ELF(4$D 4 (|S |S 8\ 8 8 prPtdPQ P P ,,QtdpKK##Rtd8\ 8 8 ss K J IF{DX[X I0hyDP FQGh F h FhUmBUF#hO1 ")F+O" HC0`O09F"hH HCF1h"hH0h!hS7`#h!0hDF %`-OF$$$ 4F%F {DX$ h  F $ UFQFHF;FUp(@ D%*'   ! Zlrjjrjjjrjjtrjrjr[[[[[[[[[jjjjjjjjjLjjjj jjjjjjjjjjjjjjjjjj-N Njjj$j'jjj*OL / E0:D+0 (@$*tFF~FO !sFx0 (جKE{ L /ErD$*ъEXF UEUF  BXF"B%FU4 **ЙF@FO !F 0 ( E3 I /E*D$*ъEXF!UEUF   BXF B%FFU4v0 +?+EUGeh(  GgG@ZGWW0l+  GMG JGwGGgD ЌBJB%F' B?B%F'U\FG_ МB)B%F"x ՜BB%F" ՜B B%F " ՜BB%F"x ՜BB%F"9 ՜BB%F"BB%F" ЌBB%F'BB%F '}B B%FU4  ДBB%F'WBB%F'LG_ МBzB%F"W ՜BmB%F"Jx ՜B`B%F"= ՜BSB%F "0 ՜BFB%F"#x ՜B9B%F"9 ՜B,B%F" B!B%F"UTFr*p-$O !oO0""#!` H Bщ 0+#D  4Ee p/R'JDGuuu p)'Dp.#'D#0h60Q& %O6Fu`0BhR0F hBROF R FR<-ONF$KJ~DV h X9`FJ!F "(FE*@4MdX!(F"R 5(`YxL.OBӆ`+D(#a p-CF1MOpFTF}D`-IjX-IOryDOrO0IOu!*FERzh0FE#I#yD"IFyD#[Fx`hxEH9FDxDPRw-HFh75X%=PCHahxDP=hoCBHxDPHxDP/ FTQ0F 8IJMpC_@aD@Do}DDT@p DTDT F(PJIX"FyDO 8 F8 KJ{DXxJzDh+pGt Jd pFL|D4T90F4Q((FpFpR FL FRh|DNOQF~D)h#!J0FXTOKXxFQQ LOSB 0F#|D)h#F(Fp C C OQKJI{DzDyDq##x]nC Hs FQh#F=FQF HѲxDOF0F)h"F## )h"F##hFHxDO30Fp-AFRhFF)F# h##K@"HxDO}!H xDOH  xDO,QO 3+o+#F1F"FQ1F"FhQ 1F"FhQ 1F"F(iQ9h@F##I FF4LFSh|D2I#yD#(X/IcXx ,HxDO Jh*E"F1FQxj$J$Hoh$IX$K$XyD{D"h1FhQ xOdhYT 0IhKyD{DOxMdY"x FI8F#yD#o+L x_B-FQh#FF F1h##lT۽ *)H!xDO3P&H 0xDO%DO$8F!FO Ol F!*hBQ# -AL!*F #"w(|D1KX x6?.P&OONDD~DB U$)@F) 8F0FO4 O  , - . -GFOM OSNLFF}D|D`Vh+`&JIKHfXxD0FE) EO2FFIYyDOo1F"E`^:J#5I0FyDQ6#k`2M2JfYzDTh0x( OQO`$ $J+IX2FyDOJo&K{Dh\` $M@FOS}D*F`h"!|$||DDD0x8 0B (i B)iPF4O5 Or8F;       d; m .; ; : : KJ-A°h{DXxFOs, @%OE"F%`"\H%D8x@#hBJh!hBQh@F5O O0FB aKJ𵛰h{DX#h%F]#"$۝@B(F`F HO  xDO0F*hBQg -CFGLF"FKFFI|D{D"`[XAJhxF-Or)b`s"FOS"(n۴DUQBHB@4eBдEr1EдH@B$ B@$@N$Ot$$! FQF#HxDO*o"cJ8FhzDS`OS"("NOO`~DDDE_Hq0FAFO H8F O OO O09 F 8  + 8 'ThFFh#"MFB hN~D1F(H1FxDO F*(H!xDO FQ((Fh#B}"f((Fh#"( J I(FyD"@(Fo$8  n -CFMFFPh}D0HxDOo++Ph(PFh`(PJ!X,x ~`CHF jF#" = sF-MTh}D$!#"M)L+Yx &HxD)$HxDO;)"HxD!HxDOO00I FyDQI FyDQ#I FyDQ#H!FxDOo H)X x-0F!#B]"0Fp, p-GF$$FFFDP_ 4<+H@HxDO@`>I0FyDQt!;I0FyDQl!8I0FyDQd!0F*FP3x,8@.I FyDQN +I FyDQF (I FyDQ>  o+2#LXP.xPFh#"!9h/xHxDOS*IX x-PFhB=#"@F<  lYs#+LF FRh|D*+щhjF#"(E%NY+x ) HxD HxDHxDHxDHxDOY %HxDNFFP x(4T @"xjF#A 0Fh"o+op *1_-AF&LF%KUh|DXhF-5(FEF8* O"@#IYyDNo"KX x O !( "Or)F@# bFC@FhjFD#"4o+6hBQK FFJFhhzDo+IRXxPPh(PPh8FjF#"h F*MFTh}D$h#"(G%OY4x\"HxD !HxD+HxDHxDN N` )I FyDPO3I FyDPI FyDP# H)X x-8Fh#B]"o+ v@-OL$FFDP/ 4o+ hhAFPMFx*,ШhAFPBF,=M[P(x(4 2 8IHFyDPO#5IHFyDPG#F AFRFHFPF x*,+,i+I FyDP0#(I FyDP((#6?#h"'*x HxDNA,M[x6?DFh#"8F . d-A',NF FTh~DhBEjF#"{(D%MqYx #HxDN 7h+/I FyDPO0I FyDPO :F FPvx @@ OY4x@FhB=jF#"|O0o+ĸ "!F"ch)"F"\O0pG-OFSMFRKOR!QL}DX|D8h FChNI FyDDOQ FR]q HIIJU PyDzDNfo+qDK On  XD)x) n"OBD o,D_0FOqJF#F!0FQFZF"(@3 )xnCFt`x$DDD(xP0B Ah`B  0FQF4'0XFQF2FN NU o, ?hBP ҷ /  2/ . . fI-OFdM"yDC-F"_(}D_H)X x thLlO hWFDDPXH`XOxDNDFDT PmBeE 8FqhN4F Nc +*4  HF"PCFDH$)XXF1Nx"R@,JIF@hP4(6Xhx-) J 'C-*O:% F;x)IyD!6UE +9F*F[hN/4FT P- N1(F NFHddYxDODDAFDNHAFxDNIFZhN@ ZB HB 4A $-OF(FThD,̀I FyDCXI FyDC(@DD HFAF"F#!(ih-TѹHxDNHDDxDJZ0xgxa"xaAEXFNO44l<bF N)FH5 xDNuH#9sxD:Ni- I(FyDCI(FyDCzI(FyDCt`I(FyDCn(;&F&&7NK~DHDI J{DxDyDzD0FCF(6I(FyDP%xE!p7Wl.W\-o+(F P(rI(FyDP(pI(FyDP&x&lOlHZ0xDN0FC Fй F(FPAF)ؔ,@"p\M #\IZ@yDd0FCFFF(FPb(FcxFKL'MIZyD0E0FCFйFF(FPC(Fex%@bp{;O!Z`=IyD$0FYFCFFF(FP"OqFB MZ0xRT(NZ@+IyDN_S"O2F'IZyD0NUIHFAF"F#!x (  F4MFTh}D,@2I FyDC$(0I FyDC$ -I FyDC(+I FyDC$(I FyDCX&I FyDC($I FyDCx$U P(x8FhB=#! h#!@йKXx )) HxDHxDHxDNo+ ΰ Z"R-CF𐇰 FPhFDo+h! FP5IF(hyDCF$h( FP F ,KY xF?!!Fh!$NOp:F#@F~D)h!A(-,1hP HxD HxDN4O& FO1F2FO)h@F:F#! H)hxDNO@F 0' pJ-AFShF+Hюh.bIyD!('\I&Dd+OVB!%(o1+--- OrBԿOp²+ܘ+܀3o BBI@FyD!O0o+;xtcBFiLFUh|DUhHo+%XgHxDMdI(FyDC(HbI(FyDC"`I(FyDC^I(FyDC츱\I(FyDC숱ZI(FyDC XPN*FWIYoyDM(FDORJCOPQI0FzDyD*F!FPAOLIYyDJJzDMr}hHO(FD9FCP8IEHcXxDTMCHxDXBO(FD9FCP/H%X?HTxDM=HxDFHxDM F $.-LE4گ]8FLx0 *в 8FLz08FL7Ȳ7ز(wE 04>6LEԿ oO0p FLFI|DyD FB0Fh"FOc (I# F6yDOaH I FyDO[(!!!HxDM p -OFLFIM|D FyDBO{h}D+;OQ FNP}h Aw~D(FCD P DE JXF@SFzD FnE2x, ". ,!-O  XFOq"FOS F(@GH)X%h x-N$O~DDB;0Fy4M M- ݡN~D B4$pMKHD}D  {DxD ,!xJ*7 HxDMax)@򶀐HxDHxDMIax)؍HxDxHxD)ъHxD )щHxD)чHxDHxDM+ax)@򍀄H9xDmHxDMax)؀HxDc%'~HIFxDM{K|H|J}I{DxDzDyDOE# .vH xDM MKrK"(F{DAB(OF(F"A:(@G.7X)xjxxMQ@F h | /0    Na(6 1-A'FMFFTh}D,.щh# `u?NYx* 9IyD8IyD 8IyD 7IyD7IyD6IyD6IyD6HxDLN4I F"yDN61I F"yDN!-I F"yDN!#)I F"yDNv!&I F"yDNm!"I F"yDNd! FiF:FNx JX/x$@Fh#BM *@Fo+ .>AJTVLG*FxձBF+ L|D4T XT0F:FN 4(%F(F2 -O }XMFFXK}DX h(SIyDKFQHUTPI  yDLoLH T xDL0F&LJ` 7F  !Or#FP F XFh 5JfDXx 11F. LL FL@ FLF*HxD&(H"2`xDL 0h(O XF!2F# ڸ h2hU0x2`2h*HxDLI yDLt FK8Fo+&hBNL }ޚ g-OM F!KF4"}DXD0h FA IJyDzDXk.*0FN(gЛI0FyDN(c#h+ٗI2F#mXIyD@0F"NXGEэHRFI,XyDPF"N 7HFKC IPFyDN PFYFNG  vLyI-YyDRF3FL&hNGoJsHXxDLq&D!`7qF'O FkI 4#ZFyD (@"h: F @+AL쇹 4  DF3EC FCѹ $$ 4 F2EB XFBv&  @{ HaF"AT `u6X&_.%8L")Y=IyDLUI.9IU yDu"PFIFNFRE)O2IYyD0L9&IFPF"N~9!HRF*I-XyDx*Ѡ q)@3B XE N HYxDL oFo+!hBN'h/бF7FCD :W-CFF +x+c+0O  s%x%Ng (F xB_0= -%8FK(/i) `P5K FF4J%4O{DXDr2O%3hDiri*H"3Dzh%mzi D\5$ODuhkh%ii aaD!ODukhhh%hi!!DODukhhh%hi !aD\%h6hBN Ĭ -CFhFGN+~DO0P@F`CJCIXO2yDLosO8!BFAjhD;9IH8FFyDF(M5I8FyDV p3 8F!"FCF]F(6*HxD*HxD L4!x) FAFO2A` FO25AXhhF(IO2 FyDAMO1 FPIO2F8F"FyDF8 H%6X FTL FP(FO0 !-OFhFIFO FyDAIF FDyDAlh8O,8hι*@3 FNFxNN"FIYyDLE JETzD*@𒀕I FyDKFXN"FIYyDL,o 8!@b3FD PlF0FLPFH"FxD0FL;8H!FxDLO5ѻHEr3BOлEKzHxD!F*FLѻ@4npE;sHxDo ѻHE/nH!FObxD@BB jKDUQ{DBgH!F@BxD-ееoaHOsO On!F*FP#xDLZJ$zD`PWHxDL( F1FBFNRK{D`x@EFDT%@1F5 F"N E؀x)EH!FxDLo+&FBN~D1h@Ho&FxDLn8m)Do:HOaoxDL`*7L |De`ESPF"F#`[FF.H!xxDLF,HZF #hxDLZѝ *?I0F"F#yD !OYx:I0F"F #yD(?6I0FyDAF CѝI N-HYxDJ8F0FT!"F#J   & T  t Z D    _0FUL!UKD"|DX(hhF@8Fb!jFD#(MIdX"x KHxDK&x HHxDK'x EHxDK #x  BHxDK x ?HxDK"x I(FyD@?h;-GFEMORFF!CO}D(FD?rAI(FyD@`h@Fh*FOSh9N+hY'x@3HxDJkT! FLFho+K! FLFh(! FLF i(! FLIC A2H1hxDJ>o&`EIDW pE;xPOQE DHFN*hAOS@FI hJFGչ@F { x -OFFu!#Fs(D<[H1hxDJO0XO!FORD8F?UI8FyD@FhhHFh:FOSO MNLȍ4+"(DT5\  -OFFPhD8~IyD@ TFO`h! FLFFtHxDJoqHoxDJF "XF!?kKYxF*,GD!)FeOOR!D8F?bI8FyD@& -+FOc30FOq:F> VI2FYUI0yDJ J p|p$1))CJzDBJzDBJzDAJzDAHxDJl%@H!FxDJf>I'yDDDB y9FJT PF{7JM J:1I@F-,FyDIF(+F!"FD JBF lO6&IY yD"FJ"H!FBF&xDJ(FI NBFIYyD0Jo0Ft  O}  T . -O L t ~ X ?  $ sMRh}D LOSF|D h%H)X FT1I,0Fop&o Sh+x h,#:o:HxDJl9HxDJ7HxDJ5HxDJ3H xDJ1H xDJ/HxDJ-HxDJ+HxDJ)HxDJ'HxDJ%HxDJ#HxDJ!HxDJHxDJH xDJH"xDJH$xDJH&xDJ FO0 !06AM\jt-G'L2F # h|D#I$HbXxDIc6MN"+FIYyD0IH*HO O hxDDJ@0BpL+Zb \@F5 J& J|8Fm s,"LF F!|D F>)hOR F?0FOq"F,#w( ۣiai0 H2 xDI p KF)MFQh}D)7 " F>8Fh"F #L(= ImX/x6$FLHxDJHxDIHxDJHxDIHxDI  JXxFKKh8F"#Nnl  #.<#QhFFa+IyD (MOd $@(O  @O,FIyDIyDH*F1FxDIL 'FIyD?f"OEFh"K#xOqBOp I@0FyDo+pQF NFTh~D4|HV @xDK{Dh H!FxDIhUOHYxDO6IIyD h"H)FxDIJ!F8FzDFH1FxDI>J8F)F@zD0Fj > NWv hsph-O ]D%4 P QF |DXH\4yD0h{Dh`(F? dYxDs(FyD?xD(FyD?xD(FyD?H|xDTO*Ir6l(FyD?HdxDTO*Ia%T(FyD?rHHTOp:xDIP8(FyD?`F@,TFxDI? xD~hxDxDh) 1FxDI hOxDo+IJzDh#H9FxDI MI}D(hyD?$(@cܓH H 0FDIFHF0F)FA.H?hA2FH1FxDIF8F0HF(0FoI8F)FAh?hAFH9FxDIO60 MF0HoxDIz!ZFSFMFPFHXEHxD)hJBHxDI h  HxD1F !BFKF0FMFHFH@E ںH9FxDIt(F%M0FAF"}FЎO+Zb ODDvF EwD a !O2n`O "~`E  !h"u`  %.@󋀗H1FxDI,I"yDFHxDuHFHKODxD{DD . IeOR!@F>@F?mFYOp`QF`h As ZF>  h_D# IrJ@zDFhlI;FlJyDzDID.XD IcI:FyD[F@`HxDIO7(FM8F1YI0FyDHMF0F50F@(@QQIpyD h*OH1FJFxDIMI"yD%FPJI HJyDzDIg aFOrXF>FBHJF1FxDI\@ID@J yD zD }HDR0j x X S]8R  N t}'   D j2 UDm^L < OBDXFaF Or>XF!Or+FMF(Jи;h#HYFxDIOR!HF> HF? BFAs YF>BJF@cF (IJcF yDzDI (FI(ѕIJyDzD (FIHIJyDzD3FIe2(FHI8FyDHF8F%Io@F8Fp9F #yHBFxDIIYFORHF>&HF!BF+FM@EF0FIO>uN(FH~D0h sHIFxDI(YFHF"6oIFyD h2nH9F*FKFxDIkK.O'O p{D h P J, aHYFxDI`JoAGzDh&\H9FxDII(pYO YKYHZIZJD{DxDyDzD .QOR!>F?8X=OqIF< 0As ZF>T h]D0 I8FI  :b ` qX & ;fu}-CFFD$&O  F,!@ FE F?~ ( I #X I"FyDH#x F< /!F0F>\ F?cF 7$6-,FO08F` pFz F!F2>#+p0zhp1xp%h&` p-O PFFF ?)D.D۷Bo  p+KF4{DyhYFPD,2F$ F>8Z 0 xA- hQ- IF*F>$%8FP` p F FFF ;0FOq*F#FFp JzD IyD h+ JzDB#3 `pGHIXyDOrH7pGb_  YK-A$OF%F{DhDB W%@ h`AF>@4 h( F 5 K{DhpG HxDpG 7I8J8H#yDzD pXO15H`xDp3HxD')*?+/,,9-%-. ./i/y//00C0001m122233?3'353C393475588#;%;<<=9:3@4 ^ $^ p_ sL!*F#F(|D-JHBI"cXpB0F!*F#(NY+xIV. yD ` H# I$XyDHJO0plwwl] T #P# 3FpG-GF'MFF(}D?#NOR9h~D0F>0FOQLKF iFXxF`h""JUJQJUwzDB  iFh""J@J< J@,h@F zDQo+]  v -OFhFFT4hD F,RIyD>(QI FyD>됹uh -}LI"F^F,FZJI0yDHO0|GI FyD>EK{DpbDI FyD>BH"xD+AI FyD>?H"xD!>I FyD>(M(F9I FyD>7H"xD 6I FyD>(4I"Zp*2I FyDJ1(0I FyD>Xph"50J*KZ`phB.F M"F%IZ0yDH>O0 $%F^F$$F6 F $%F@P>`Z\  o  ~slh fSJ$pF h F(F>m(0FIyDIyD*F#ip@HKJ{DX0 zZ KF{Dx((HxDHxDHxDHľ? )`]-A'(NF FTh~DhLBjF#)7 MpYx-hJ.I FyDJ`!I FyDJW F:FJ'x JX7x$h@FjFCM#2FAFo+F Z -OF/MF.K$FF}DX#F8h`"F@)0F"OQF0F"_CF2Нp(/НC)I FyD>RXI FyD>L(I FyD>Fй bHZFI&.XyDHo (P0 o+8F)BJ+bY :2-#p#MF#K}DX1h!X"F IU 0yDH(@O`R @P@P_@0`_o @P`@``iF F!F H#F I-XyDH 6hBJpX  JF LzDh|D)(FH$X"x [F W -OFMFKTh}DXh7 &I "&F8F4FAxyD"h2F8FYF"vB](iНNb) ѝM@xLxIyJ-YyDzD6+ +׀pOsJYzDqIyD4D@Dw)ѝM`NhJlIXlJyDzD4"6+DT(+DT P+DT+D TCED@T&UL\I\J-YyDzDHorbMNUIVJYyDzDHo+zFLQI*YyDOJzDH.,?h F;(FO   !BFXF'=$`BNORHFCFpZF~DD3B 8K6'ܰܠ{DDD)$I:FmX3IyDH+XhB" ( 6 7IFF!#IF BFOPFH{!H)X x* H F7hBJG"9W jG0E>-f J-OFL%KFFO)FOR|DXD0h38F=8FOR>8FOQLF I  , *F+FHFFFyD"K{D1FHF"Ay(>b( ѝ=9NIJYyDzD0" оMsFIJgYyDzD E@Ew(6ѝ= JJIXJyDzD02+(+P+{HIJ$XyDzDHoEUEUh)pOxIyJYyDzD*EUc(0AhMrIsJdYyDzD"JMO л ZJfIXfJyDzDHao+SHbIbJ&XyDzDHT-?D(F(d"`  D DTNXDJSH ~D$Xo,'x/ n!OA wK On _@FOq2F;F@FIFRF(; #x n YF)`wP%ܐܰDDD x 5JzDh`B 5HhF9F!XF9FRFH H4 o,3hBJO O 5 U  |h{DcsEdv`$ Ǟ  > JF LzDh|D)(F H$X"x2OlAL F Q -OF`PS Y" 2LCI*YyDAJzDG## F(F?9hDFp7H!FxDH(!O5JYzD3IyDGи H/I/J+XyDzDGpƹN+I,JYyDzDGe O00F-hBJ?O o+/O |N*QnZ 6$ -OMFFKth}DX h-"乻hB+9h((tFDIF!HIFZFxDG F F!F(@ӀI  "FXF#F F&FFyD!"FXFIF!C(&c( ѝ% BOIJYyDzD,+{I~JhX~IzD0yDo#C"b("ѝ%IsLwIxJ.YyDzD*\,+ +ĀkOqIrJYyDzDMo@oLw()ѝ%QhIiJU 0yDzD,+ (+ P+WNbIYyD`JzD&DPDPDPOs(~%0CJOVIWJYyDzD,^. CLRI*YyDPJzDG2o`+ODtX>`PS Y" 2LCI*YyDAJzDG## F(F?9hFp7H!FxDG(!O5JYzD3IyDGи H/I/J+XyDzDGƹN+I,JYyDzDG O00F-hBIO o+/L >;xT-"J׿`JK-OFJO LF{D F!SRF|D F0 F0IxFMHNI"XyD*FF( @ EO*FGIYyDFO;iPFJ@FX=IRFo fX>IyDFX!RFCFJN(F3H #7I"XyD*F PE *F2IT 0yDSFF30F";@P+H)FxDFXF1F:F0F";0령"JzD!JzD!H)FxDFXF9F2FKFEF MHdYxDFO;0FJ@FEXF!hBH#9 O=19:Q:@KTh{D$ L HYxDhYhRHX HxD1Fxo+!F"@7 rz-GF FFJIJLyDE|DFXGJHIX*FoyDF?zF1iFHx<0h=F;H*FC/(l *@! <;.(łr noѱ!FI=(4FO= B-S FZF ;>#: "p n@"5 F{DIAnr;쀻 ,ud%YzDXyD5PF;쨱m0suSF@@%YPyDzDt>H "O h; v;숻<xc/ \$Y 0yDzD "Gx><qh d$YPyDzD3'nc(0<:xc* O\$YzDPyDx "G x '<<(N(($YPyDzDxIyD;h+ٿJIY`o JyDzDE;IyD;`<@MIJYyDzD0 "lIyD;p*ѴI@FyD;LxIJY0IzDyD* **(*P*Р*mNIJYpyDzDCFEO(O(O(O8O8O@8O(>/IJYPIzDyD mZW5M}I}JYyDzD0E*Gw  &GAw' H# CFWGS CRFo+ FIHF ? hB GA SN\I]JY0yDzD OVIWJYPyDzD:":A:0 ͱWrƕ85fAS ۯA'A/׮iqǯ[CuxHíY/WG1 ݬiSK9#ssS$FFF"!FEM:r0F)F4"G; Fx ,ѢWBW-AFPh$FF@iF HxDE@F9hjF# H)hxDEY0FO0 FX p-AFPh$FF@iF HxDE@F9hjF# H)hxDE+0FO0 Fo-AFPh$FF@iFt HxDEq@F9hjF#r H)hxDE0FO0 FUo-AFPh$FF@iFF HxDEC@F9hjF#D H)hxDE0FO0 FDnFhFFPh)F HxDEh(8F1h*F # H!hxDE8FO0 n-G#qLO FFF|DDPhkJkIzDhyDDD `#FAq !F(PF;(њ:(8) rD!FuFLS(bD!FUOSM!OP}D3u*F0F9h1څ)F /}/|X 0TE*qhOS`0F`"F#9h ax!xbxx'yey5HhxDhELArGhx0Ӳ +IFJFG/`O0`hPx-,! FG!!K{D` J!zD`(iPx--! FGIyDaL |D aMAq?h}DIOR0F9F*F0F % a ~ |  N D , "  FFFI(o+`hiF(!h FG1h8FjF#-CFPhFFo+diFoF(0M1I}DyD(F;OQ(FI2CPh(! FG²*q*#HxDEo8h(! "Gq@&qy/y@(@#/y - #qLHFOS|D"F( F H"xDE H"xDE L gƚ 0?-CFThF,V.I F"yDG+I F"yDG`)I F"yDG@&HxD &L|D%L|D%L|Dh#$HxDE'/"M& F!IFOS}D!F(FI F1FI!)T F1FIF1F FI Fh)DH@F@*FCPo+LB<6+ -AFPh' FF(?!F:FGx*)HxDEUo+(HOgxDELI0F"F#yD)hVOOc0F)h"F#D/ HyxDE.O00Fgr& J-CFFFThD)HxD*)I FyDGȱ'I FyDG%I FyDG#I FyDGh!H!FxDEo+*$$$$h HxDEHiFnFAHhxDKYx$J #zDFEKP`@Fh kj~xp8 𵅰LFFSh|D{h*F#(#OY&x HxDF)8Fh*F #( H!X x HxDEz o+ tt-ONFK~DX(h%0 IFXL0"I6YyDDLo=!0"O:,!JKMDHIzD{D}DxDyD р8F@"!:+@dXFDIF:<("XFIFGJV XF=!<F I yD @#B8F?*?"9hx(@ꀄI yDZFDo+P--@܀XF;V(zI ZFyDD%P%vI yD s 8F: 0(F`OAF"(VhH xDDoF'FǾ 0_I;`yD5uh8F"F #F(2 (FHxDDG)I(FyDF # I(FyDF(H)FxDD2 h!0 HxDDO78F"F #F8F81#؜-OFO pFFH+F(%!O r9%`@ V(`#`MOP"FO s8F}D1h8%0@wHxDD;uIhyDʇkhpHxDD)O nMnHoOoID}D xDD yD EXFhN FQF DdK~DO {D #FF3Ah+jDD/jid 8 D ;F\ Dz2km '*mDpDm 7IhDg/GHOFOxDDD]Ch3j8FDS DO DO gFcFl(F3+D D+0HLOxDD*,J-IzDyDOd l D*EDE  5g  DV {Ho+ FHo^ d  >E\^~-CF(MFSh}D+C&LOR h|D F:8Fh"FOs2(7H)X x!h L%HOt|DxDDDDDN~D3hB F&qF)F8F D @Fz6D. 5D4 HxDD D   ĠӠҋ -GORmMFF h}D(F:O8Fh*FOsD(€ĕbKXx- ##FYHxDDXHxDD*`UHxDDTHxDD*bKQHxDDOHxDD= =FGHxDD-EIDyD@F:bFh8FOsm(b?H$xDDDDDB @FD`PFD44HxDD2HxDD0HxDD  D ))IDyDPF:8FhRFOs#(#H%#N#OxD~DDD 0FDi8FD5MEN \     ҟ)z^ ݟc S-O-#4tFDВFF$F $T4zDxDyD}D{D$?XyDzDDo(F98@CZ_-7(F9*H(F9$0(F9 (F9I(FyD9(I(FyD9 (I+FzXIJFyDC& $,$OJX(x hOSXFBIF#D(@{(x0ZI+yD L"I>YyDCo,cJWK{DZ"HxDDRH"FIxDyDD./ޱHIJKxDOyDHzD{DIJDKxDyDHzD{DxDDrK휺O *x{DD O, PIOJHyDKDIzDxD{D"FyD h`i?ah-`iai?a]i-]aj-bXjXbj?b Z iHɪn ;(  EiI}DyD+`Ef((I@FyDC>&I@FyDC8X 8FiFO PFE    q  @IjXI2hyDABL-Y(x8FhjF#F @FpBC h5y-CFLFK!"|DT 8F6uh%JHXxDaI(FyDC SI(FyDC%5I(FyDC(мI(FyDC%&I(FyDC%I(FyDC%I(FyDC%I(FyDC%I(FyDC % I(FyDC %IbXIyD*FAo+hEIHfXxDAI(FyDCd#I(FyDC\@#h ]MHfYxDNIYyDI(FyDCF,I(FyDC=!,vHI'XyD5i%rH&XHxDI(FyDC%%I(FyDCH%-Pui]fK}HXxDcJ|IXyDzI(FyDC.vI(FyDC O.XqIT @yDsi5@lHT `xDvkI(FyDC hI(FyDC eI(FyDC( bI(FyDCP _I(FyDCX i/}YHT`xDDАWIT 0yD/TI(FyDCpRIHFyDn(NHT `xD&MI(FyDC(KIHFyDY(JGHXxD$ "EIHF00FyDFO?HYxDA(FOY:IyD9IdX"x 8 pBCg +//4 iԆȆf4| 3 3nk22kJ2281eeeeeօ-OXtFT4 hDW*# "F: =$$TxDA~Yp0x7F  ADD FIFIFHxDA:xq  A(D AFAFI HFyDC8IHFyDC0 K%JFFI.FF{DzDyD P׀XF C_(ÀXF CX(XF CQ(OѹI"xXI0yDRFXF C CZENIYyDzHRFxD\sE 2*NZFYIyDg0@  p0KALH=YxDADO JD_8!.٨MIYyD$"XF Ce _ZEѠI|XIyD' x r^DDֲjg ٕKIXyD0"[F@"XF C; ZE ыMI~YyD@o+ _ ӄLH?YxD@o H_"@ -#FF("FO "% ӱ͹+FB 4  T3.@O  PF *7  ݹOEN1"  J cE#O E @     1vp&(+-OO E    qvO pF* q-eOEN20F B#}O E  P  PqMY8xp!pqO"Fqh*#mFPF hBC {0!:09IՃ߃:5t\-OFYFFhORI}D(F6ph|D@ xDAo+9F(OQ(FD~+8h *FHFOc (LgX);x M@ )xD8 xDAwO0G z$Y}Do x)zD EyDh-(zDh`xDi`-(zDjaxD=kb-(zDpc xX}Dp+0ZxDxDrhA`&@AxDAxDA ihxD@|jxD@hlyDhyDd(zD`(zDX8{DT8{DTxD@LyDhD(zD@(zD<8{D88{D0D,DO(D$DDDMDDDDDDwDwDg~Dg~DW}DW}DxDxDW}DW}DMW}DW}DxDxD xD  @/|7{Dp'zDl'zDh7{Dd7{D\DXDTDPDOHDDD@wDMdY#x+IyDODHxD@M"x*M}D0N~DHxD@='x/HxD IyDHxD@-&x.K{Dp9M}DHxD@!x)JzD`1HxDHxD@ %x-OD K{DHxD@$x,JzD`1HxDHxD@ V  cU rU bU PU @U 2U $U U U T T 3 !  fDT m{[pIg7Z#MB=6R ~~B5~s~a~O~=~)~~.R '~[~P~~~"~s~a~O~=}+}~2Q ~P P ~P P ~P P |~P P r~jP ZP e~BP 6P a~ P P R~O O >~O O 3~O O ~O xO ~bO NO }2O O }O N }N N }N N }N N }}rN pN ~} N N o}y}M M A}LM @M "},M M } M M }L L }L L }L L }L L }-OFx8DX#hh/}X.xkBBRH`X"cmt FP.O@HO@ gHH H 8 |PFx|QFxD@*)x C&**\yDXyDTyDPxD@ )x1N`0 @#N4xD@*x!hJm.Ѵ| C"m)Ѵ| xD@PxD@``)x6xD@xD@xD@qxD@ @ HFxD@FxD@xD@(x&sxD@xD@p|xD@1txD@hxD@{`xD@tpTxD@m1LxD@fr@xD@_8xD@X,xD@Q @ xD@I*x8ak Y @(xo8.Bдt Q+;дt FFD  PFIF"mFȱ ٰYF "4f 8 vD DF0FAF0"L(x#hk"*Q)ہa`PxDLxD@?H`X@_FHF(IFH0xD@$@OyDyD _² и_ и_ и_ ###P#(#xD@XxD@xD@(xcm@"xD@)xfm6@ xD@x*xcm!xD@lxD@c#DFFD d@ _q C@F1FF@L##dA  C+HFq@8[F6. @a 2HHh~?X)q&'xD@v$DDDDzDD~HBSZAo`hЀ 1O.N EӴ`p1EӴ`F+++. ++d$zD`$zD+XF9F ? 7 /~D&'@@@xD<@84DD4$DD{DzD x^ HN 6g0x6a@6] ORN@F@I~DRF yDvF(@O`CF@HOaoxD?Pz # \&F  x"F6(@#)F8FObA"iE)((j*&g3F+2  "4tL@O ѕf}bE4`(h 3FlHPxD?૱hmCF(J`HxD?61h0FC(FC8FAdO PFC#SO @FRF#D9FFh`@F9FRF& 0#FP:JGI[*FyD0?MF, F(F?>hBYAx`FT@; 44 @fF< *?8dѳRE ڣR T@H?R A dTHxDHxD?`A& !br(rrqj= d|q qpppooKI-OFJF{DyDQ'S " y!0 @4th F5k(٪H!FxDK8F!F"Ah@A<Ʋ8F)F"A& L ! "HF4 ( 9F"HFAD!"PF4(FYFRF#(@ 0 (FYF#B RF0!F(@FH !BF6څH)FxD?O0H3JFCHxD9F" F4p#(F":80!FAtHxD?|(FA O`CFxnHxDDDDD kHOaxD?\(FAo( #Ob(F!FA5!HxD?50F!:F$# ?0FH"Xx 9(FeH)FxD? -BA. n7 27 7 \mmShpFMJ}DX2x F"`"Fg($3x h `1xbhb`h6```k((m# IU PyD> ``p p rl-GFiNO0 FFCF~D`dLeI2YyDO2>oh3ORxhX")F@.Fx!o+Oi"(F!4`PJX;xHFOQ*FPF#IIyDd};xeh-e`h`h F`5?HxD?``k+6Mm#:IpYyD0>?"b`` PF3!"FO3BF(L'FEF?x%h-'hzhk+ #Om#(IYyD> O hE HF  J0XxD- HxDHxDHxDHxD?YH)FxD>%EF FC (F( 1lllk"kxkkkkkYK-GF5hF F{Dx(F 5+(F) (( ( (( Њ"(( (Ђ@(B(}c`8F)FZ36?I(F"yD@k(n5(F 4Aa`*xj)F"@F5AF@F!"@ eh - -P'- -J'''`o'g@cg =DDDuh-@F)F"@% ah)% HF)F"@(bh*%%gPF)F"@ `o cg (F9FF8F"36O0 kjjj-O۰Q 0d /  6!A{DqX!).A3h('!&Y1%,$-1#!A!T&+PF"1*zDh|DQh V  h ah!z@hpQhB: { ~H y zNP { ~<  z2> {:xB@BD4FHJLNPR18 t5"!D F{Dz B! FB#F!F8FBWDOB 45"! F{D B}! FB#F!FPF #B5)QB4"! F{D *+B]! FB#F!FHFBOB 4"! F{D:;B>! FB#F!F0FB(ZB*4"! F{D*JKB! FB#F!F:B.HB H4"! F{D:Z[B! FB|#F!F<B'ZB*4"! F{DJjkB! FB]#F!F>B-HB K"! F{DZz{B! FB?#F!F@B|&ZB*K"! F{DjB! FB!#F!FBB^OBK"! F{Dz*+B! FB#F!F0FB@%OEK"! F{D :;Bh! FB#F!FDB!,ZB*K"! F{DJKBJ! FB#F!FFB$HB K"! F{D Z[B,! FB#F!FHB#ZB*K"! F{D*jkB! FB#F!FJB+HB K"! F{Dz{B! FBl#F!FLB"ZB*K"! F{D:ÊB! FBN#F!FNB!HB wK"! F{D*B! FB0#F!FPBm*ZB*iK"! F{DJĪB! FB#F!FRBO HB [K"! F{D:Bx! FB#F!FXFB1PH/0xD>Q-7-X ' 8FPF>YLHF0FBH:A@H@B>xD>9=HDFHJxD>/9HLNPR[FxD>#F:@<0NB>H-HJDPRLxD KF RF 9F >1YhB@~[OpG iihYhhggYggffgf)feeue9edddId(dccccc-CFFF0F!"34c[HxD>ZK {D8/$3If (F!F"|(F!F"t(F!F"l(F!F"zd!F"(Fr!!F(F"k U!F"(Fc"!F"(F\#!F(F"U$?!F"(FM%!F"(FF&!F"(F?'!F(F "8("!F "(F0)!F "(F)*!F "(F"+!F"(F,!F(F"-I"o' 0kFyD @F aF c"<9(/  HxD"HxDHxDHxDHxDHxDHxD>HxD HxD>HxDHxD>HxD@>ĺ*bHbdbbbbbcEc|ccJd-GFFF"8F!F3.T!.? -h,]@I)h ] D+h]?-h,]@:)hkh ] ]!1)hkhh ]" ]$,]#@$+hih]hh% ]( ]',]&@+hih]h) ]h-i- ], ]+ ,]*@o 0 nF_HF2 s&L|DD)% bhF+Fp@Fhchp@ahFhhbhF%hh ph-OFxFtTpt xD}DFF`$!D\4 F XzD{DxD  ! D@F'!"=i3B{h^(tY(xD=[ "! ZFSIyD"!- ' HI:XyD*F=''O 8FB=FH)S1=EX*  B%  Eӻ  /Fe 0F)F#"F0F"F#)Fx)F"F#0Fq0F"F#)Fj0F)F"F#)F"F#0F[)F"F#0F0F"F#)F0F)F#"FD)F"F#0F0F"F #)F0F)F#"F0F)F"F#%0F)F"F #)F"F#0F0F"F#)F0F)F #"F0F)F"F # 0Fo FO OO X0 B  E  E-?O  8O IFX,OEPE""  FEO O* FI#QZFEO RD  aFZF -@IF#X#3 R BFO )`ZFI# ( E PD  0QZFk X#3  R Bҹ РZFID  O E HD  YZF* -D7'X'7BB-44L,¯ rIcbbb-OF8VF46F}DX h!F#XF!( C beYxD1=O0HFB1F`E-YxD=o!JF2O-:p',:0L7 BF: @F/wh8FyD308FyD36''h@FyD30`@FyD36OOphX(jX@ yD=XF"FKFU 0xD QF= QFxD=,-)-"O6xD=|zd#"hYx"`FQM[B; : YFNF8xU xD: DYF=FPX*XxD=F,:  )F00tdYxDW\\\$xDyDzD= !hL$zDH$zD@4{D<4{D<  88xDyD=QFD($FXFyD=QFO FXFyD= OxDyD =bzHI xDyD =HIxDyD=+ *.  HxDHxDHxD HxD HxDHxDHxDHxD= 6P!Kh@(Ee NYoIyD=xO!+!+[B*RBRBHIxDyD=q J -;k]HO#I"xDyD=W H -ia HO#I" xDyD==HIxDyD=7*P-ЉH*QaHO#%xD =HxD=~HIxDyD= hCհHxDHxD=nH , IxDyD=2PFk2FHRFxD= =HHxD=P +2F(FO| @K:F@E+^9 ="HI- xDyD=HxD=" +2F(FON @L:F@E+kBkA =HxD= +2F(FO* @H:F@G+^ =KkH%O 'xDD=f {B#b K* AK EF *P`#*#*RB)IBIBHF=QXF=M5 O =-H'DxD=> E XF  O=+ =c{'HxDzC=@O e}HxD=    FA"0FhB?Y[t.[ZZZsF,h"F$HxD==hh8H!FxD=o+?Fx0H"FihxD=0F!FfplZsZZThh1 HxD= o+:F` )HxD=H FxD= FZxZpFh#HxD=!Qh!HxD=yLFOR|D Ff3gpx < J(FOqOSp@zDۼo+p?ZSZ X FHxD= F0 -G FL!FFOR F|D F2 F)FOR3&(F3.0IF D2F2J8FOqOSzD G  -AFF"F F!2(( +"'%&( %!% k N`kgjjjkQ k l"`l!n$ o#`ooo@   $" ! #   xDFD53`( J["F,IyD<&O0 !} XXXXX^]}^^^;X8X'X XWWiWXVmX9WX%Y)(I F>#(E FYF>(Amh-H!FxD F (F F>F FIF>@(F`v-FQF F>Fй F(F>i<;+ H<"xD<o+& EF&HxDUU,VUUPUUTTUTWWSF. TT#R#@ 3+3"F#F h(,MH}DxDih<5hh !)HOrxD<'HOxDDT p6 L, S6S0FPh# F 0o+ (!h #(FF H xDH hxD<:(F0RRFTh$HxD<h1HxD<#o+$ F2IC0F"FyDM!FOR}D(F2*F0FOqOSHxD(>"0F X yD>( " "YF0F=a9B*{D@Y'i9}D~D{D yD Dp xD;0"B  p//!D FyD6(4E}D)F"s= Bx)/ FyD(h~D9F"k=pUBx)Ѵ/u FyD2F& F"yDF1E%"O*O L+DD  Kp#Lp#pO _!3gHxDD2F0  D8F &_!3Lp9F*FxD0D0xD D/+ FyDyFZF FyDp/?$7 &{D^U > +D5Xpppq^q/! FyDN(?RFQ D@D ADA(xxD; /EhwhD77_yDxP F F CF'kX`BxY 0 FyD ZP/?RFQ DHD )pG/Sf P FBF~D;pyDp0'X' FBFyD8X'@X FBFyD('Y` FBFyDHY0CY/?Q\DT/`Tf P FPBF~D;pyDp0%XF( FBFyDq8XPE%X  FBFyD`(%Yp FBFyDQHYAY -?ȕDRFQ HD ) #/@ F:FyD& &FF F:FyD8n&Eh F:FyD8&ʲE L F:FyD@OF& E , F:FyD0&E F:FyD(&F F:FyD@&aH F:FyDHO&_H  F:FyD@AH& F:FyD8 H .?7ltD;/>d" FX Y yDZ jF(?1|$(8Q-4xDDRFD/x/? -/5XpXF!"EFsY=" :/@M P F}DU>I JFyD$ Xp'FI FJFyD 'Y`I FJFyD H'YEY I FJFyDZp'I FJFyD'[0I FJFyD '\I FJFyDH'\A\ I FJFyD]0/?pRFQ D@DwHXX/@ˀI P FJFyD 'FFI FJFyD8h'EI FJFyDv@'pqE I FJFyDe8~'EI FJFyDU8'^EI FJFyDE8E'I FJFyD5('FI FJFyD&@bH'I FJFyD@'^pHxI FJFyD@|'H qI FJFyD@'pHiI FJFyD8H/?aOD>g/@_I P FJFyD(' !RR R QxQ( QQI<: ;$V0V" QP6 P zPcPn 6   OO MOd !O4OO HNNsN_N NNMM\ MrMXMBM*MMLLLL }L KKKKKKKK> DK.KKKJJJJJJqJYJ 2JFF FJFyD8'@E FJFyD@h'E  FJFyD8'E FJFyD0x=C' FJFyD0'Eh FJFyD('FL FJFyDHO,' NH, FJFyD@'0aH  FJFyD|HO'_H FJFyDi@'xH FJFyDW8H/?xDh/@׀ P FJFyD: &FF| FJFyD*8&AE\ FJFyDH&O.lE < FJFyD(&C  FJFyD8&xE FJFyD8&E FJFyD(&F FJFyDHO, CH& FJFyD@&bH FJFyD8&Hh FJFyD@&xHH FJFyD}8H.?)$wDi/@ P FJFyD` &FF FJFyDP8A&E FJFyD?H&O, nE FJFyD,(Ʋ5C& FJFyD8&xE FJFyD 8E &d FJFyD(&FH FJFyDH&O.CH( FJFyD@1&bH FJFyD8ƲH& FJFyD@&x H  FJFyD8H.?OuDRFQ 8DVO"=T- D}pp7l/Q P FBFu %FF FBFg( %C< FBFyDX8%pfG FBFyDG G0->dRFQ ~D0DwT? Dwp ` 0F1;0=D?F(̀1F&0%8FF =MF" {!"(FRF50*+#O F0 ( 0# F.F&0 8*<+p5  hp5 5, #,!2eC "F=( " "<HxD:=8F?_HBF AD9HO xDDD:E@F : H .ue . :W  :Q+HxDHxD:R(IJyDzDP>y*FL|DK `W ph>x.Os)c`O0"FOS7킴@4kXE}HxOS&`)Oph"F``т 'KH `Ex#`OSh( ObO"b`"F '.DU^pE@GbJx#`OSh(F"Fg` 'H@Er2BАB '?''D G7z , %€NDD ~D  P_ -:(F=!2;F& p(F0F( )F:mHb)F;FxDhF*LhH)Fb;F,DxDhF!0ز(`H)F:FxD: / ѓ+3+OtOt /3+'+ Ot$ / ++ $$/ +++$$+W$@$$OtOtl$HHHHHzHpH\HMH=H+Hl HGGGGGGGGGwGeG @G5G$GG GFFFFFFF >F,FJ D DD DDDb : 6   _Cj v B$`$p$ `&Dv аIyDD0s YO)[0O,]`X Z\FHxD% բK{D@D6FBt0DvD2+O< J N@HxD)F:P O :0]FN444~DDDD)iD)N (O3@@iXPFLXFHF:5ivH)FxD )PF8pHQFo+xD:XY0Z@[D\ F6] C%N,B ! qPFJF<SE[HQF*FxD:^ WM }DF6 bT 3 O< "C#09F` &D"  XF>-G FL!FFOr F|D F/n F)FOR0~(F0.0IF D2F/ J8FOqOszD G -OFMFKFN}DU~D(651h!`@,Rѽh-g@F"F#F9hF0H9FxD:;8FW *вHoxD:.oIHF xD:"C`;F`( 4 IF>HIF*FxD:  Q HxD:e@F F`SP \ⱻ 1LAI*YyD@JzD:о F(F+9h@F +$O6JYzD5IyD9к p0I0JU0yDzD9NH,I,J-XyDzD9o+O05hB<7xs ~s 4>{ >====w=Q=;= =<;<X<U<)<<;ɰ M!KRh}DX4h7FGRLI+YyD9yo+%F hF0h!FƈK{D@Or0F= I0FmXT9` FG?hB<0Io ,;!;-O "FF h D(@ " F.WH, Y`1x R, !.0X.p*.pMH!xD:O0(Fu! # (5x  'BJ BKDBHzD{DDDxD1xDYU3xDbl;l`nn l`nn@FYF> Dz3x #0@FQF>D1x @F7>/DI@FNyD/Y HTxD9 =(o : \::;3;: -G FL!FFOb F|D F/8 F)FOR/H(F0.0IF D2F.J8FOqOczD G L  FF#Jhh#FzD(5IRXx"F;;x,HihxD:8F#1hHOxDD91[8F4)q 9o+(Fm 99-GFHL#PhF|D@4 BHxD:1#*F#8F1h\(p;IgX*HDahxD9#9U9V9C98FThTH!FxD9#(F!F8@o879-AFM!FFORF}D(F.1FOR(F/0F/wF$AF"F.J8F3@AzD 𰸴 ~ -OF;N'Ph FF~D@7I8HvXxD9 :FIF;shP.M0I"hpYyD09o+MIF:F;a    IF:F@F;S!hPFZF#2KOPZFPF{D#!h `DFND~DJIXyD*h;F96PF49 9B 98F|h 88 ~8 Q8-CFPh$FF @o+p!F"F;Fh(!F"F; h08F #1hT,H_AFxD90)HqxxD9+(HHFDxD9"$HzxD98!F"F;]F(i(!F"F;UkiF+ #8F1h(_F`". FED1h`#V bF ^L8F8F7777-OFPh$FF@o+!F"F;Fh(!F"F; C #8F1hEH_EFYFxD9~H DaxxD9{HKxD9xH9{xD9vHxD9(! E@Ԁ @F+D{9u _h(!F"F; h(!F"F;_'aHxD9Y(i(!F"F; #e 8FBF1h( `"HF. _0 OJD!0 jiSD!Z T("!F5 D .U! F;T 4khⲈs(,ѩTB4HxD9O0Q~08F1hJF`#H$1hJF`#8F~@8F1hBF#Fy4$HQFOxD9!HDaxxD9H'DxD 9H9{xD9HxD9 (! 8{@E  XFCD{9_0F!676666665s5555-G}Vh$FFF,`.M!FOr8F.V0F!F"F;F(hPF"F#F(b-h8FOr  q.!Y F;14'0,%HxD9=B"HxD974PF:FOs/2F h3F&``-hDDO@F1F$94B HFr455 96.o+8F }k4v444-C$AOFFF0F!F$".hhDo+m;(Шh(!F"F;h(!F"F; (i(!F"F;#)H@%J9Xx/"FFhi( "iF;F*x:*hiF ";Dzx:+0/iF ";*x *э&HF2F$#$@%pU xb -GFSMFRKFO Rh}DX9h+R,FD- HNIHYxD9IqShQU KA=IT0yD9#sh+X =JFP5L7H+YxD9"oI3I" F6`B`PFyDPF1F C(;Н n*ѝx$I%J(UPyDzDo8%*!&@""HF"F#(H")X%IyD8 PF+?hB ;o+% F=(F,ja 32<3l222-OO,FFF XDF(VPF2F3F$(@9x1)){JzD{JzDzJzDzJzDzHxD9qx(߀vHIxD9gtHxD9arHوxD9[pH!xD9UnHixD9OlHhxD9IjH9ixD9ChHIixD9= AF"8F.)FBF`h;uFx*_(]HxD9%X9PF:F#.Jݠh)F;Wx*Bѭ)Fh;Mx*8ѭ)F i;C x*.ѭ)F`i;9x*)Fi;0xṭ"i)F;&x)F j;xR)F`j;%x . /HY`.H1hxD9-HxD9%,HxD9!+HxD9*HxD9)HxD9(HxD9'HxD9 &HxD9 %HxD9$HxD9#HxD9"HxD9!HxD9O0 _ 2s2v2w2y2u2u2v2222222162:2v22223F3g33334-C'FFF(F9F"."th 3F"F#FHF(8H 9 F0S/ 7H!FxD9phi~ȹth F/( F:fF (F"- HxD HxD9hO0HF*F#q3E33-CFFF!Y!@ 1) 1FXh(10h(Q4 ,@F9h*F#F'@F*F9h #~(8FFHxD88F HxD8FHxD8 Fo+ 332FPh#Fp:(F)حhJP$ e(F:I"F8F#yD^8F"F# IyD( 1FHxD8c(Fo+ 222𵅰ThFd%I0F*FyDP"I0F*FyD0HxD#I 8FyD( $HxD8o+HxD I"F#FyD(HxD8y H9xxD8 HyxxD8 Fa2U2I2C2;292292I2G2-AF FFT 0Fs+1HxD8>o+X`h)F:r x" 0xR(HahxD1.@F#9hu9Oq*3)Fh:Ox! Fth,c F:h! F"-h)o+ F:( F :0 uBFYyD8`F F :p FyD:8 FyD:([Ѵh\U `U0yDhSF8 F :}X F :x0d FyD:q"T FyD:hpL FyD:a8@ F"yD:o"0 FyD:P"dtSFY-X *hyD8lh FyD:5@ F"yD:C(oѴh,?S FyD:4 FyD:& FyD: &! FyD:#B FyD:#9 FyD:#0 FyD:@#'| FyD:#l FyD:OC\ FyD:OS L FyD:(OC8 F7yD:, FyD:H8F ?F,@U 0x!OG JSFvhIXUPyD0*h7O O$ JXx>!B=# du x?>!#B} TeIyD 7\x6>!#Bm ;LZHxD8,@"OG XF<FXHoI*XyDZF7U-!ZF-8  x0`O4dcE OHOD=DPIO3$2F$@bbyD3csc[FF0F<@@x$?p@/׀O0<0Fp؁O2oIU0yD73!:FO3FHjHI*XyD"F7{hm+ cLm"I-YyD7J FCFFzDhE%YhxF|B,`FH8 F6H  SD F " 0 &3F=L2FjI-YyD7:Bx B3DBB%,LZH)YxD17uF , (BF  R6K+O4&HHxD8GH1FxD8B*xv*8F<], !JFSF FoHF@IgppPFJF+F1hFHF<-PFK s(UJ(](-O#OFThF D40O0/I FyD-(I FyD- I FyD-0I FyD-( h  )P 6XF#h2Fu 4HxD76ЀHxD70FH" %,BD6pB4,܀ 56,<| 6|tHF7v@-Ѻ@"!UF,NcJ4FX'(hF(9,# r(?l9`r(?d9r (?\9r(?T9 s(?L9`s(?D9}@9y(?0 9i@9e(?$9U@9Q`(? (9C@9?(?,5F91@9-7/i/?0+ܮ8 2FXF h 6XFJ 'm'e'w''-OFG04!D[@" h%,j# XyD( !:F# ( 8d[ x lhT$DO NF|DDuxD7ODFDT Pm5BeE PFyh7>4F)HxD74ܣ%܃FDDU @,@̳'FȓDDW P-@ 7r +*7  PF"9QF0L[0$7 x#S@,=QF@h9(5Hhx-* I &C-*O9)x C6!:F# cO[02hx2`qhx q`kh+?wIFL%HF/FKyD|DxD{D UHFxD7bphBtE @FYh75F\2hBХB HFIh7~7,FZ#x++74 F"9AF4xȱO Y0+pљF Yp/ !FHD  @h9(  Lh"x-*eCH@0,d-+O5F x0(bxx* {H[ 75# FO - t #!F`F ;0"9[F ! `F;! ",JFF9GzFaO[0OF7KF !FJD  Ph9(}  C(@2hwh" C'5`'x@-5`x q`HI#yDX$>OEH[P'xDDD YF7@HYFxD7DFW `fE QF2F[h7AFZh77F4 7 DDDV @,dE IF"F[h7dAFZh7_6F %hB9;'G %/Fa .a %j ͒` $1$_ i ""J] lg !.K-OF-JFFǰ{DX"2`hFE0'LY+xF)F9GF9B ` )F""9692``9h@F"FOso+@F"F9hOs 2hph HxD7@FE`B9GB -h+" hFO0pG8K-CF7NFhF{Dh~D18F9f0 F0IX"dhyD '9F"F#F@M@F&OY hxF ` xOh?O`(FjhG@F0hұF!F907(BhIvX4x@FB=#8 FA -9/x/H!FxD7?O0 e A d p F FFF _F20F@"F Fp-OFLFǰKOuFF!*F|DX hE0F,PIFBFPF[FE!hB9G@ FM!FCF}D)FyFh2)F F F1hFp0L M|DdY%xD=##F08@ VI#-GF FyD? \ @   UI-OFKǰFMFFP{D[YhFE#7ZFOv2F!(F,#XFQFJFhHF 8F)F"F+XE0FB9Gl> s&MF}D0KX%h x-%`p= -O# hF FDF(@ǀT% (18F-aIFyD _IyD(F[HxD7[YHxD7U`$WODDT B 8FYh7D4H,щx0 . FB8u8{+WFF[( \FF%DE*& 3F !h@h8`V 0Eeh=FtF#6H. &tFB8p  U*I"hZp)IyD658F.%IyD -#IyD&%O&HZ@xDDD QF6HQFxD6 V PFAF[h66H. 7 (F= " b:o#-A#ȀF1M8FDAF}DF(NW"p߹ Fj!#jF %IFkXx-AFkFF,.*I8FyD88F2F8xٹ{NY*x?!jF#@} F I FyDk Fo+; -A#hFFF@F!F(SQh@B(F1F:F@FX!phG@(F!!FF !FE(F- )hF*I8FyD8!I8FyD88FiF"8k3xs(F!F j(Fo+p$N!FC FF~D1F<(7T"2(F!"F# !(F#F1F(F F[6!F0(F!"F# 0 #(F1F#FS(Fo+p-OFaOO$`KF|BF F!  DWD/ F+&0"PFYFC-F(@Z 7ѩhh)0F"FCF )h"FCF O )0F YF)h#F1(Fm?H?X9x 8 !PFMh,)h7IyD7HRFxD6SPF,k (F 2NRF2IYyD6oB #QF`FBF 8 +|FBFXFh+)h$IyD$HZFxD6JX8x hk)0F"F$# y)h"F$# !$")0FIyD)h#F0F/0B8|1R9 -OO3"JM #<  h}D,F(y >h U P +x6?H1F <'xD6WYyD5?olE   9OO Oa D%B?3H xDP%W/XFHHEB"P! HYF@F+x@F ,~# *"@F+fB  EF75  zO OPE @  6C 63 F: \ X - xğ -OFFFW8h@8@F9F7L$HDD0B[$P/hNF>0h(9F+H68F@F)F54̢ ʞ 8 FKFJI{DXyDh5v!F 5H!FxD5|H!FxD5wH!FxD5rH!FxD5mH!FxD5hH!FxD5cH!FxD5^!F 5X F)F8@+ ]-CF$5F+GF  B !"<HF07]0U4'p-O h#FhIF (FyDD+ `dI(FyD+HbHxD5Zo`L|D_L|D ")FFPF(ZI X`2xh ~h .F &F?RHROxD5DFYe BeEУ8FYh56F 5X/x+/)5 (F"7F xq#X/I)F@h7h(  Mh(x-( >CK P--/O6 x$@ 6 PFBmh#Y3]E0F)AF*F[h5`7FY- 5c(FMFHhX`xDDFAFFF5SHAFPxD5LDQFZh57 *  O vM vv`uYuu0u.K-G F-IF{D[XhFTh,4#FBM"F)h'!F8F"*DD8F)F"*J렱$5AHF5,: 5<4,PF55A0F F1F?08F)h2F#o+0B7( z𵅰ThFF "F h#Fd0F!F"*0 F45 HbxD58F F)Fu08F1h*F#jo+ -AFI"FyD7+HI(F"yD7$HxD 5(F+FFHxD5O0+x{)F"0F570F!"78U4 F   JKzDx{DZIOTFyDIyD 8HX xPHxD5 po+ 0!!p LS `Y`X`ڝ ' } (u ,0MJ-OFLKzDx{DZJMOVFII}DyDFI\X%xEHxDEO""pYh4CHxD55o+nOQ?MF?I}DyDF4(F"yDx xD4!5!{Dp `iA!.(FbiyDp0ai xD4"xDp0Z"ұ.(F yDx xD44!{Dp iA!.(FiyDp0i lxD4d"xDp#jZ"± .H(F"jyDip!j 4xD4,4!{Dp jA!(.(FjyDG`0j HxD4uH"xDpjZ",.I(FjyD(`j HxD4VK!{Dp KA!WAI(F#yDh  HxD40I yDp(F iX .I(FiyD` i HxD4K!{DpbkQ!4.I(FbkyD`0ak HxD4J zDpkX 8.I(FkyD` k HxD4K!{DphQ! .ݴI(FhyD`0h HxD4J zDp(Fz0X I(F yDah  HxD4K!{Dp Q!I(F yDAh0 HxD4nJ zDp2X I(F"yD!h  HxD4NK!{Dp Q!)~I(F yD(0 wHxD4*vJ zDp~~R> wu  t oa( ;.ܵ  D  qb ?3t ( ޳  aU@ )  P |r PB v 2  x TER $ ʯ  L f` D7  ~ @   n`| F8<  0X (F yDx  xD4:!{Dp(F Q!(F yDx0 h xD4`* zDp0X H(F yDx  , xD4(:!{Dp Q! (F yDx0 xD4) zDp0X (F yDax  xD49!{Dp(FU#9Q!Wٱ@(F#yD4x p xD4`h"yD p0Z"ұ.L(F yDx 0 xD4;,9!{Dp lA!L.(FlyDp0l xD4"xDp#mZ"±P.(F"myDp!m xD48!{Dp `mA!T.(FbmyDp0am xD4"xDpmZ"±X.h(FmyDpm PxD4L8!{Dp A!ѱ.,(F yDbx0 xD4 "xDpmZ"±\.(FmyD?pm xD4l7!{Dp(F4 nA!`.(F"nyDp0!n xD4G"xDpcnZ"±d.|(FbnyDpan dxD4%`7!{Dp nA!h.D(FnyDp0n ,xD4("xDpnZ"±l. (FnyDpn xD46!{Dp oA!p.(F"oyDp0!o xD4"xDpP2Z"ڱ(FP"yDmxP |xD4x6!{Dp(Fa A!X(F yDGx0 <xD4s8"xDp0lX W (F yD x  xD4L5!{Dp"Q!(F"yDx0 xD4)% zDp0X (F yDx  xD45!{Dp(FlQ!H.`(FlyDp0l HxD3D% zDpcoX t.((FboyDp ao xD3 5!{DpoQ!x.(FoyDpp0o xD3$ zDpK:(FyD"`xDyD34 {DpO $DDzD IF (F38PF3d p  (F)(F&0X б.L(F yD x  4xD36,4!{Dp !Q!ɱ (F !yDh0  HxD3J zDp0X .I(F yDh  HxD3K!{Dp(F!Q!I(F!yDh0 HxD3J zDp1X I(F!yDyh  HxD3K!{Dp!Q!I(F!yDVh0 HxD3J zDp(FL 1X ݸI(F !yD0h  HxD3]K!{Dp!Q!ݩI(F!yD h0 HxD3:J zDp1X WݙI(F!yDh  HxD3K!{Dp(F!Q!݉I(F!yDh0 HxD3J zDp1X ( @yI(F!yD(֪  D r TE ^  Ш |p PBH   v u, RD " `  Х `O (6   ` dV 4'أ b    dY¢ :0~ 2   tZ RH Ơ z    xD3 ;!{Dp Q!ѱ.(F yDx0 xD3* zDp(F|(FyP1X ر(FP!yD\x P xD3:!{DpT!Q!ٱ`(FT!yD6x0T H xD3b@* zDpX1X ر (FX!yDx X  xD3<:!{Dpd!Q!ٱ(Fd!yDx0d xD3) zDp(F\1X ر(F\!yDx \ xD3|9!{Dp`!Q!ٱ\(F`!yDx0` @ xD3<) zDph1X ر(Fh!yDux h xD38!{Dpl!Q!ٱ(Fl!yDOx0l xD3{( zDp(FCp1X ر(Fp!yD&x p |xD3Rt8!{Dpt!Q!ٱT(Ft!yDx0t <xD3,4( zDpx1$X W ر(Fx!yDx x xD37!{Dp|!Q!ٱ(F|!yDx0| xD3' zDp(F1X ر(F!yDx  pxD3l7!{Dp!Q!ٱL(F!yDax0 0xD3,' zDp1X ر (F!yD;x  xD3g6!{Dp!Q!ٱ(F!yDx0 xD3A& zDpT2X ر(FT"yDx T pxD3l6!{Dp(F"Q!ٱD(F"yDx0 ,xD3$& zDp 2X ر(F "yDx  xD35!{Dp(F"Q!ٱ(F"yDwx0 xD3% zDp2X ر(F"yDQx  dxD3}`5!{Dp"Q!ٱ@(F"yD+x0 $xD3W % zDp 2X ر(F "yDx  xD314!{Dp$"Q!ٱ (F$"yDx0$ xD3 $ zDp(F(FX2ԃX Wرl(FX"yDx X PxD3L4!{Dp`"Q!ٱ,(F`"yDx0` xD3 $ zDp\2X I(F\"yDdh \ HxD3K!{Dpd"Q!I(Fd"yDAh0d HxD3nJ zDp(F7h2X I(Fh"yDh h HxD3HK!{Dpp"Q!I(Fp"yDh0p HxD3%J zDpl2X ݿI(Fl"yDh l HxD3K!{Dpt"Q!ݱI(Ft"yDh0t HxD2J zDp(Fx2X ݡI(Fx"yDh x HxD2K!{Dp"Q! ݒI(F"yDih0 HxD2J zDp2X "݄I(F"yDFh  ~HxD2s}K!{Dp"Q!)$@tI(F"yD (P ( `P (b  ʜ ~nx F6,   B fW ( V  w RFl " Ԙ  ~6 XH  L  | D2T  • | hY0 4(  ^  ri̓ J? 0 hxD2id$ zDp2X ر&D(F"yDx  (xD2C$4!{Dp(F "Q!(I(F"yDh0 HxD2J zDp2гX W p*I(F"yD`:x HxD2K!{Dp"Q!,I(F"yD`;x HxD2J zDp9x2X .I(F"yD`:x HxD2K!{Dp8x"Q!0I(F"yDd`;x HxD2J zDp(F[9x|2X ݸI(F|"yD@`:x| HxD2nK!{Dp8x"Q!!ݪI(F"yD`;x HxD2MJ zDp9x2X #ݝI(F"yD`:x HxD2,K!{Dp8x"Q!%ݏI(F"yD`;x HxD2 J zDp9x2X '݂I(F"yD`:x |HxD2{K!{Dp(F8x"Q!)sI(F"yD`;x mHxD2lJ zDp9x2X +eI(F"yDw`:x `HxD2_K!{Dp8x"Q!-XI(F"yDV`;x RHxD2QJ zDp9x2X /JI(F"yD5`:x EHxD2cDK!{Dp8x"Q!)1D;I(F"yD(>x 5H$5NxD2;~DEp $ ؐ  {H \S 4)ď | :   f_t </,   f w x 2FOsxD2l #h9X xFX T(F"hyD{p !h @ xD28:!{DpbiQ!.(FbiyDYp0ai  xD2* zDpchX .(FbhyD7p ah xD2d9!{DphQ!.(FhyDp0h xD2B) zDphX .t(FhyDp h ` xD2 X9!{Dp Q!ѱ.<(F yDx0 xD2) zDp#iX .(F"iyDp !i xD28!{Dp(F(FyD_`xDyD2( zDpO DDyD (FiIFq0iPF2 p  ј kX 8.p(FkyDQp k \xD2~T8!{DpkQ!<.8(FkyD/p0k $xD2\( zDp(F$(F!#nX `.(F"nyDp !n xD247!{DpmQ!X.(FmyDp0m xD2' zDpmX \.(FmyDp m pxD2h7!{Dp 6Q!Wѱ.D(F yDx (xD2$"yD p(F0Z"ұ.(F yDsx xD26!{Dp A!ѱ.(F yDNx0 xD2z"xDp(FBcmZ"±T.(FbmyD(pam hxD2Ud6!{Dp lA!H.H(FlyDp0l 0xD23,"xDplZ"±L.(FlyDpl xD25!{Dp mA!P.(F"myDp0!m xD2"xDp(F0Z"ұ.(F yDx |xD2x5!{Dp A!ѱ.X(F yDvx0 @xD28"xDp0Z"ұ.(F yDQx xD2}4!{Dp A!ѱ.(F yD,x0 xD2X"xDp0Z"ұ.(F yDx xD234!{Dp(F nA!l.\(FnyDp0n HxD2@"xDp#oZ"±p.$(F"oyDp!o xD14!{Dp `oKA!Wt.I(FboyD` ao HxD1I yDp oX x.I(FoyD|` o HxD1K!{Dp Q!.I(F yD[h0 HxD1J zDp(FQ0X .I(F yD6h  HxD1cK!{DpbnQ!d.I(FbnyD`0an HxD1DJ zDpnX h.ݷI(FnyD` n HxD1%K!{Dp(F Q!.ݨI(F yDh0 HxD1J zDp0X .ݚI(F yDh  HxD1K!{DpoQ!|.ݍI(FoyD`0o HxD1J zDp0X (.@~I(F yDm(  wHxD1vK!{Dp uh G:f  " ފ  xP iH_" 7l  V  cWˆ 7-~ , ܇  gZH 90   | , x SD N   v ]T2 90  f (  yp SM\ 7/ Ё (Fu Q!ѱ.p(F yDYx0 TxD1P( zDp0X б.0(F yD4x  xD1`8!{Dp Q!ѱ.(F yDx0 xD1;' zDp(F0X б.(F yDx  xD17!{Dp |7Q!Xɱ.p(F yDp8x XxD1P"yD p0Z"ʱ.4(F yDp8x xD17!{Dp(F(F:xA!ɱ.(F yDrp;x xD1"xDp9x0Z"ʱ.(F yDOp8x xD1|6!{Dp:xA!ɱ.x(F yD,p;x `xD1Y\"xDp9x0Z"ʱ.@(F yD p8x (xD16 6!{Dp:xA!ɱ.(F yDp;x xD1"xDp(F9x#lZ"@.(F"lyDh8x!l xD15!{Dp:x`lA!D.(FblyDh;xal xD1x"xDp9x0Z"ʱ.\(F yDp8x DxD1@5!{Dp(Fu:x kA!0. (F"kyD\h;x!k xD1"xDp9x0Z"ʱ.(F yD:p8x xD1g4!{Dp:xA!ɱ.(F yDp;x xD1D"xDp9x0Z"*.Cp(F yD(׀>x T$PdxD1~DƸ@2FOsxD1 4(F"hyDxH!h:Xx xD14!{Dp(FbiyDhHai:Xx HxD1K!{DpI(FbhyDhHah:Xx HxD1K!{DpI(FhyDhHh:Xx HxD1K!{DpI(FhyDuhHh:Xx HxD1K!{DpI(F yD_pH:Xx HxD1K!{DpI(F"iyDIhH!i:Xx HxD1vK!{Dp(F?I(F"kyD1hH!k:Xx HxD1^K!{DpI(FbkyDhHak:Xx HxD1IK!{DpI(F yDpzH:Xx HxD12K!{DpI(F yDpnH:Xx HxD1K!{DpI(F yDpcH:Xx HxD1K!{DpI(F yDpWH:Xx HxD1K!{Dp(F`Oz|o2D  `!***FI(FyD(0Oz{JoD  C:J"HS1+xD1K {DpfhboOz~j EZjz*2FsI(FyDG(ch+ހfoOzy  G * ^  k_~ 7-v~ .~ } } wP} WL } +!| ~| >| { { ]Nl{ )&{ z $E6z +bz  8z z y y y w\y o`2y UEy x x zx qw C+HS2+xD1K {Dp(F[I(FyDHH&IxDyD1~JzDpd&``DDD(FIF 18PF1c!6.эI(FkyDhHk;Xx HNxD1K~D!1pI(FkyD hHk;Xx HNxD16~D!1p(F(F|I(F"nyDhrH!n;Xx vHwNxD1~D!1ptI(FmyDhhHm;Xx oHoNxD1~D!1pmI(FmyDh]Hm;Xx gHhNxD0~D!1peI(F yDpRH;Xx _H_NxD0~D!1p]I(F yDpGH;Xx VHWNxD0~D!1p(FSI(F yD~p:H;Xx LHMNxD0~D!1pJI(F yDgp.H;Xx DHDNxD0~D!1p(F\@I(FbmyDNh"Ham;Xx ;H;NxD0z~D!1p9I(FlyD9hHl;Xx 3H4NxD0e~D!1p1I(FlyD$(n\su 4u u :u tu eTt M?t ;/t +Xt *t s s s ns  l;Xx jxD0~D!1p(F"myD !m;Xx jxD0~D!1p(F(F yDX ;Xx d djxD0~D!1pX(F yDt$ ;Xx < !o;Xx ixD0g~D!1p(FboyD% ao;Xx ixD0N~D!1p(FoyD T o;Xx ixD05~D!1p(F yD ;Xx t tixD0~D!1p(F`(F yD;Xx D DixD0~D!1p8(FbnyDan;Xx  ixD0~D!1p(FnyD|n;Xx hxD0~D!1p(F(F yDD;Xx hxD0~D!1p(F yDi ;Xx hxD0~D!1p(FoyDOo;Xx xxhxD0x~D!1pl(F yD5;Xx LLhxD0]~D!1p(F'<(F yDh;Xx hxD0?~D!1p(F yD4;Xx gxD0$~D!1p(F yD;Xx gxD0 ~D!1p(F(F yD;Xx gxD0~D!1p(F yD;Xx ppgxD0~D!1pd(F yDT;Xx DDgxD0~D!1p(F(F|,(F yDl;Xx gxD0~D!1p(F yDQ;Xx fxD0y~D!1p(F yD6;Xx fxD0^~D!1p(F yDp;Xx fxD0C~D!1p(F yD<;Xx hhfxD0(~D!1p(FT(F"lyD!l;Xx <(^o "o aLn E0n wzn pZDn R<n m m `m {f*m _Kl A2l 1"l  Tl t]l T=k 4k tk ¾о(k žj j j whhj [H4j ;,j i i zi QDLi wi qch Xh kH&S+xD0kK{Dp(F5I(FyDHHIxDyD0YJ zDpp&llDDD(FIF 8PF0=!6.ѐI(FkyDx4kW0x HxD0$I"yD pI(FkyDhNkYx HxD0I"yD p(F(F~I(F"nyDhtN!nYx xHxD/wI"yD pvI(FmyDhjNmYx qHxD/pI"yD poI(FmyDh_NmYx iHxD/hI"yD pgI(F yDpTNYx aHxD/`I"yD p_I(F yDppINYx XHxD/WI"yD p(FeUI(F yDVp("yD p$(F yDiYx  xD/#"yD p(F(FnyDinYx xD/"yD p(F"oyD\i!oYx xD/"yD p(FboyD,iaoYx xD/"yD p(FoyDhoYx h xD/`"yD p\(F yDwhYx < xD/8"yD p(Fi,(F yDYhYx xD/"yD p(FbnyD?ThanYx xD/j"yD p(FnyD&$hnYx xD/Q"yD p(F(F yD gYx xD/3"yD p(F yDgYx hxD/`"yD p\(FoyDgoYx @xD/<"yD p4(F yDLgYx xD/"yD p(F(F yDgYx xD/"yD p(F yDfYx xD/"yD p(F yDffYx xD/"yD p(FX(F yDHhfYx dxD/r\"yD pX(F yD-0fYx 8xD/W4"yD p,(F yDeYx xD/<"yD p(F(F(F yDeYx xD/"yD p(F yDeYx xD/"yD p(F yDLeYx xD/"yD px(F yDeYx \xD/T"yD pP(F yDdYx 0xD/,"yD p(Fw (F"lyDhd!lYx xD/"yD p(FblyDOtdalYx xD/z"yD p(F yD5@dYx xD/_"yD p(F yD(dY;x $exD/?~D.t2F#xD/3l(F"hyDxI{X!hx TTexD/~D"2pH(FbhyDxI{Xahx 00exD/~D"2p$(FhyDxI{Xhx  exD/~D"2p(F(FhyDxI{Xhx dxD/~D"2p(F"iyDxI{X!ix dxD/~D"2p(FbiyDy(jIXai;x $txD/DX2FOsxD/t(F"hyDSxH9X x!h \&xD/~T$zDpP(FbiyD;xH9X xai 8&xD/f0$zDp,(FbhyD#xH9X xah &xD/N $zDp(FhyD h{H9X xh H&xD/7JzDpI(FhyDhqH9X xh H&xD/"JzDpI(F yDpfH9X x H&xD/ JzDpI(F"iyDh[H9X x!i H&xD/JzDp(FI(FiyDhOH9X xi H&xD/JzDpI(FiyDhDH9X xi H&xD/JzDpI(F yDp9H9X x H&xD/JzDpI(F yDpp.H9X x H&xD/JzDpI(F yDYp"H9X x H&xD/JzDpI(F yDBpH9X x H&xD/mJzDp(F7(ZOzv*#n D a*"::*BR&b K>a a a Pa мa ϶` ` z` {lH` cT` I4_ _ ڹιr_ ȹ@_ ֵ_ xj^ dT^ H6f^ $*^ kZ] O>] ] zhL] \J] Ӵ´\ \ h\ t2\ iY[ K@[ ;0[ )\[ ض"[ t¶Z Z uZ fRJZ J4Z *Y 2SBY 9(lY K!{Dp=I(F"kyDNhH!k:Xx 8HxD.{7K!{Dp6I(FbkyD9hHak:Xx 0HxD.f/K!{Dp.I(F\mS ߧS ٧ΧfS 0S S R uR XJR 9+LR R Q ݦЦQ ɦQ lQ kyD@k:Xx 4xD.08!{Dp(F$(F!yD:Xx xD.8!{Dp(F!yD:Xx xD.7!{Dp(F yDs:Xx xD.7!{Dp(F!yDXd:Xx xD.7!{Dp|(F yD=,:Xx \xD.gX7!{DpP(F yD":Xx 4xD.L,7!{Dp(F (F yD:Xx xD..6!{Dp(F yD:Xx xD.6!{Dp(F yDP:Xx xD.6!{Dp(F(FbmyDam:Xx xD.|6!{Dpx(FmyDm:Xx \xD.X6!{DpP(FmyDm:Xx 8xD.06!{Dp,(F"nyDf!n:Xx xD. 6!{Dp(F yDLL:Xx xD.v5!{Dp(F>(F yD.:Xx xD.X5!{Dp(FlyDl:Xx xD.?5!{Dp(F"myD!m:Xx lxD.&d5!{Dp(FX(F yDp:Xx <xD.45!{Dp0(F yD8:Xx xD. 5!{Dp(FbnyDan:Xx xD.4!{Dp(FnyDxHn:Xx xD.4!{Dp(F(FnyDuxHn:Xx xD.4!{Dp(F"oyD]xH!o:Xx xxD.t4!{Dpl(FboyDExHao:Xx TxD.qP4!{Dp(F9D(F yD)H:Xx (xD.T 4!{Dp(FoyDpHo:Xx xD.pLH:Xx HxD.jK!{DpI(F yD'p@H?X:x H$NxD~D.P4p(F;. "hPBУH2FxD.AI(FyDHHINxDyD.4~D!1px&FOppDDD#h(FEYFV/0HF1h." ɽ"FIhyDh )؉L# ЄHډxD.#OOD#B}HOq2FxD.P ץĥDP P .O O WClO 6O |N p]N r4N VN =.$N %M M ޣM ɣNM xM rfL L "xL FL L ֦ɦK #K K XIFK @2K , J J J }XJ wj*J cWI MFI E>I ;.tI JI KoC I RH 8/ʛ\ \xD.GW @N#hY!8(F"hyDp!h xD.9"{Dp`hB"±.(FbhyDpp0ah xD.!xDp hY!.(FhyDNph xD.{8"{DphB"± .(FhyD,p0h xxD.Yt!xDp(F! #iY!.P(F"iyDp!i <xD.448"{Dp`iB"±.(FbiyDp0ai xD.!xDp iY!.(FiyDpi xD-7"{Dp(FiB"±.(FiyDp0i xD-!xDp #jY! .l(F"jyD|p!j TxD-P7"{Dp`jB"±$.4(FbjyDZp0aj xD-!xDp jY!(.(FjyD8pj xD-e6"{Dp(F-jB"±,.(FjyDp0j xD-@!xDp #kY!0.(F"kyDp!k pxD-h6"{Dp`kC#W p4.D(FbkyDh:xak 0xD-,!xDp kY!8.(FkyDh8xk xD-5"{Dp(F9xkB"<.(FkyDh;xk xD-!xDp:x#lY!)b@.@_(F"lyDd(U>x!l $uxD-DEchY!.d(FbhyDCpah PxD-pH5"{DphB"±.,(FhyD!p0h xD-N!xDp hY! .(FhyDph xD-,4"{Dp iB"±.(F"iyDp0!i xD- !xDp(F ciY!.(FbiyDpai hxD-d4"{DpiB"±.H(FiyDp0i 0xD-,!xDp iY!.(FiyDt`i HxD-K"{Dp(Fk jB" .I(F"jyDR`0!j HxD-H!xDp cjY!$.I(FbjyD3`aj HxD-aK"{DpjB"(.I(FjyD`0j HxD-BH!xDp jY!,.I(FjyD`j HxD-#K"{Dp(F kB"0.I(F"kyD`0!k HxD-H!xDp ckY!4.ݵI(FbkyD`ak HxD-K"{DpkDC#W p8.ݧI(FkyDX:xk HxD-H!xDp kY!<.ݛI(FkyDsX8xk HxD-K"{Dp(Fk9x lB"@.ݎI(F"lyDSX;x!l HxD-H!xDp:xclY!D.݂I(FblyD6X8xal ~HxD-e}K"{Dp9xlB"H.wI(FlyDX>xl rH$rOxDD-E24D C ޡC hC C xqB NDB $NB B РA ~A zs:A XS@ :0@ h@ $@ ȝÝ? ? xb? ^T$? 84> > d> ڜҜ > = = tnj= VO4= N-O ,FLF!"@F"2K|DHIDJ{DxDNKyDHzDD~D{DxD |h,O F1"J0y F"B2q F": C\ F"2 BS F"( AJI FyD" D@ F" @7 F "  C . FQF" B@% FYF" AlI FyD" DshI FyD" @sdI FyD" Bc _O"FY^IyD-67s "F#F(F h;F(@UJ X3x15 &4 4 4 ؃˃V4 (4 3 yq3 3 \Up3 -CFFF F"30FBo  ;`% DIF*F$ FAF" ,= 8`0F-OF:KFFF{Dh(` hr* FO " -!FF=LD_F,IO '&yD7D 7/D8F0FH%H:F%IxDyD,eo8FHC F"sNF~D6xA hL  ChV`!F@Ot*F!=F@LF =``wlc:˟LQ1 K J{DXJ`XppG,( M K}DX4hLh'h0# FaL|D$h#O <=.(( o,.p) `) 0L|D%h--L|D%h>aL|D%h$#4.(( o,0ĵ) ( -O#(F$LDD|DD7h/98FIF!عrh1*(FO2jM}D/@0IHcXxD+&) ѴJX [(9F!(OF)ЧHxDh (FOY".l0ТN~D7h_(x(F-)xyx—MIfYT @yD"h+~ (F(IhyD! K{Dh.(FE8h6FHTIyD!~(FOD9h)UIyDHF!l퐹IHFyD!8h0(FAFGF8hp(FAF2FGFpvI8FyD!JhtK{DaH"XqHTxD+% oI8FyD!6Ah) O +9gIgX(F9hP 0(FAFGFhбFFM`YT0)XM}D(uBJGIXdXTIh"hyD+g AFT 0TCZ, AFT@M-(FoF(C?M}D(>&J*IXbX;IyD+3O011F7No(FF~D2h*$2I8hyD!0IyD_r H,HT 0xDT+ &*H$X(F!h(>HFw( @ .D( <' ' 8( `' ×jjiH.̕% ditȕ-OF}'vKwIwLDXyDhX`T QF T +HFOq+ (𾀙0 ++fK&2F{DF. HF .Xx")Ax")pD&6. .D& VIyD.m(TH1FxD+RI hyD!(F&hNI0FyD!(yLI0FyD!(rII0FyD!밹GHxDhbh"(F!FCK{DAH xD+Dp/H6(F!FF08FH!FxD+9Y F9F5+$(-!F @+):^ǓAgǔWŕݕ-OfF6xh~DX h+PyD! F8hbd!," % O0=P6D D&{DFyDzDxDD |D W%@O , F!h 5 XXtXxD+$F PFQ$! 4 , + $2XyDRF F!0O 8:. F !8#80:0;0 F ! :[ FYF!z$8@R FAF!p#90I FIF!h O ;? FyD!\ O<3 FyD!P O ?'t FyD!D@> *@!=X FyD!4@=@,@ >< FyD!$ 5E UOp/ uYHOryD+vOw!F:F >$X@F/F !FBF xD+>p:@,a$'#@!zDpOcq@WpppWqqqFBJxD+:p@O7xD+>0+@(T5 )F+(d)FxD+/!/=F(F+hB-UO5,:hV`yD+a8h \@F yD! ( J!KzDR @{DHFF"/D :x/IHFyD/4DITJFyD+2+2I@FP"KyD{D!/ 88IXFJyDzD/D: :IXFJyDzD/D;@4IXFJyDzD/ITBFyD+DD# ;`:Fy`Oq`(GrOD: Y(8, \0_-ЙQ FIF-0 < /%("O OO Y' hBO76 4B'x/O HF!F 8 H !F3X ^  7/۝>)(#U= *O/T?ҮJ$#dF`zDDDzH1X hE' +HTxD+V#HO 4 1X @(T^ SF[F+0#Q  &D,?T +)/rsI#pX>)h?p/qIT"FyDfO  jK{DiK{DiIT"FyD+Q@FP"SF/N8  (_K{DS ]JzD]IHFyD/D:  ?(`DVJzDVIHFyD/D;ihHFPIhyDOIPJyDzD/TBFFYF+9 :i+GDOD>0+?O - :65h\єfw5͓X3 ="Yߒגܒ̒\=P uOېWUXO 39g%dnV-OFOKehDXh3-I(FyD @NI"h$TYyDPMD@FD*HAF}DxD*HAFxD*T QFcY4*D,I(FyD (I(FyD (h.!!!&KO O LF{DX P-1+x+ЀO (F!FQ+0F!B (F*"-P(  ,C  [L*FdI?YyD*{OpF,F@D Qh B.U 1F-5UEO RHxDs@4̿!!NHNJW 0FxDzD Z,*P#OO|FQ8 P(Yh̿9h(@F! #Fh_w- "H[%IyDJF*T!I[ 0yD_sJH[0xDT*#` F.'0F.$8F! 0yld :<Gh޺-CFSHFFRLxDQI|D ayD x`0",BKI`X IN:FIIYyD+F*O5{p@IfX0F *F?IT 0yDT*@F  (8I@FyD F`6O$DHF9h6(P<FLfF(NY_p*HT 0xD*n&JzD F3uEC *FC)h`*AF:FIHF2F@CyD OY 0*FIT @yD**0F.R(Fd Hv? d.2 }|-OFF4 F!F$"DZ DXF'GyD x" ",EZ 0 $;FZJFyD0*O7+Z 0h("| $ (F[F$"yDCTTZ`1LtXZ0xD 1F(FJF[Fl,(@G44@ !' , @"!@F{D.@!@F.`Z @F4{Di_Lq hIZ'#yDT0*^!JKJFIZyDT0*R"S I:FZ0ITyD*E (FAFJF;F(!OHZ0xD*?$jJKFIZyD 0^HxDi_.(F1F;F( ";F(FBF@e' HZ0xD* "8HNI ZP~DyD3i)?O @!   1E#2F@F@ QhF2R bEpF(FAF@";F0%NHZ0xD*1F@F@#Z(FAFd  E@ӎ"ՑHZPHxD*&ӮL# ZIyD*$`ՃOHZxDT1*K{D_h(ёI$"#(hyD0?®(h1FJF#0@Ҁ('RF`mLZ kHZ0HxDp@|HBFxD F2EB XFBhOp{*`1FZFpIOU "F#q@C`q(FyD ۷O OU DJHZ0j HNJFZT_IyD* FOF.,ld =  EOprOpq@F a"F(FYF@C F.A B?n U#@F#q n=I(F"F@CyDV 8IBFyD F2wEB9FB ;h`.*1FJFJ-I(F"F@CyDaF F.8F1hB,qt   d h: ʸ   j f I- {B 3&5M1FF5L$"}D(F|D2KXh)))E.I8F$"yDA(+HxDI*McY)I)HbXxD)" :8h)F$"3FGFKXJIX*FyD)(OY_NpLHT @xDT JX>0HT @xD)(FL 4oh(  d_SIU#-AF iFKh F+LB|D*NY_u T%IyD)O0;#H!X hF++8F1F(`T 0OHYxD) * 8h1F#*iAF MfY0I HdXxD)q8F*ndh-AFLFFK|DXFI*FcXITyD)9(FAF:F"( 5 O HYxD)6 O0VmdpG-CFrN FqKrM~DXhF wY;mI"FpXmIT0yD) F @bI z(F8@aM bIhsYyD)!"-O$"!hFiF F!aAhF!UhFA!Pg F!jF!T(NHxD9hF!._Lp O2GIV0yDT)OA "2%! F P! FAFjF!"@E7HxD FiF!(3HxD) KX J IX*FyD) gPpdRTL3*8(MF}D((%h+BF+HxD)JX#IhmXIyD)h+z? O4$ KXL I-YyD)$ F8fdOzsXC(-OqM FpK}DXF lIbh#inXkITyD)"irdLfI+YyD)O;;h06 QYI2FoXZITyD)x`h-F`UK'UHFUJ{DxDzD 8pINPHYxD)iQF>ZF_D Q>I:FkX T)D.L:FIFhBGhBCPF-\pr hBO i-SFHF-LC&JX:FT)_Kp 2FU 0T) !FRF#i??FPF-!O;F!F(Ѹ_s(HU 0xD)HF-XF "fdFZ6cq_k-CF ' FF9M#hB}D 6L(Y_4J5HXxD)V@F9FUFh,JXH*N,HYxD)?Bh#hB#L(Y_Lq7UT IyD)r,ip@F1FJFGF IkXNHYxD)fh4h @F1FJF#FCo-O4 Fdd-CO1.L".K|DX!8hF(F)J)IX"FyD0hF h335"O#JYXT p |I2h;T@yDT)8#0A0h(D)F"(iFO0 B+c hdtLd-GNLFFFF(|DIMgY_w@FHT0xD)w3h&9FJF(F0H!FxD'=HxDX0J#HX3H!FxD'1H!FxD'}/H!FxD'x.H!FxD's,H!FxD'n+H!FxD'i)HxDI(H[XxD!F']%H!FxD'X$H!FxD'S"H!FxD'N!HxD!F@'GrP/9cݣ1a{ۤ#9h~ɥ[x# FMFOr!}DFX( ;` LF I/YyD'0F I HmXxD'O0 FN#B\0: *3 pGO0pG-A (NFFFF~DٿK:F'IXyD0'@,},t,طIyDQ$0K{DM"IvYyD_-,a,$a,F_حK{DS$0K{DH"I4XyDD-,H,$F$DآIyDQ$0K{DMIrYyD")-,.$,ؙHxDP$0K{DL"I6YyD,ؔK{DS$0K{DIV yD*F'!$$$$ $K "G{Dbѭ,P؃HxDP$0K{DnL"I6YyD'%B-,>,9zK{DS$0xK{DwIV yD"-<,$qM}DU$0pK{DVL"1YmIyD,lJzDR$0jK{DMH*FiI6XyD%%%!WcM}DU'Hѝ,@,>]K{DS$0[K{D:L"1YYIyD)-,(,F&TM}DU$0RK{D.H"QI6XyD,NIyDQ$0MK{DLIV yD*F'h$DFGK{D/0ѕ4,#AM}DU$0@K{DH"?I6XyD,lJЃ΢~ƣ|:hF*K{DS pG{pFfN~D(ÀS@uIJ"@P #-l !O ! ! $!0 H!` l! ]%B5 -i+-IMJIpYyD0K*5* ѓ++CLDI6YDLyD|D* #+IyD[+6L";I6Y;LyD|D" T#0'I""""O 1K "{DS"G6f, #K,IXyD"F'+6W- c,d,e,f,q -#"""""""""" !! !!!!  p@CO0 p8JmrdPP<.1(K{DS HxDz9)0pG pG) J## 0pGppG pG`FpG ) J#;" 0pGppG)ppG pG`FpG)     0pGppG)ppG}ppG pG)  0pGppG}ppGDPpG)ppG pGpJ#hzDR3@B2DUhGp3+ p39)  0pGh0pG0pG pG:* ) p0) 0l0) H000 +-C F `#IyDO&FE4!F+FQ BC /*P"/h#hh"/ "~qOt$LEu8 8  F$h$90)/ +)*K{DS"POu,IyD- IyDQ"P + L<|DT#Pj(D0 0@ƒ(K{D3 0pG܂8FF FFo FL%`8(K{D3 0pGpF FF+{F!FH2FIxDyD'G(FplpFFFBoA%oo?#pO2#`pp!p%qeqqq(FpopF+;hpG pGFFFF8)Fh #` H:F3F IxDyD' Fo" -AFFF FP1F*F(h#`@h``  HBF;F IxDyD' Fo" -CFF FF ]X9F2F+F(h#`@h``  HJFCF IxDyD' Fo"t -CFF FF +h9F2F+F8h#`Aha`h`  HJFCF IxDyD'd Fo "@ )"O2Fh D,,M }D5`7PBO E 3B@B@BF~jF0h+JzD2 "2  *-C FFF%o 4a x+-Nx.IyD1O1FFgobh{(F BF3F  Bo Fo%o$PFDHxDB K _P$@"F| h* DxBo D 0D, `AxBXxDxB o  D!D) E -O&KF%J{DXh#F(x!HxD'h'|%&FDDB  F)FJF;F+D-- F)F0RF+D-0F%4F'7B0F'#.hB)%A *O(K{DS pGHxDpG-(7F F F! JzD JpE _A#P#F!zD+ F0w_O FdFfFgFE P - -#- -Lp$3p43&&F  .B2FD!BF0 pG0pG-C FFF$FF*FBH!FxD'op:F03h#D3`( ).-OF FFF-ݴQF@F-FHF!ZFCFGEM8@ho+Y)F"'~ Qx+4x, !"#$%&'()$0*&@+(p,*P- . / 0H12345J6L 789:;d@F<=1hl#|Pp@F>4\ǠĠȠ-A hjFOs(mFO@v$FD*Y8F4 BȿQBEȿR%F @hL)|D#( KXxHѲ"xD%" O0(+8-OFPh$FFo+R"F)F'Fh()F"F'Fh("F)F'/F8ۺ5(( (/6i  HFZF#(hH FxD%0F)F"0F'iHFZF#po -C" 0MC-F h_(}DR+H -X!h*x )HxD%.xah &HxD%/xh #HxD%`Da#e' &$HxD%fF %9 @F5%\- 6% . HdxD%N )8=2Ҟ|o+MRh}D*0C-F h&H*X'hxF?'`(xchc`O%DHxD%vbhBc)F8F 5% %Z0F )0-CF-NǰO,KF~DXSh hFES&IpXxF"rF''FHF*F9hOs(O0$$h#h#B*`HF9h*FOs*FOs9hj( H'h2X9hx HxD% EpB'yG( }kKlI-AVhF{D[XhF.eI(F"FyD `HxD%_I(F"FyD [HxD%ZI(F"FyDUHxD%TI(F"FyD0PHxD%OI(F"FyD`JHxD%II(F"FyDEHxD%DI(F"FyD{ ?HxD%z>I(F"FyDl@:HxD%k9I@F#yD(:5HxD 5I2F3FyD(1HxD%R )/H)xxD%-HixxD%,HxxD%*HxxD%)H)yxD%'HiyxD%&HyxD%$HyxD% ?hB'' Ԝ  K-O&{DQh (ILFLL|DDDD4FIHJDyDxDzD 7<+W407XF60)fFoYF~I (F"FyD(@׀FFyI"F(F8yD~F(F (F(F hFO !F ( HFQF,O 'F O# 1 P H (F AF(@𑀆F 4 H QF'lF(ѻ #1hHHxD%%HF5HF7)e ((/8F4)"*Wfh4 e0F6P0)F(?`1F # hM/H3F!bxD%8F).j:)HxD%}(HxD c+&HxD+$HxD+XFh%i ( 8FIF'FPF5%]IF 'F(Ѡ0F ,O %,O j֜v\J&ӚԚښݚK-OF0F{D#B=FI yD(L8FOqOS|D"h( h I yD'M 8% 0 " '4IF 8FyD,F,, + +DDDD DDDvh 6IԲyDD  4 (24l,4 0`Tl.0F0)Fo&1FQFHF'&4 F +4 4 < . ++(&&++ && &> l @FZF3F(O E[, L  €&&O &"OK) sD#@F ,  &,,QF '  F(HF)In8F @#)hfHxD%| 4c *=0F 4).4 , *4\, 4 0PT\.(Fi0)F(?V)FU8F @# hDIH 0xD%0F)V  0FQF'c4 F +9 4 *(J(HРO O (7( O O XFO %+IyDEں, %J  و% %y8/%QF 'F(j(F & &O O 1L}>Й[-AFUhFF'I*F+FyD(#HxD% ; HZxD%(/h+. )HF0HxD%o$(FA h="x` `IOV@F"F#yD h9hF F)(Fo+ܖxϖŖsFThh)Fw(,۝0HxDHxD%7 I FyD(I FyD쀹 F&F)F0Ff H1FxD%o+0FplghǞk8FPhh&F!F(FBH)FxD%(F8sFShh)F(1۝HxDHxD% %F&0 !#B jF F# H1FxD%\0F F)FH!FxD%N Fpkg-AFFch" IFyD+4HXF5x&*F& x:HahxD% O0LOP|D#h@F#9h 7x%h)h&h0h,o+@F*"-AFFch"IFyD+1HXF5x&*F&{ x*HahxD$LOP|D#h@F#9hp7x%h)h&h0h o+'-AFFch"IFyD+1HXF5x&4*F&/ x*HahxD$LOP|D#h@F#9hpp7x%h)h&h0h o+-GFFPh&IyD@%HxD$Lo+="JXxF&&FNIGM~D5hyD(F(FB8hOSPHF*F(ۚ0{6h!5O,L. H:xD$ 1h!F``fdI-OFbM"yDC-F(}D]H)X x thLdO `WFDDPVHXVOxD$DFDT PmBeE 8Fqh$4F $^ +*4  HF"&CFBH$)XXF1$x"R@,EIF@h&\(6Xhx-) J 'C-*O:% F;x'IyD1UE &1F*F[h$W4FT P-(F NFHddYxDNDDAF~D$JHAFxD$EIFZh$1>'fV[fD[ f0Pe:ZEe2e~e-AFLFFUh|DMOHYxD1$ o+)I(FyD&(F&N #hIbXx6- Fh@F #tc-G+LF!FF8FD"(Fb!:FD#|D3(>"KXx )1#V#@ 3_)/  HxD$QFV("&3L P dDL _BB (F#dpO0o(Ɛ-CFfLFeK , !FD"|DTHF8(Fb!JFD#(ZIbXx+|h=$(F1h #j(򕀝spt`uPOHr0pq xDspr0t`uP$W$ ( WIF"&,+ofT4,Y,?(F1h #+(V۝tu{sxpty`uzP{Rvw&Hr0p q xDr0sxpy`zP$ F$ ( WIF"&\,@*)T4 ,(F1h#Fp B&}!t m-C FBLFF!D"@Fd(Fb!BFD#(|Dq;KXx )|h-Ф(F1h#(_۽ P1HE N xD$[5$ @99"HhAF&sKEo@P4,4(F1h#i(1۽ P`pL E HF G xD$$ F$ @9;"XhAF&rJEP4,(F1h#FpO-GFSLFRK  !FD"|DX8hHF(Fb!JFD#a(@HI dX"x +vph0F$)(F2F#(l!x NO e*%%DE @F  $ $ LP 4 JJe), %HxD,$HxD$*BO e,O O EiFV"&@) H  (F#LpO0o?hB&6 !Y;Y-GFRLFQK  !FD"|DX8hHF0Fb!JFD#(@GI dX"x +thh+F$* H 0FJF#B(i x $蠤NOe.%%DEPF$ $N IS 4 JJe), $HxD,"HxD$<'BFe%($$BiFY"&c@) H  50F#FpO0o?hB&, W͋-OFvLFuK F|DX #1hrJ#rIzDyD9 oH *FxDh& '' , !D"XFJ@Fb!ZFD#(@T @&x +@@}PFO 0 p @FRF#p('LD޲B ڔAi $CѴB $~@F4$ mPO  y_ &F#B/  Ph"&@+LثEpT$!D lBO  tFB$!D4 <$"D4 6 p @FRF+F( EGE@F E+Fp@F +F((Fo#;hB&% c#V-OFaLF`K !FD"|DX0hHFd8Fb!JFD#(@VIbXx +@lh(F&A P 8FJF#(JO&DAY8F4$O, $ $_F  %FO ]E8F*F#(Q.4 MPO,6ZIF"%@)7.T#D\ -",-tF!D4 58Fj#( .8F #pO0ohB& eT-C FF܁!FhF "-hDnFrI(FyD찹fho+nI0FyD!kI0FyD(!gI(FyD(@`h( (Хh-^I(FyD@\I(FyD(C""  TIHFyD sPIHFyD~ Dshh(! F%h(! F%h(! F%(i(H(Bх9I(FyDP87I(FyDJ#w#h..2I0FyD<)qz-I0FyD2FIp i(?Z)F*F%I`i(?Q)F*F%@ H)FxD# IX x$ 11FI8FjF #yD (ևDgYŮφo-ARhF*oI#(F"F0yD &FgI(F"FyD& bI(F"FyD&^I(F"FyD&pYI(F"FyD`TI@F#yDK(QH&xD#OH&xD#MI#(F"F0yD 'FFI(F"FyD' AI(F"FyD'=I(F"FyDp'8I(F"FyD|P/G3I@F#yD(/HxD*/HxD#m5-IFyD(*HxD#_ x!xbxx%H'yxD##I"@FFyD(HxD#D& Hx)xxDjxx,y#&0F^8h,ʄ „Q]-CFUh!F-("8FpwI0F*FyD0$@FpI0F*FyD($@ jI0F*FyD($@0eI0F*FyD(@$@_I0F*FyD($"@ ZI0F*FyD0$&@$TI0F*FyD0 $*@( NI0F*FyD0$.@,HI0F*FyDw0$2@0BI0F*FyDi8`%6P4`lHF:F(# T5HxD5HxD#U:F(#.HxD#F F<,ND~DDh( !$'&H!xD%HxD$H!xD#HxD"H!xD!HxD H!xD@F0F!ࡌHF5# -Ѩyl_R/G`ڄJPX`hp{-OFFF(F!"DO DZ,@  6  B YF"Xh%E$x0HxDB4,޹*F8FJ)OX0x6'H1F"FCqxD#%6  !D"PF8Fb!RFD#((JX0x ). HxD).HxD#eo+NOR8F#~D4h*F(Fxg-OFLðFK!FD"|DX8hA(F0Fb!*FD#@(#Z#P 3I+xI d *FXF+FFyD"QFXFAe(pvPg- ѝu0CNIJYyDzD@+لHI"XyDJzD!peEcf- ѝu0[zN~IJYyDzD>#b@+rHyI"XyDwJzD!pESw-ѝu0ChNqIqJYyDzD@+bHmI"XyDkJzD!@ESr-ѝu0CXNeIeJYyDzD@+RHaI"XyD_JzD_!p%ECs-ѝu0CGNXIXJYyDzD@+AHTI"XyDRJzD!EE#ia-ѝuA7NLILJYyDzDy@+ ĀGIT yDEJzDl%CHe-#ѝuA'N?I@JYyDzDX@-ؕSCJ9IX9JyDzD!pEEpi-u0;N0I0JYyDzD02@( J,IX,JyDzD#of!E PV 9@߂Mx|uY5܃փՁo)I,!RF8T @ xKe-T  #ZF 0F(0FZF#B瀸O"ܑ$܁DD;0) @F B; HF #5- D@PFa#5- #30F~(0Fc 򝀸o5 'P%O HDD A #+ HF B @F 5#-A &O DD A #+ HF B @F 5#q-F ..,HjBCxD)HxD%#U #(4qO"OC`R[HxD#B3HR[xD#:*HRxD#3 HxD#.o+0FPFA?hB%CwNق-, #-C}NF FF!D"8F(Fb!:FD#~Dl(@ـtKXxF?(@h)O5(F#R(򿀘` /BHcHxD!bHxD#%3`HxD#^H!xD#[H!xD#OXH!xD#&UH!xD#RH!xD#OH !xD# #u-q GHxDFHxD"FHxDEHxD#pBHxDBHxD#Z@HxD#`(>HxD=HxD#V%F.%      O0p (F#BHhF%o+o(FTlԁ'Si6nyvy~q-GzNF!FF FD"(Fb!"FD#~D?(@ӀpKXxF?(@)O5(F#$(򸀙06 />!^HxD#3\HxD#ZH!xD#WH!xD#~cTH!xD#vQH!xD#nNH!xD#fKH !xD#^ #p)n DHxDCHxD CHxD BHxD#F?HxD#S>HxD#U ZF(FAF$"x E 0 xo+1h(AF$m"x*O%E ,x*h(AF$W'x D#x-PFhJF#O0R?Q?1?-O FGFF8"!8F kh|DXF:F+@Z8#LdXxD"*$x  xD"L x ? 6 - 80Z80:p|:p0Z>0@p|@pBPnBPD0ZD0Fp|FpHPnHPJ0ZJ0Lp|LpNPnNPP0ZP0Rp|RpTPnTPV0ZV0Xp|XpZPnZP \ S\\PxD"H xD"@ xD"8 xD" 0 xD"(8xD" :xD"<xD" >xD"@xD"BxD"DxD"FxD"HxD"JxD"LxD"NxD"PxD"RxD"TxD"VxD"XxD"ZxD"t\xD"l^xD"xr8#TxD"0Fg"X x$ -  6 8 P8 :P l:P<` s<`> P> @P l@PB` sB`D PD FP lFPH` sH`J PJ LP lLPN` sN`P PP RP lRPV` sV`T PT XP lXPZ` sZ`!\B\\DT4d|D}D{D~DyDxD@,I" FyD$e( FO F"$[ FIF F2FyD$N F2F$F 4I F2FyD$=% F2F$4 :I F2FyD$+ F2F$$ >I F2FyD$ F2F$ BI F2FyD$  F2F$ FI F2FyD$I F2FyD$ JI F2FyD$I F2FyD$ NI F2FyD$I F2FyD$ RI F2FyD$ VI F2FyD$I F2FyD$I F2FyD$I F2FyD$ ZI F2FyD$@5HxD"A ^ر" $s x+@ŀ(ڛHxD"o5(HxD"   =x  6  8@ `8@: W: <` s<`> A>@p |@pB0 ZB0D NDF@ `F@H WH J` sJ`L ALNp |NpP0 ZP0R NRT@ `T@V WV X` sX`Z AZ%\@g\PXF  8#\P?HxD"o@Fo+ j~(ER؀9UqɁ *ER1@PXƀr̀ր  -OFaLF`K !FD"|DX0hHF\8Fb!JFD#(@VIbXx +@lh(F&* P 8FJF#(JO &DAY8F4"G, "u, "jPO 6_F  %FO ]E,ZIF"$@)A .T#D \ -" ,- tF!D4 58F*F #(."8F  #(.8F #poO0hB$  U6F/L0I0M|D"hyD}DFFOq0FOS((I0F!$h #?$KXx  F+є%H OxD"xHxDjC"v "(+ - dx" HxD"_0Fpb3$|||-OFgIFgMF2FO SFyD0#}D5(@by  y@#)\L"\I-YyD{y ON {PKF+N "BFbBMInXNIyD!~ZF8F"wXEFDIhXFI0yD!O ZF@F!&?JO zDDO SHF0YFBF # -H+X2HxD(ay yy@#zazL.+OFF z@ Ff x$IU yD"BO HYxD!8F!rF" F`E LbFI-YyD!O0F"p ܬ4|{|||v|V|>|X|U-OFd!F FD"8@Fb!"FD#(~DQ4%&Xx ? O4 #<%O !Ozp4PT0"DO O Onp4 }D@|DPQ{DRBPSTUDVxD<<> 8$4TD0D04yDzDD}DW|DX{D Y\-YL,ՁI(FyD((F( F#"4I(FyD F#(F(3I FyD (I FyD I FyD I FyD I FyD I FyD(@ @I(FyD됹I FyD0/ !!D F#DI(FyD F#(F| F#I(FyDr F#~(Fh F#tI(FyD\( F#Ph(FR( F#Q]I(FyDF( F#wRQ(F:( F#lBFI(FyD.( F#`S:(F $( F#UT/I(FyD F#IF$(F ( F#?VI(FyD( F#3W (F (@̀ F#&XF  O P%F`LO RI5YyD!oO Y)FJF{IXFyD _FXvJowIXZFyD!/ /@F =/A +4mII@F0#yDF(@FD Q+u +F@F!JF!FHEWH3X[IJF;FyD![[QF:F!VDF@FRF#FFN /JѽXp o FOO bLIYyD0!;;III@F 0#yD1FAvFDXB(T'0(F7 BEĿNAEĿIQF!o+ O7 F%$(F k8F+TqY'=]7{1;]{{?]?{zzzzzzM:z^zsR:yBfy1/;Q+x1Q+xG]:K-GF9JFF{D F!XD"3hFx"F(Fb!D# F(O~h(F:F#(C(M4F}D>9](Frx4!v ,#HXY xD!l -I0F  OyDD#QF"#2  U9F4Sp#,HxD!o(F#F&p B# vvvvovK{D`H@xD»0R"-G$FFFFV_ 4O PP ,M~hBI0FyD# >I0FyD#!;I0FyD#!  0F*F#}x8,мh1I FyD# .I FyD# +I FyD#p @T",#HxD!o+1 " @F##@F#P. ` 0+IyD IyD H xD!z@F//N0a/S/0/ղҲͲ-OFF%FFP/ 5+-#l&B*H;Q+@xI FyD#hvI FyD#8tI FyD#(@׀&4 %L!BpFApAjI@FyD68hI@FyD0([feK&eHeJ{DxDzDB=@F# @F# `p,@F#  @FYF"#!x*hYF#v x8iYF 7#l x6"-exT-S#-xD!E@F6!. '!,xD!3@F 7!/ %!xD!!a@F 5!- &!xD!@F6!. '!xD!@F7!/ %!`xD!a@F,5!~- &!@xD!@F-6!l. '! xD!@F\7!Z/ %!xD!a@F]5!H- &!HxD!@Fp6!7. '!HxD!@Fq7!&/ !{ "h$ SF V'8! F# 7K8@hPF{Dh[F%-I(FyDI(FyDI(FyDhI(F%yD8HxDlF%%h,bI FyDhI FyD $5HxDRHxDOF0i(I#9FٿHxD?-(нHxD8KOPF{DhOS('vih.@-5-V-ЫH5FxDD!~PF5!z-RIyDIyDH&xDDD!f@F  XF!\>2K{DK{DH aFNbF\%xD~DD!Cy@F0F5!7-K{DK{DHaFbF,%(xD!#O DD y XF\]PF5!-09F8D"yI8F yD%F-  A-Z-$U$OPF@+@gOD:hO! F"p q=FS(,!F"F"`(s! F"Zhs5  R( ,!F"F"D(w! F">hwѪ yQ( 4!F"F"(\! F"!]ь5HxD!O0:A9tvXcD-߯ίo1* (:[Hx-`OM-a` L-`4U-GF(LFF'Ih|D hyD%nhG"hU@FOSo(5%hHixD HxD 0F#! S Fhh"phHxD! F"h8HxD!,O0@F"hSF@Gy2`a;B-GF1MFF0Ih}DyD@F%thGHFOS*h(F.h&HxDys F9#x0 (2! F F"O !(qhQFRF"qhXQFRF"h0i QFRF" JHF@zDhG O08=2ҫ-GF!LF!Ih|D hyD%$G$ phhHxD!F"F"chHxD!F"F"Xpphp!F"F"Qp+i; HxD kO0 JHFSF@GzDh^e1PUJ-GFMFIh}D(hyD$G% up`hHxD)F*F"hp)F*F" pph; HxD #O0 JHFSF@GzDhn0ǪX-GF LF Ih|D hyD$G$ tpphhHxD!F"F"h!F"F"pphp!F"F"p+i; HxD O0 JHFSF@GzDh .50_-OFF%!IhDyD$;pF  U Pch )F*FU`h"y hap")FU*Fh"l h\ NPF@KF~D2hO׸HxD yO0/0BK-AFAIFh{D@LhyD$Fhh|D@=H=I"XyDMFFRh}DF hFx+T6H9hxD H4H2F9hxD B2J2IX"FyD 2 FOF"IJ̱H(H"F)X(IyD  B!O$HYxD !o.8K"FIXyD0 a_PF$-FPJHXxD op,0"FHF9h2FSFF0F$ nsm-CFShFFF& h#< HxD H 0xD -PO 6*O0#F9F"F"@9Fh"F"9. h9F"F"0  @HF# F!FM#RhF F}D h(*OY#x HxD \ F)FF"xo+h08F!h#-)F"x.̧-GFF'U'@ 7&IDyD/hh"HxD$!F"F"YDzh(!F"F"QƲh(!F"F"I_(i(!F"F"@'.غHxD WO0 0@ #tHFstG>kj6K-GFIFH{D]XxDhh+h F ,8Fh"FOS7(!xFa  HQFJF3FxD )hB"uL -OF-MF&,Ih,O}D(hyD$p D npn`h#HxD+1F2F" hP1F2F"hphKXxF'@#h i>x@diDHxD O0 MHF@CF}D*hO)gZ8FHx!xxxD x+2ёHxD x  -%+%FH)FxD x  -%+%FH)FxD x$Hc -!+!xD }HxD++@ y(cyHxD xwH"y -!+!xD x` -%+%FnH)FxD x  -%+%FgH)FxD x cHS -!+!xD xP^Hj -!+!xD xb| XH -!+!xD TH|@xD -!+! vPHxD~(zOHxD mxMH"y -!+!xD bx` -%+%FDH)FxD S -%+%F=H)FxD B%xB9H -!+!xD 4x'P4Hk -!+!xD &x)  -H -!+!xD x*H@* -!+!xD ,0-Px+@@L H@ -!+!LxD HxDHxD8@ V*8! ߥ̥)vؤƤ/5K-CFFh3M{Dh}D0F4@Fh2FOS%(Q,H)X5h x-*O5`DD3hX0`+?!x8F %y$HaxxxxD ayHxD byj(F5VF@F v`qH\xDD yHF d(FCy Dq,FF^F#Rh2HxD O0#F h1h!HxD  O5FD0hB !F8F (F4jx eD ϟs-GFLFIh|D hyD$F hh HIxDyDt'h! F",!,"  Fh HIxDyD[! F" h HIxDyDN! F" `p p/QѫHIxDyD;PF((PF8HxDF"9Foi'HIxDyD!8F(8F8HxDF"!ji HIxDyD!M F!@}DO,@F*hL #//@(i HIxDyD! F!(vѠphi HIxDyDHxDi HIxDyD~HxDvi |H}IxDyD! F!vO,L##0(j uHvIxDyD! F!d8 @!%hj oHoIxDyD! F!S'j jHkIxDyD! F!F(j fHfIxDyD~! F!9  )@@F* .+P]L|D"hb(iѠphi YHZIxDyD_WHxD i UHVIxDyDQ SHxD )Ji PHQIxDyDA! F! C" (j JHJIxDyD0! F!8 @! hj CHDIxDyD! F!sj ?H@IxDyD?M! F! t@@F}D*hG<7H9FxDwO0$BiE0Т h (Ԣ ¢ԢѢС΢pVtuܠwdV:-AFF5MjF hF(}D_|hԹ1H1NȀxD~DDYMB2@FQh4 <(FB#x++-+4xڱ"! x}h/x+/C-/$@F1hfN$HLOYxDDD)FT B(F9F[h4F[v]ޠ;-C%FFFFV? 5&0B0`0`YIHFyD@WIHFyD(Qѭ`hSI0FyD!$"PI0FyD!"MI0FyD!" 0F"!xQ-hBI(FyD!O ?I(FyD!O ;I(FyD!xO  @T%,+3HxDvo+M0&`0 **HxD( ѽ)'HxDYo08F#(8F#0h IyDIyD@,JzDJzDH0xD8FȖyk+ ;qa^m-CF%FFFP? 5&0B0`0`NIHFyD@LIHFyD(Qѭ`hHI0FyD!6"EI0FyD!."BI0FyD!&" 0F"!xQ-h7I(FyD!O 4I(FyD!O 0I(FyD!xO  @T%,(HxDo+60&`8F#(8F#0h IyDIyD@,JzDJzDH0xD8F<O?o.K-CF-JF-H{D-IXxDhyD#hF0F  0HF" (F #HxD O0&hB1.!$"hF|IF*F #4iF F2EBqFB h`7## PB8F@2F C/!M 8 nΝ]UK{D`H@xD+K,J{DXxF [xC ZCBhB` S‰ SiaBiBaiaiajbBjBbjbjbkcBkBckc ZSpGT:K;J;H{DXxD4!F8H!FxD6H!FxD5H!FxD3H!FxD2H!FxD0H!FxD/H!FxD-H!FxD,H!FxD*H!FxD)H!FxD'H!FxD&H!FxD$H!FxD#H!FxD!H!FxD H!FxDH!FxDH!FxDH!FxDH!F@xDܔ޳ Fzִ6Vqѵ&KJH{DXxD4!FLH!FxDGH!FxDB H!FxD= H!FxD8 H!F@xD1Lȵ׵+8F*_H!xDB?*\H@!xD8@Ch( (VM}DUM}DUM}DTM}DTH!xDSHaxD!z*FPHCxDNHbzz!zxDbz8 OHHHJxDzD#z A--ХBHxDAHxD AHxD @IAHDPyDxDI]:JzD9JzD9HxD8HxD7H!ixD5HaixD4HixD2HixD1H!jxD~/HajxDy.HjxDt,HjxDo+H!kxDj)HakxDe(HkxD`&HxD[%Hᏽ8@xDTHs qsnkPdyc~ö̶ԶݶF%NFPh~D#HxD!c0 HxD`o+3(Fu!#o(+KXx (F"#9h(%O4FD3h4Bax5xxCA8F iwQF,I#,LFB=#yD|D(Hй(Fu!#(>"IbXx @IHbXxD*"(FF1h<(!NY/h"x?/`O,F&D+h4Bax6xxCA8F^ 𽟩 -CFDJFF F!zDP1)'=M>HVYxDAF<;HAFxD79HAFxD28HAFxD-6HAFxD(5HAFxD#3HAFxD49FL"(F@#`h:F1F0 x1Fh $ xh1F %xr i1F &;x+`i0HxDEo+)F=HxDHF*FL#pBru޵#+-CF=JFF F#zDP3+"7M7HVYxDAF4HAFxD3HAFxD1HAFxD0HAFxD.HAFxD/9FL"(FT:F`h1F $xh1F %x1Fh &xg iHxD)F0HxDo+HFL#*F( F F8F0_˴-G#ENFFu!#F~DF(t?H1X x(FCI(jX >HxD0F!h<#}8HxDom@|{Yp+}+L 6&|uG|Gĭ% {Ѭ{{}y[f-{-E{pj-A԰ hOs"FD(B"x*!H!xD 8ex5x &DHxDd*cxB!(F6|F 55 , #A# O OB R @FHDxD T1F*Sh@HxD! K{D`H@xDT`h7FPh0 HxDo+iF0 HxDO0I(FjF#yD07FPhPiF0HxDo+I(FjF#yD0կ-G!DLF ORF|D&hD0F60FIFmh-l@FOq2F #(g&h7p/aOR0F)FIF0F0.H 0xD@FOq"hOSD$hDDDB85PF)F4   , <  @F, OLL#CHFBaH, \fȮîȮ-AF5NFhF!"mF#~DT#p3+S`ht +HxDqI)KhX1x)9F:FF FA1xh)! F9 F41x i)! F* F%`i 1x)! F FI²4$ %@F#@ jFyDP/o+&𵇰F8MF!0F"`h}D01F2HxD+hx1JX x)! F Fhx(KXx)! F F iP0HxDo+,`iKXx)! F F_iL-Y)x)! F FI8F2F#yDH 𵇰FBMF!0F" `h}Dx>KX x)! Fa F\ h01Fs4HxDAhx1JXx)! FF FA iU x)! F2 F- `ixKX x)! F F iX 00HxD-o+ix L-Y)x)! F F I8F2F#yDL7F?HF?LxDhF!"|Drhhx:KX x)! F FhPiF00HxDo+Phx*JX1x)! F F 0(i!IbXx)! F FhiNYx)! F F_ixMdY!x)! Fs Fn I8FjF#yDܥa𵅰FFh'XF9F(d'nh^HxD\]I0F"yD^[I0F"yDWXXI0F"yDP(Hр!!!)Ѻe/W- hpXO a)hHCHxD)! F F0"/  +  OPh04HxDo+AYF& / '`(iP'D!HxDth8FF9Fh HF@"FSFOȿo UҘN/)';3)^s#SMFTh0}DPI FyD(@MIjF#hyD y#0F0GIjF#yD(~۝BHxDAIjXx6._>HxD ;HxD9HxD@6HxD 4HxD1HxD/HxDv,HxD*HxDd'HxD%HxDI"HxD@FHxDHxDPLHxD Fo+ pl-˧Ƨا7>.K-G F-IF{D[XhFTh,4#FBM"F)h &!F8F"5FD8F)F">鈱$6APF,: /4,5HxD2HF F1F108F)h2F#O00BƔ +,bK{D`H@xDFLP-CFT F.FHFFDxDFEHF9F Hf OxDDxB)]8F4qHCxDлY`p$HNMxD~D}DaY0F4Q,pȭ7+-OVM$RhF}D*=F h(@NOYD*x/F ax)IH"xD!_ExFH)FxDP,DH!FxDJCH!F xDD B ;x6 HHF5 c:K  {DhOs4p tp B-OYx@4*GFX б,YF"x)7%I@FyD(#HAFxD;h3 HxD&o+#OY*xaFHOF RFxDh!FI FyD HF@"F Y4{OqAGjN -AFM$FPh}D0HxDo+(JX1x)!F"F FB @F#9h7xhhDh$HxDC(Fˬ-OFsM$PhF}D0pHxDo+mJX1x)!F"Fa F\ B @F#9h O_HTFxDT\HxDE0xhP/#h i;F+h'iOHxD2x!i JJzD:1x%i-/OG r  AH'xD?JzD_EZ=I:FyD3xj Q#EP3 3+!1K"D`F{DbF0xP)KAA+ਈ#I#HyDxDr2x HJFzD1x UU7D  dD4$THF =mւ7F6L FFJ F`hzDHxDISXxF*! F_FZh0HxDto+9x)! FJ FE)h0FjF#3|K-OFLN{Dh|D ~D:FT BB #O   I@FyDF(cHxDL@F6Y!F2x"JF xHxDhHxD3x!FF xHxDhHxD3x!FF2x !Fh""FxHxD1HxD2x F) Z(iHxD!F"" !xH)ixDhiHxD#DѶHiixD2x FiHxD~DF#AѭHixD6xFBШHxDhO@ZF # F2EB XFBh` 7 5O O 1x)ˀCE ѭ8 4O@   D  8` y`D𯀘0@F *g!F"x:*@2x@!FX"6xxHxDihF?uHxD@2x@ :h4(?Y'BjHxDh&2x*cCh+?Yx!) * OO~Z:`h+?HF9DCwWHxDhro+u:!|hOPKih{D W-CF#NðF"K!Or$~DVA(F\W$ 4,xhPJXx(`, иhPL6Y7xh` I*FHFOsyDA B'C ®-CF#NðF"K!Or$~DVA(F W$ 4,xhPJXxnj(`, иhPL6Y7x_[h` I*FHFOsyDjA BC *-CF#NðF"K!Or$~DVA(FW$ 4,xhPJXx(`, иhPL6Y7x  h` I*FHFOsyDA BCt -CF#NðF"K!Or$~DVA(FfW$ 4,xhPJXx(`, иhPL6Y7xh` I*FHFOsyDA B1CЅ -CF#NðF"K!Or$~DVA(FW$ 4,xhPJXxxt(`, иhPL6Y7xieh` I*FHFOsyDtA BC, \K{D`H@xD@-OUhD5-HxD?O0N*KOb{Dh+F*F h< x(;O DDaxE(KOLOX ;Dx0 B!+[BXF PF 5 0Fo$vW@-CFFHxDqEHxD#xCIyDBIyDBHxDbAHPxD\?HaxxDWx((;IyD;IyD:IyD:H&:OxD@9HDDxDxD86HxD4yB!Fv 0HxD+m {HF -@F8FE6$H!yxD "HJK xDHDH F0xDLM N0HO@xDAEVRI5-\'7EFkI#RhF0yD h*gFBc(bHxD OS8F #1h򭀴X`BWHxDoTHxDSHxDRHXxDzPH[\ xDrMHxDn]FIHxDdc<EHxDZi2AHpxDN?HxD1OUF1h;V۴o *J$'3HxDE2K OU8F"{Dh#1hqpF/(HxD, (%HxD#( HxDHxDHxDHxD HxD HxDHxDHxDHxDN(F>ݬެ%EFE@Qf=.HMs h"Zxl(u8opG pG-OF %F5F{DXxDb" *#h(!#l8FyDFOc/T#OdN*aO/dyDP*c "Q(fTVF#}D#`(M&*.8PF "puxo8 "PFux*@/ _'o"PFPFPFAF('o "PF)xI )б o/@ )F F(vIPF"yDPH'IxDyDDIPF"yD(е,T"#h(ѧ )@/&-OWclIPF"yDk3IPF"yDa(@$@&PF "=`pPF"N(PF"H!PFYF"@!IPF"yD7(u!pF PFpFPFd*c QFd#zPF "JPF "Kx(H)OoPF "DjPF "Hb "PFFx*a *@`PF "Lxɹ0IJ,OoP O "PFIpIFMx:+O8PIF "Nx:)0 "IFO"x *'в oPF "QPF "xRxoFFO@gI  yDRF(خaIT" "$tyD  n[ID @TFyD4WKF{D_)SЙO ( L#F;E,=F*78F#8F") m* 8F Jv*8F Cp8FA DYF4 FO8FO83T"xfR@ / IPF"yD(%F5p@F#/hB% e2%  `$-OFyLFFxK%xI |DXyD !0h "5  P P}h-ƀlI(F"yDw(HFQFZFfI(F"yDjF0O DBF`^NB]IYyDodT0x0WHO8xDKUIpbXh-SHFxD@   0d+ ѽ P',OkJMAD}Dh1FBF;F0EHoxD-h-7/HFQF bOc10J)FXOb;F6/0F[@F8ZFAF#@F W0FQF"0F ;HFEXHT @xD !F1F@O05 hB7lz gSb*(10^LWߦK{D`H@xDn4B-ObM FaK"`IO  }DXyD! h`i  !`" |BFKLBJI+YyDyoxDJFHXxD}CIPFyD"Fh  !"HF:(FFp/1 _0 D ( D,BHxD1  H"Xx-PFJF# 6hB HxD|O0 t #iK-CFhH{DX4hThL"x-*dHXaaK "{Dhy! d FN(XH!FxDG8F!F"8F)F"P$ (FBF@#DIFF`& (FIF#B BF&F,DH!FxDm! F " F )F9F"FGa !:F7H)FxDO0O"FH3v0H"F0IxDyDw< ( !"HFR#(F"*p(0 IF$H!FxD\!O`~F@HOaO4xDM&Ob(F!F#2iG(8F!F(F F3hBr mT J K{D`H@xD<-B-A#:MFFF}D(h `ph(98F*F#(V%FFE%E5%H9hxD ?#H9hxD!HyhxD HhxDHhxDH9ixD hZ8F*F#6$VE$qhA, HxDo+4,¦æͦצ{-OF[MFɰZK$F}DX4`hGW$ 4,,O3jxhx0 +O ;FFIIkXxF(BNCHYxDCO 'O EO209I"hyD` BoMJh1IFyD4!-IFyD*%L)H-YxD, B  L@HFOsI2hmXh(x HxD HFOso+@FG7hBIo ۷K-OMFFK$~h}DX  h 7B  #( H!B#xDH!xDy0F0F0ހI#FJ7F&FFFyDzDi{I#FzJyDzD 9FnC(ŀNs)ѝM BmNmInJYyDzD<6 eH )X &#N c*ѝM9]J`IX`JyD0zD6 @VOSFZI[JYyDzDSo*ѝMHNOTIUJYyDzD46FNOIOJYyDzD4k*ѝM(6 =LGIHJ-YyDzD! "+?yf8 "8FIF6(0FQK{D`H@xD֫  h( ۽ HB!RxD; ]-CF,M"chFF}D{ hF(@$H!xD7h)6F9FU_xJOJIYXehyD09FhB²xihOJYXI0yDh3h UO1hE"@F0Fo+ aH K{D`H@xDjj0YMRh}D*@C-F hh(RH-X!h*x OHxD+xah LHxD(xh IHxD*xh FHxD+x!i CHxD~(xai @HxDv*xi =HxDn+xi :HxDf(x!j 7HxD^*xaj 4HxDV+xj 1HxDN(xj .HxDF*x!k +HxD>+xak (HxD6(xk %HxD.*xk "HxD&+x!l HxD(xal HxD-xl HxDHxDo 0(`    "&*/37BK{D`H@xDx0@MRh}D*uC-F hw(p:H-X!h*x 7HxD+xah 4HxD(xh 1HxD*xh .HxD+x!i +HxD(xai (HxD*xi %HxD~+xi "HxDv(x!j HxDn*xaj HxDf+xj HxD^(xj HxDV-x!h HxDNHxD 0D^RX_gpstwzK{D`H@xDľtҨ-AF=N#RhF~D:F hc4H1Xx!hU 0H&0OxDDBڣ8Fy6 𧀻F@𾀕HxD]J𠀻a@𱀏HxDPi ػf𙀻h@𡀈HxD@𔀻𓀻j@𒀂HxD1E   @,,& DDlyHxDswHxDwHxDvHxDvHxD +r1xPF6,<YnHxDcmHxDlHxDlHxDkHxDkHxDjHxDjHxDiHxDiHxDhHxDhHxDgHxDgHxDfHxDfHxDeHxDeHxDdHxDdHxDcHxDcHxDbHxDbHxDaHxDaHxD`HxD`HxD_HxD_HxD^HxDB]HxD\H,FxDU@F!F-`-?Go+ FN8F+hB-0Z }`pФORESa\y3f{ͥ+cep#=H£գأ9`kr{Ϥޤ)=?G-AFMFF hN}D*h~DFdhF@FhOS(K/hX0x9h B@F4t O0SK{D`H@xD,^FPh#F@:Ų-#ظh]X0I "F0F#yD I"F#0FyD )FHRxxDo+0Ftd`dpFPh#F@Ų-#ظh]XI "F0F#yD{ I"F#0FyDE )FHRxxDo+0Fcc#FPh#FPƲ.%حhme(FI "F8F#yD<I"F#8FyD( 1FHRxxDA(Fo+ ccǪsFPhFH($؍h HxDiF(HhxDh g#0I0FjF#yDo+ppcsFPhFG(؍h HxDLiFF( HhxDI0FjF#yDo+p'b-A FQh#Fq#)h(f)hPj-3JzD3JzD2JzD2H$ȀxDD!F@FN4 ,Bh0FO-F&` !!"²F*'ؠh(`_L НL04`h(8F)h#8  o+ϩĩ˩1K{D`H@xDڿ sFPhFȱ{FhtF HҲxDI0F#yDo+pK{D`H@xD@ O0pGFN",hF~D$HxDHhh|x@H"FihxDo+IrXx-NOP!FB]~D3h8F#F0h8FN -AF%OFPhD8#H hxDo+:KFI{DhyD F FBH?X9x-C]hOSP@Fh"F(N:x~D4h&h ))F66 H2FxDb  HxD\0FMf a( -OM4F $ K`hDX h$" (ÀM ( QFXP.xi2FdFh 7`*xQF""YUF@otH)FxDo%hu`, x0(`xX(4 Fh@F ص |O DaHQFxDq0 )˲  TE! HF?(TMJFTIX`yDPHF(HF_77ò# ySE\ TE Lx _3>HO >LxD|DDE? z F @FFz  2FOs9hTo+t#hB5A2FhOsHxD@F`HttxDDDBB ңXF8HFQF44  M.M ժ,0:&K-OF%IFǰUh{D\X h'FE5!HxD`o+/h.h)&&&FJ$  XAFxhh"""5H$4BPFOsE?hBGJ 6K-OF5IF˰%{D\X5`Qh hI10HxDo+Jh4h(O FO FF'J$ X xYFhh"" 5K$04TEٹ@FOs9h%6h:x1h HxD\@F9hOs=@FI hB,KJ *M.K-OF-JFFǰ{DX"2`hFE0'LY+xF)FgFb ` )F""VR``9h@F"FOso+@F"F9hOs 2hph HxD@FE`BG$I m6K-OF5IF˰{D\X!)` hIPhh4/HxD'o+IhF$+J )  O O XF xIF"" I$4TE8F1hOsE-h2x)h HxD}8F1hOs^8FI hBMKXH 𵅰M"L}D/hF h|DFp-h(F I8DyD H!X(FT1J0FbG-AF6M FF}DQ/ 00N8F #0I~DyD2hK(Q-OYx90hhDhh"35h&HxD <(o+7 phAF@Fx*ѰhAF6Fx(3NIYyD h(x.F$A M h`0x I8FF=4h#yDT`:oG]Z=Y L|D+ KXx) K{Dhh JzDh!hHxD $F<8M}DKXx)K{Dhh JzDh%h--U HxD HxD HxD H)FxDk 8EVJIHB@MK{D`H@xDjpLK2F|DX#)h!IyDgJHXT @8I"hyD% I3F"hyD!+hB"p2K-GF1JFİ1IF{D FXyD;hFC 0F! #'HxDp8F)t) 0F "F#%HxD H&9F"#xD*0F"F#HxD xIyDIyDHxDC(F0BD|= TKȦͦK{D`H@xD,Z-OF\N$FPhF~D(t"FtFkhELDT pO YF@h4(o[y)WFK" ,PШhPDIEHvXxDo+u FPMF=K!F"6}DU/ F 6I0FyDS(UV! (I B+O,HYxD80F!F"(4U P+x "6"# F#;8F "F#2I OR#F8FyDhIyD1o+o/0B40@6 Hդ(tsFThlI2FyD(!HxD/ F FIF2F(FyD(C#I(FyD p3K{D`H@xDX-OFMFKF@}DXhF , F W`F.@𡀍I F:FyDI F:FyDO I F:FyD}(@OU `3x#LP{O Os"]D8h#XF _-Oǰ[O FZK$YJ&FdDX,WKzDpDh{DE{@F"$ (z(y)x(O O DJ(pY@F" ([(Z)x(""DB+p<@FYF"(EcC FX (0 )(HxD'JXx)! FW FRF ) HxD 6.pHxDanpD ~tnx!h#HF*Fo+oE.hBG1 &g1ڥڥ-O%LFVhFF|D.E 2F3FAmi(OYB'xƈDO.O,N*O(O)O+' O.L"H#I&K%G$N 񒲛HxDs FR5QF8F" F- ؠO"IYyD+FR"K  0FX!F*x"RF@x.@ *x  !F"2F@ x+@*x !F"F@x+@ހ*x !F0h"F@x+@ɀ*x !F"F@ x+@*x !F0h"F@{"x.@*x!F"2Fk@g$P x(@)#0  yGHxDo) ! @4B>HxD[)Or @z3E5HxDF")!"_,-HxD4)" BHcE#HxD `B`.& ` BHxD ))%$P d- HxD7o o+HF:F# ,0ɣʣˣݣK{D`H@xDp-AF,MFFSh}Dӹ*N!OTB~D3h#9h="J7hXT3IFyDFPH)Xh x"F-HxD'NOP$~D3h@F#9h H)FxDO4 F,<zݥХFUh- F0qHxDo! !`lI*F```0FyDX#hA`bhB``#scI0F*FyDX#hB``h@a`csZI0F*FyDX#h@`ahAb`sRI0F*FyD`#hA`bhB``0II0F*FyDX#hB``h@a`ct@I0F*FyDpX#h@ `ahA b`t8I0F*FyD]X&hB@`ehE@c`t/I8F"F#yD,H!xD F9(I*F+FyD($HxD8 *"H!hxD H!{xDHa{xDH{xDHxDHa|xDH|xDH|xD(FnQ5ޤääڤܤޤoK{D`H@xDL}*K"$F(N!F{Dh >8F!#~D!HxD I"F#F8FyDHxD)F@'i!HxDJX4x3F9h 9`x{h{`h` HxD(F(b)ǦͦSh pG-A#NFFWhF~DF8Fx KX7x( FAF*F. Fr(o+(DKEJ-C{DX+x h+O0 0$O@T &Ovq8HxDc(x!h !`*xah a`h/H`xD&hf` ah)*H&"xD&``(xh `"i"as!jF bH&t xDHDxDi @Fz6b .-xh"i 0,`$j$HxDM 8FL(K@4Ț-OF,MF'}D+h:F#`;FpF1h=! HxDy4H=FO OxDHDxDi B! D5_ d``QFhYF"{8FRF@F {/2DF*M FSh}D빏h/@ hZ(D,: !HxD HxD HxDHxD(&iF"FDx(!   HU P+x8F!h0 O0 o+oJ&*B#LFFF|DU 3+o+#Ph(MOp}D+h8F#1h<( N*hYh'x HxD5 ~%?zwK-OFvM th{D}D,F("F@Mh#F6 t" F eJ X.x cH& xDDDHF[%"zazB - EPF5   6/ .$@F ,!t"@F  FEImX 'O@wDF &2p#&rU (TUOл @HF@HFѨB?cz++;D C"h D N!X cz˱: D B J1h0haE B J0X2XE3cr5*F6$4.h?BFt# h(O0)py$-OFHLFGK Uh|DX1h -= *F+FG]/ F h3UFSKEŪF6IdX x 4HO ̰xDD E  XF   <8F.  !"HF (F,F(p/ _0 D (D,E  o+ 6hB H"Xx-PFJF# # T!K{D`H@xD.|^vuK{D`H@xD`veK{D`H@xDD6w-CF4J$FFzDU$0 4)O-HXhh2xF1F"F(%HxDo<,@F#9h-P;h JzDJzDHxD,љ 1Fh""OK9h@F#o+ F f!ة-AOFF F FAF " xh0(HxD8o+GAF "("H!xDo8h0F)h"F #rHxDh! ""F)h #z0FpHxD"F #Q HxD HxD0F:<-!!)mK{D`H@xDXuFMF&}D2FpF3F9h #hgHxDIyDIyDGh 8 h V(< HxD HxD HxD)(FuO.+$C K{D`H@xD:u-C#zxz*HxD4 A/o+hyD#F.^OӧK{D`H@xDjq-GFbMFaKF}DX9h"F+]IyD([HxDD ph(zxh+?+ !F(" qh x1* 0* pII "PFF6yDPF1FC:(kНb) ѝ0 FQF7(8H8IxDyDo+Z @ F(K1H1Xx. #Os#U. Op Ovb `& OrHFQF#F HFQFOrV3FF "FI{|D8FyD^Fo F(FSS-CFFhFFF 3OBHFoxDA@F!bFx! F!HD8`7 F80o(F||-OFO#h$FF D,0@ xHxIxDyD+\(uHuIxDyD!hh sHtIxDyDK(pHqIxDyDh oHoIxDyD ( IFE@kHlIxDyDo+ FOQF(dH:Xx) 'Ow'^c) OP OQO  0F@%9FSFF(w@'9FSF 0FF(jOr0F9F#F(^ 5DDU1XFIF=U # 9FOr0F XFQF&X0F9FU<@#FH5(HZF(IxDyDHo+/x'K` I\"F @F`yDFo FHF _KRp7R})RRRQP7FxFO2!&F)F F!0-AF(F"8x(H*FIxDyDI FyD'I FyDI FyDH"FIxDyDo+\O "F OQF(TN Y+x+ !Oqp+ OW 'f!O\ F(FOr#1FFF(@ `!(F1F@#F(@(F1FOr F(@ѸFQFv((F1F@!SFF(@ր {ѝw BDz_FiG '(#  PFHFHxD]{AFZFnHFo+IxDyD HI#xDyD, x I D) QFJF`JJO zDDHO IxDyD."PF   E  PFF8qHxDQFoGFYF{6@jHjIxDyDO75'(F1F@)F89.xvFC (F1F@)/FF UI^F "F yD\FO FHF@FiEIyD"o8FJJBJ*9uu"JJ IIIdIР&IƠџHHHH5 LH H F @F֞.FEEK{D`H@xDpUFP( ( ( ( JzD JzD JzD JzDJzDJzDHxD AӜ-O F$Wr}DnX7h'Ge*xfvvvvvvvvvvvvvvvvvvvvvvvvvvvvv vvvvvvvvvvvvvvvvvvvvvvvvvvvv|z:0v7vvvvvV^g/!x8xD 0yD,yD,xD ax$xD'xD9 xD xDR0/xDP F!FxD`x#xxO JJ,LB`#xxD#xxDxDxD"xB$XFP \XFAFAFxD=xDxD!F"xD|#xxDjxex#xx@'dGxD xax#xxPG,xDLBak@xD<xD8!xD"Fd\,h/X;x xDW:xah xDN=x!h xD=!xtxD>axxD8xsYbh+x# A)`` \ XQFMQFbhxDahxDxxD QF$$QFxD"xD~(x!i |xD/xai pxD+xi `xD*xi TxD-x!j DxD@xDJ!hX;x 0xD8xah xD=xh xD:xh xDI'kXxF /?OFO, EH)F(F(DE ! P]cIZE`bHxDe]O!xbxchYg(x( }D$HxD!x`xxLO L-YL.NBa+x H@OM@xDDH}DOM "xD $DJH}DO M @#zDxDD H}DxDHxDH#xxDLx'xU Px@"+xB Ia HxDH#xxDH#xxDHxD3HxDHxD,HxD!x F)F/ѢHxDHxD+?HxD++?!x)+y \ YFH PxD@HYF+F"FxD~HxD!FFw``x!xU 0OJxJ,xLGa HxD^+^}H%O !hxDDY!h BPF)FzhM5 -Bxax#xUPOKxK,*xL@g?hH9"CxD+#cH#xxDC!!x(F^HxD)F!x F![IyD}XHxD!FO0'6hB) JߛҚؚE`cbaesjgdf@̛֛ܛs+84 &0487CI"Om`m&44F"0 F IF"D-*FyDXKI(FyD#0Va-OFfNF @ FO~DF(`KXx) "Or"0]Opc=h5HF!F@   !"PF!(F FBF7O#"8hX%DHV`xDp HI2XyD:h % 7H` )-&xh(нhűh,J/I{hXyD o=h !O%HYxD,Op" #OrFHI*FwXIyD~`HF"FIs| yD[F F(Fo)-OlMF 4 kKFjI@}DUyDuPF Oq]F(_IO jXx+  Op g1h)!F"TH "TK $  O xD{DV+ *cF (F V"8DJXRFBIyD#C)=O?I?JYyDzD0 V+(-( 2N5I6JYyDzD:*!oBz`{hCx`yh y`F( V+ȱxp  &AF@S #HFI"F#yDwFo F@FouhB]wJ TޘnXV*E܊-OFF_J _ID[p@uyD8hg(F OqhF(UIO[0 O Ozh)0F!F"n Fp i_x-+=I[ yD% 7K8H[xDAF5I@FyDPh D(,N/H[pxD IF,IHFyD*Fo'O oC +`)hC*`(h(`9FOr%#@F I0F"F#yDF H)FxD F(Fog7hB}ib vwJ"-OF0FK!F"D[@ h50FPM,Ai $Oq(P& F(O [ 0xF,  Op(i:h*@F)F)"nI" 4 $PFFyD4 PF9FACt(𨀝Fs(ѝE J\N]I]J[pyDzD%30Wh(ѝE(3Mi(ѝE *30Cd(ѝE`INKILJ[pyDzD2!3-c(2"( ܰ>Q" 6L:H[0xDo FYI2#Bۭ 4礳pL0Z0@`@'Jp& Or#pI@F*F)#yDdFo+ (FXFo5 hBJ7 >-AFMF @ FhF}D`KXx) "Or"]OpcP8F-!F@  BF#F H)FxD F=(Fo@-AFMF @ F"F}DhKXx) "Or"]OpcP8F-!F@  BFO@SF H)FxD F(Foj-AFMF @ FF}DHKXx) "Or"OveP58F!F@ E HO5xD HO1xD F(Fo(f-AF7MF @ FF}D(\2K@X@ x) "OrF"eP-0F!F"8(F (FFH9hOwxDB # pOr F 0FIrx yD"FF H)FxD F;(Fo-GF?N F @ F~DF(l9KOzXx) "Or"툤e=h-Lyh !.O.HYxD  (FIFFH'H1X(HxD1o7 Fxh" #@[&L gF(H)FxD@F"FIsz yD|F@F!F@ 2 F(Fo ~-GF,T F @ F}DF(4X xF) "Or %Ou OzO 2u8h0@F1F@ $d"O O,%O  #BrO O~@EB@ILE w @YLE@f@eB @cB@Z$ @gB%I)F*F_xh )F*FP=A O,L A ' @GH)F HxD! "FSF 9F(! Or#   @E  @ # @A #n` " #OrFxh(W(' Orok # Or D]@Y'  Or)F*F7   "F#`: 13 +))F*F F $ Or#=" "@U2&BG & "F  ^e(7  Or#T(&# @g Fp@F2FI|~yDXFo HxDo+0F Fo~Z-CF8MF @ Fg}DF(]2KOx@X@ x) "BFF"eP-0F!F"6(Fq (FlFH9h xD# Or RF 0F"F~yI yDF H)FxD F (Fo@{}}#-MFFF}DT# 3+"F8F1F6D$N~D7hyy=!H9hxD5+)H-X`h+x)F3 A F)Fh")Fh"1h8F #j K HXxD1o+ FN֐-A$hNFFF~DU$ 4,},aKXxhhF(nF,WJhX"x""}y !@F#9h(JNJH~D5hxDihohO)EHOrxD vBH&AOxDDDihhBڡz@F"h# 2E3+5HxD 3IO yD hh6dDo+=o::Dy)P!DG)=O| DHhxDIO yD h` hDhT Dhhvʟ #3X: :9o8999kK{D`H@xDh:5K-ChRh{Dh*XF h(TF,OxMDDD0? > 5 "&*-0!H!xD' H!xD#H!xDH!xDH!xDH!xDH!xDH!xD H !xDHF !@F !8F !4@, )F"Hŕgoɔ-AFShFF+4@FO@P! F hh%i@@Q!X%Xo! FZb5qF"F1h 8FF F0Fo+oK-CFIðFTh{D^X3hA, F (FI FyD8(@nABhF$mFw( I FyD'(DA B(I FyDA B( I FyD(@FA B( ѻI F"yD(@@5B( ѵI FyD(@!@6B( ѰI FyD(@@7B(ѪI F"yDObI F"yD@9B( ѡI FyD(@΀@:B( ќI F"yD(@@;B}( іI FyD(@@kBp(ѐI FyD@Be( ьI FyD(E@BY( чI FyD(@@6BL( сI F"yDx@7B@( |I FyDm(@@B3( wI FyD`(@@_B&( qI F"yDR(@@iB( kI F"yDD(z@jB ( fI FyD8(n@aB!( aI FyD,(b@bB( \I F"yDA( WI F"yD(IA ( QI FyD(=@cB( LI F"yD@>50Uh]*FC]+F h?(%H!hxD{HahxDvHhxDqHhxDl H!ixDg HaixDb(F HxD 0FQ]er}-K-G F,IFTh{D_X;h,5#FBM"F)h'!F0F"DD0F)F"x젱$5AHF,: j4,PF5o@F F1Fm0@F)h2F#o+;hB< tr֨-K-G F,IFTh{D_X;h,5#FBM"F)h'!F0F"DD0F)F"젱$5AHF,: 4,PF5 @F F1F 0@F)h2F#~o+;hBmt qwK{D`H@xD R3-GFGMFSh}D+4EOOVDID;hyD#V(u?HJ!X(x/F(cI^b8HxDD:x*M`2HxD6 OhiN,L,H)YxD1-o+<$JXxFp@l@Fe@a8F PZ@V0F 0O@KNO`#p~D2hPFX“Γ֓Ph-OFbOFF%DX%`5--U[MOcPF}D*h3F2F SH,hxD RHb9Xx F!KRMHxD KH xD(xah GHOxDEHD!zxDzCHxDv!zE XFFyi [- 8L9H?YxDcoO/8FyF81H9FxDKo@1F:F&#  #``r``h(F* H)FxD'F6^EZHOe&r"F;FxDhPF%F F2@FO0PFBڒܒ6ē-OF>OFPhDh%;LO0F"D9F0(F9F"FP4HX6HxD1o+YQF8F"pQF"8F p F]FFXFF&F"K%HXxD  XFFXMHX`xDho$:F1FG0 OW)FRFK"F{Dh[F IyDPF F]HFFz04$-AFM FF@F}DXN"IYyDo%hJHXxD F!o+MK `OQ"F{Dh#8F1hF F (F֏яt-AFMFVh}DVNHYxDo+& FXJIX"yDo0FK `OQ"F{Dh#@F9hF F(FX~&-OFMFFKh}DXh?)mth$IHmXxDl  "PFT F@F~L 0FF@IU 0yD>AFXFRF#HRH!hxDFybyy!y'zHezxD9H xD3HxD.H!|xD)HxD#HxDHxDHxDiQJHXxDo+ i Ft/ٗI F"yDPﰹGOSFBؿ݁OBFIYyDF'FO PFFXvLRF)YIyDoph `hF5 (jH+XyHxD 9(hF"(aJqHXxD-F#(3iF ( VNgIYyD HFdHxDF! (MI2ioX_I HFyDq]HxDIF{o+upiF tqiҲiOPBp i  p/NO  YAIyD4#cE ړ>30`@F0FFFXH1I+XyD2Fo AFXF"FSFF8F*VJ3F%IXyD  F0F?hBA ĎՎюʎp6 -OFN!K " ~DX(hF8F!F"8Fi!"@Fz! FBF#$IyDF(@FJ !RFwH)FO4xDyH3:FiqHxD ( !"XFJ"(FYF*( " fHxD!FTO`vF0aK{DD _HOaoxD>f* #9FOb(F"iG( TL8j3YHx BHииIIyDIIyDHIyDHIyDHFFHHxD0FBHxDKDDJ0EAF#xZx#Q) ) ) ) 1IyD QF YF.IyD.IyD-IyD-HxD+HxxD*H!yxD"F(H2xD!"# dD(F4 FPBz  yyyvy|/XyhMnjI5  {7FLSh|DKFIF(FyD IyD( H!X x HxDA 0t7FLSh|D۹ h#W(*H!X x20M\ HxD hFc F^ I(F#yDmo+0K{D`H@xDl$KFH )4 F $F"F{DXhF+h !#p H "!DkF(,9F"FxD /hB f N-OFMFKFh}DX8h=)XѫKVh{Dh&JHXxDT  "XFOUv0FZFHF#&H!hxD~`{zz#{{{HxDqybyy!y zHezxDdH!|xD_HxDYHxDSHxDMiI~H)XHxD1Lo+@cF`vLI*YyD@*o!@ ph{ `*PF( fNRFpIYyD@F mHxDPF (\IhmXhI@FyDeHxDAFo+h!T`QJ_IXyDh@F\HxD XFNFYFPFbFOsnOKRF{D ScEB!PF tGHRF !|xDvi0F (FO 1FPFZF#@ٰ`9HRFxDXFv0FFht2Fo.IU 0yDtYFHF"F@FPFVI3F mX!IyDZ F0F=?hB6? ֆ:͊OWjp\`v8hqcH" hF-CF_MOpFF7F}DX[L[H-YxDo!Or`@F9h"FOs MOY+xaHf'O fbE~8F  =7BI0FyD##pW>I0F  yDH#NFO #pV(Fa@)4HUPxD BP*O/HYxDo+@` (I0FyD_NFO Vȱa@) B(д K2FIXyD0o@&bU xRb@F"F9hF F@F>]F\VE-GFkMFjKF}DX0hF!@ZFPeLeH+YxD2o!@~hVPF"F@E XOYxejaO afE9FW,hFChF  \$7II0FyD''p^FI0FyDh"7$&"pW (PQcF@+8NI8FyD(0h#""-J8HXxD )HOs)X2IyD> hOs N,HYxDt:F*IU 0yD%6q%J!'X x ~'` B` ~ B I!HF"F)hrF F%@Ff~+̑Ñ|-CFN!K " ~DX(hF8F!F"8F!"@F!" F#I BFyDF(@FH !BFڂH)FO4xDH3:F{HxD! F"nO !F(F"pHxD!FwO`F@kODDDujHOaoxD_ jg*@dIrXxH QH L QL (bдNJ+N]+^+_UIyDUHxD4THHxD.0FPHxD%JNH FxDLHKxDL0+<+=;+><+?=+@>+A?+BA+CO+D@IyD@HxD?HNxDNPi#!FOb(FiG( ݄N1IyD1IyD0IyD0IyD/IyD/IyD.IyD.IyD-IyD-IyD,IyD,IyDh*+8FIFAF(FB FPBV kkkkk k~wf|er~} !2NPcP YK{D`H@xDTz-OF)LFF(Ih|D hyD;nhG"h@FOSU(7%hH)hxD3HihxD.0F*! F0FhIh  HxD ! F[h3HxDtO0 "h@F@SFO0zWb#Ҍ-AF&MFPh}D $IyDFh!O5F0FD9FFбpDFHU PxD"H)XHxDKHXxD1O40F9FPF J HXxD4F FԒ-O#!<% 'FF "&D$ D $T(0DD)yD*ptzD+0|4}D|DxDD{Duh-с(FphDtDYxD(Fh$X xD-o+(Fhh l&JHXxD(FPh$08F#I$`yD(vI8FyDFM:FIdYyDaHT @xD(F(hI8FyD $N| I8FyD0$ |$h.4н$0FI,yD$p(𗀎I0FyDG@I0FyDGI0FyD G$ymH2FI#XyDniJHXxD~I(FyD8h8(^xI(FyD8h*)PrI(FyDh²V* )>PMiIdYyD4gI(FyD}h²Qϲ+ /%CH_I#XyD2\I(FyDb`h 8NUHYxDa5H*FSI#XyD{[.F*$`  +bR)IIHgXxDso0EIdX'x/  Op-7O&F +F$&/O$D,&1I @F#yD Z֒r"ۑ őfHM%[C;(A-OKNTh~D<PFM48XF46,F(Fg \q1c<k-OPNTh~D\NM"FNIsYyDo+O`9F`EHObFI7XyDox!FObDDkh+fIF*FOcF`3I8HtXxD(F8FTh+ +J1HXxD(FO0C+H8FxDDh,E'%B7z  )|,4T XW,V<S|PFRXF40,4.<(F X c)z-OF\DO`pF|DpLO`rcXDyDSo!O`r4! `rb83CCC CBdO8~DDDnh.Ɂ0F(@Ѯh.8OHYxD" KzjXxzb87>h "0F0F ! (8` HIh$XyDoIcXx8`IHbXxD0FQF>h&JHXxDhq0+OHYxDxj@MHbYxD0FYFHh8h(I0FyD&bI0FyDxbOIYyD5IjcXxb3MHbYxDyI0FyD\Hh;h+зI0FyDQbI0FyDI bOIYyDNjY xbMHbYxDII0FyD,(GѮh.;9h)?xI0FyD#I0FyD# I0FyDxI0FyDO3;c!0F Fy8cyJIXyDh{H:k&X1x:cqOHYxD"I0FyD(<Ѯh.2;h+?)I0FyD&I0FyD&|I0FyD&yI0FyD@&\I~cxkbXx;RMrI`YyD0nxcr8oHT xDmI0FyD(0ѮhN8h(?hI0FyDzjBdI0FyD yjA{bI_I0FyDw~j&4O[IYyD21MXHbYxD~WI0FyDahƱ0F9h)?+zjB"H2FKI'XyDMHHbYxDXlFIT 0yD2F eo+ 52MxjbYx=IxbO8HFyDFH$6HT @xD Pi0Fc;;ڌ܌ڌ4O,O^pJFFWN Ɋ ͋ыыËP~pdK!JpF{D(FX"#h! "# I0F *FyD/$hBpj Z-OlFh!d0F"XL5'DDD~|DUv@FIF[HMI@FyDPbJI@FyDH#GI@FyD@#QCODIYyDD@JAHXxD4@FQF,(h@"76I9HdXxD YoP1N4HYxD@FYF(hX%#H%%O)HYxD 6 IbX%IyDBF o+#5 KXx?% ++FI%2F#yDuF8 H$XHxD 0F'܉҉މ͉Ήʼnj|K-OFJF#}I {DXyDh y!3hF ``"q "mhe(F.(ٌH)FxD! F)F" F9F"'t9F "s(FFH!F"(Fg !BF|H1FxD H3*F~vHxD9F" F`+iO !F0F"c`kIlHyDxD jHxD c0F!*2R-:S-;-'!;F!FOr0F <800i123 @F40"59Fj8(f!-JHxD "-IHxDHHxDHHxDH ' x CHD xDD #mB7 9F #B z M3 , E) ,+,*<( ' PF &XF9,9< el$HxD#HxDAF mR- HxD S-HxD9-aHxD [硙O0@B #}P BYWWp}W .3P *0Jٲ )zD٠a _+ؠWA˲+ؠ7ȲHXHxD _ F-OFShD[IHX xD Bo+DO`YF`OObIXyD0 o1!ObpH$I&FDxDyDHF(?Ѩh(6г.݊N"IX@yDfJX0xS4@.@{hqFPHxD > MHxD O0~XF (FGHxD*YF"Fd#  YF"F`F!#F>H8DlxD 8HxDXFzIJ?,@4HxD!F="FYFC#1 "FFYF@#F8D*HaFlxD l`#hi$HxD)F9!HxDlp(F/FHxDFHxD HxD PFt#!7 B9 ތ֌،nj**Ɍ͌}K{D`H@xD&`2-OOF F hD8h D'(F.OqOS:hF`H#FIX yD*h G F>h@7FD9i 3PFYh47hW< 7HFF!F"  !F"(hp=h0+  /Ѐ !F" pjJ)zDh  *WѮx.@/cH!FXph>x2Fd`l`(/YH!FXph>x&o2Fih`:xHh!F""`\`EJJIX0yD m/ ݺ FO P:L?IXpyD/5L;IXpyDjx UO !FX0x0h*4" ph x!FR"!Fhx"O !F `xh"   6aE3D J@zDho+ |`;1_:Aq^-AFLFF(|Do+ph)Fi(@F*F#9h H!X xh H2xD @F֠kFFF(o+ hhiF6(8F1hjF#-C#F F h0FY(F O0HFo(o+7V'!F(`I0FyDc!"I0FyDY(э""$ Q@F)h"F #g O #OV)h#FD8h@F@ ̉\-GF0OFF(FDo+O`h1F(Хh&I(FyD##I(FyD  I(FyD(# 0 Aʲ*ظhS HNIhYyD |(  ' pPF2F #on,-CF!NFF ~Do+2`h")F(!ѹѠh XIrXIhyD o'( h)F"\ @F9h#:-GFMN#FPhF~DXx DE(S( '' ' DIDHrXxD owzPFFX;LRFh'F F4(F8Y-CF FF D"8F)hFFXH;F*hXIyD HxxDZx 8F`h1F"m8 Ѡh1F"a )h8F#o+OK{D`H@xDFX6-OF &FF}{DXxDhHFyD+hxDuh-ւ(FyDF @ " FHh)ĂxD|08FIF(FyDrF(FyDjF(@; @ " F"h)|xDX(ŀpxD F@ "h-\)FxDBq(F!F~(!q<OSxDh8F@ #"Fich IFK9FxDP9FxD 8xDEO'OFd $ F~D )PD"7F :0"쀹ry * ѫ DbFTdD Dx +B EoHD TD,BEѡAEo/@yByyyxD wyxDChxD(F oHOqxD [o(F (HxDsၲ0i!( )HxD )F+((hVpi(! Fv uibu(! Fk#}iC##u(o ( IFx(tP`I(FyD&F @ "(Fh)]HxD(&8FIF*FqsFI(FyDF(@Հ F@ "h-#HhxD(h&HxD 1 0F0F8HhxD o+ (Э@F9hjF#ӌylaKTK{D`H@xD*P>-CF%H%OxD%N D $M D!hHF eDah@F `~Dh8F [}Dh0F V!i(F R HxD nHF Dn@F @!o8F HxD "xh ;HxD x)i 8HxD #xii 5HxD "xi 2HxD ! | x %-H1F=xD &xyh 'HxD xih $HxD #xh !HxD "xh HxD 'x)i HxD &xii HxD $xi HxD A ߺ.E\sʐ-A$F,M"FCM#F h }DF`AF#F 4F!F4,4Q/ 3+ O"IYyD0 'o+#H)X0F x@"F. JIX"yD o1F8FXh-AF F+L*H|DxD @&KVX"x $HxD xyh !HxD #xh HxD ! l  H)F7xD %xqh HxD "xyh HxD $xh HxD A )*7DE؏𵅰$'MF"FCM#F h}D4=xh#FF!F4t,0W/ 3+ N"IYyD So+IoX <LVfv" hFY-O"ILC-F h|DCH%X9h*x AH<&xDDDD H9hBhҴ _s" 8H1FxD 8(xa(OnBN!2HxD + FF/HxD #+xai ,HxD: t1FHF +x# @B!PF +x+On@N!XF *x!"L A !HxD +xa# @B!HxD +xai HxD 64@Fz boԌe-OF=LFYHh2xF!F"RF A@ =" x-AI{XCIyD0h p phL- 7L:I:YyD*F lo+TP7!F0h @*F 3x+ј =!F8h"F @  x/ј .!F(h":F @  x-ј 0h!F"*F @  >x.IXFJF #yD >hB T ]^@-OHFFK%DX h7F{RFSF IX`9h3x HxD F|HxD  FyHxD 2x9i vHxD 0xyi sHxD 5xi nHxD 4xi kHxD 3x9j hHxD 2xyj dHxD 0xj aHxD 5xj ^HxD w 6xyh YHxD lW5- l, SJSIX*FyD0 R!0"8F26X 0PF!FxF""  o+R-D(L0h(ph (И  !Fh"RF  !F""  #-  ј !F0h"F  :F0#XFo hB  =KYbr|Ƅ׆ՆK{D`H@xDT ?@P/@ REJ@-@0d0  B P90S$A$ RJ 00 00 00 00  R* J 0 R*  @DA  P R@/R/0 P/ R/P& R BJ.ȠȌ 0.ȠȌ 0.ȠȌ 0.ȠȌ 0 R*A  A@D -Q `ep B7Špƌ 07Špƌ 0 R*A  AA@D R@@-R$:0`0  BϰDD$$$$ΰ : !@ R: ! B!@ R--B* : ! B-  !- ΰ: !   /$%$%0 0@m`mmB0 00 B@ B@@@@AAAABBBc؃Bc@@@ R :@@@@AAAA  B  @@@@ΰ:@@@@/$%$%؀`@l\Ѥ B- V8R- M8 -R4:0!!$@ R :@0@ R@ Ͱ: 0Z0ΰ:Zϰ$%/l BD$$\:ΰ:  ϰD$$/ xpG1xxxkxKā_|xݱxxP;<, <@ԁ++;;KKı[[++r;;KKK$[[1'_|++ ++++Z Q+<, <@@+@L#@<, <@ <, <@#1_LN@_L @`1p11 +OBp1_LN@ _L @ #1@+p1@+1@+ ;OCp14RxQ+<, < x{LxxQ;@_l#@+p1@+;K1@+;K[1Q+<, < xlMx}Q;@?_l#?ӯQ+<, <o x|Q;@<, <w#@+p1@+Kp1Q+<, <IQ;@<, <S# xʱKx˱xܱQ+Q;@_n?3<, <7#p1+p1+;p1 xLxQ+Q;@?_l? <, < # xʱQ+Q;@<, <㮣<, <#p1+p1#@<, <@ <, <@꿑_LN@ _L @ :62._LN@ _L @ 0FFF_|+B + +Q;<, <,#@<, < ѣ<, <(_LB_L ѣ_LB_L ѣ,)FFrE )F@"FD0*AТ_|D!_C|ڡ ! @: ! ! B@:--B 2!  - ! - _B|!  ڡ  !ˑˀmEmgm }Q;@;@EEEEEEEEEE E g E g@@@: 2EEEEEEEE    EEEE_B|EEQK@K!ˑˀgE Ŀ뤿 lHxDZ8]@``p @RRχ\SSχ\z  ϰ *r4 S S r8 SS r< SS /]@``p  @RRχ\Q P RRχ\@@SSχ\7\ P0%TSχ W&$R,P\0",S P0%XSχ W&(RP\0"(SP0%\Sχ W&,R P\0"$S32/ 34/25/35/24/<`@НP o`12 Q/1++;;KKı[[++r;;KKK$[[1"_|++ ++Z++2 Q+<, <@+C#@<, < ѣ<, <#1_LN_L `1p11 +OBp1_LN _L #1@+p1@+1@+ ;OCp11KoQ+<, < xkLx|xQ;@_l#@+p1@+;p1@+;Kp1Q+<, < xDMxUQ;@_l#Q+<, <| xlQ;@<, <#@+p1@+Kp1Q+<, <XQ;@<, <_# x±KxñxԱQ+Q;@_n??<, <C#p1+p1+;p1 xLxQ+Q;@?_l?<, <# x±Q+Q;@<, <<, <#p1+p1FF_|+B + +P;<, <,#@<, < ѣ<, <(_LB_L ѣ_LB_L ѣ@sE*AТ_|D!_C|ڡ ! @: ! ! B@:--B 2!  - ! - _B|!  ڡ  !ˑˀmEmgm }Q;@;@EEEEEEEEEE E g E g@@@: 2EEEEEEEE    EEEE_B|EEQK@K!ˑˀgE Ŀ뤿 lHxD9/F#_|+z  +2+ Q;<, <@3#@<, <@<, <@꿡pG_LC@ _L @ pGpGpGpG_LC@ _L @ pGpGpGpGK{D[hGhp0pGs"hF I`x FF(``(Fp h@hKJpFL{DMhX|D}D`%a H`` I Faa!!baQ F i ` Fp@'ZjxJ')8FLKh|DX`T!`hjhT 0`h IyDKJ-iX`X `8hT @ `Y7/8@Ui|x -AN~Dh3F$Q_ 4oBXZИG5H1XAri h#p &DF2%x0= -S `Fp-OF0FFdкiкoSBSx кXкo &&&P,u-'9dBeE {;DFT* F)F2F;F8F F)F2F;F0EF Fм  0 XOaOA sDز EAFE0$ pO =E  `  `)K*Jp{DXhF #I"EFh+7()!Ob F0 F !n"(FZ!l"IyD )F Fn"UAYh* F O5(F6hB 6(%Fpg 0}𵕰FFBF2>OD8FF F@FOHDxD;h+h(FFO0"#1F" FCF9hhh < F)F@ks J HzDhxD,`HxD@"":"2"*"!K F!I,MF{D _X #A&D``)F`;h`$`$4i1F"(FH"Oa,``xD` F h` )FF I"F yDo F$d?hB ,M` -JvQ ]pGQ  FFJH!FxDupGF@0B2oc ]pG-C FFFFd!F(F A8H!`O0%F#8F1FJFCF jF F 98F𵉰FF$&-h!9FpF B HxDK{D\h$hGdh` K{Dh$hG$hHOBxD`@ ZK{Dh$ iG$hH@xDy 2F FF F౅`a` HxD H##`xDAha` ` M}D*h,`NH~DxDt`Q FO~" OQ``X``aXapG8FCi M}Di!O rv i`!iL`"iL-Y+hSa8] 0O3$FOQ4 F""#y0 OP!F ~c07 FAjFjhB= 0 JhIF JyDzD b F 0tssF HxD' K"b`{Dh `D`IHyDxD `@p?XhpG8F FF!F *h#h `ihehJ*b`CH#`D``ah)$h8O08ʚ;J #zDYh!pG(pF HxD JzDxsQh F1C3+a Q`p FpR F$F FFJ`O zDhhNi`B%pF4`4, %HxD2(F+pQ pG pG7F F+ F$p@$P$HxD F0z-CF) O O FFUh3FF 9FJF C h%`@B) &&F;#h2FF9F # B h%`@B#`FpGO3` pG` pG hOS#))9CCCC` pG-AF0h@GVq hOѷO^AvApBY)TOD(ѨEoѽ7CBEAT/OD+ѪBZ%h@@B T_OD+ѽBKE)х TOD*ѮE7eF1 F!*F#.-# F T/OD+ѲBFTDS+ѷB 1 F!*F%h[ %h-AF0h@HW3&B>hO(Av.@~/T?ODv.ѫB(&([GT/D)-9 F!&[TD6.GB'`%h0Fʾ$ 0#`O0O1" 𵅰FFF (FiFjF COR0#F hiF%# C `(F F0K{DhGиF FocF#ʹ ۾pF M}D(hF@! F(h!F0F!F" FpI#yDRh*3TLBF^M-AFFFsFh8FF@F*F J)F;FzDB("$,O0 4`n J KzDh{DB S 0h"0DpG pGFpGPpWFF5"h3FF9F C h%`@BKF-AFJ FO${DXD:hhh1DB`*FaFT%D (u[`$ FW-OF@VKDp{D F  F.!F0   FOŲ-2i0iq / F)FZF(1a(F3xB  F*F r((ڲh h/ F)FZFy(`h0h?F.Ѫ/ F)FZFd(`F( shph#4/O d!KY{Dhh/hHO!p=MxD}D !" (_ F  h+V3HxD @ xF&,O5JO4 F d(/(, Q&#*s !K{D`K{D`F"FAЁhJBhIBJBIyD h O5K!{DpJX(`%. F f&(FpPROPnvOCE,UylV KsF{Dx$p@ FHF(F²0F)F#FpF!h FJFhA@pGhA@"S# A ` pG FE A j FEA e))YEAEAEA@ SO#`O0"FFO0e-AF FU0K,uUK%C*"`O0' CFN~D3x"F9F F " 0(h( F!1p0 E0O2 *xЈBv7@Ѐ*FO  @ @  E aDF 5F#X=PO aDdDD']U7BDDЄ*F  sD\)FdF p3ҕ F&F+FW;Fo}C)D,D VB<1D&D @ @<h#FT3 + rr`pG8f@Tj %kb88FVpTj8HIxDyDbk%c8SvX-O<WFjCXHXIxDyDFbTyPDDHFOQjFH #O3`x#)QF (&YFp(F F(p )F2F(! )F2F(F(bh0F1Fm"O "O (F, #U)i BjiB'&`g`aha+aB +0F; +I``yD !0\t'D8$4``x* * * ЦBIF<0`6 (p0(FvXvYXX FhF+&h)#% "`i`(F5hױ#h B%`D!`U !hE h#`-OMEF5 |DX0h6Q"F` +++@pepeY8D I[s#` Ev.@sY  BF c h G(] FDBV))#hFM0(HRD` ` #P$F0`tzD+`yDa D XG .@BҸ#h 2F o h G(iND B0FFFF>FB+((Nѻ@|aE7@J :FKFe +HF G(%_DB@ h`7XFA)YDHF!`QF  hEIF hR`PD `j )2ѻ/@J :FKF HF[(ڀ_DB@oHFQF G hB̀/ɀIF #hD '`4EЫ*- FFXF% SF x л;л@6 YF % [F: [F:F 4 h(. E@ &&hR`qB#h8;`[ QFF D(% SF #E+:F( QhF2R bEpF(1)#*?? 8PFAQD!`#h #  B `  SE9F`JF F'h,OD'` >Fv>FOp#  `;`h!b ._)\ VFO OE U F7ph lIE. *>EF# 2Bۋ X  C B(";F07E' ; X^?N|A301Uh!F hB. @#hD`&`h!F "$`%` FD7hB \'h8FA)D'` VFX VFH M O 0,Fs-AFhh+ +F&&O0 qF(@O2`1DF F `)O1"3F9Fc F Q(F:F3F FF F C(F_h((    p  -O$O# h'F%FSFkF(F,\ў",BIF@F h0R(IF (ь@F= Pp  ?:F R8- eD(F FhF  (W1  (#08F4 h4 DzApB (F$ t`O6$t`/q)F'F(FU `+*8x0C{ (`;1F#4A{jiD$F(@% `$<` (F$K%J$ F I{DX"3h7Fb,!"!F !n"0FIl" @yD 1F(Fn"Ah((F  I(FyD ;hB !G Dl,l-GF!hF"#F '(F@! "hF w(O0F*F#F u (qWF!"@F z!PF#F BW  0F!"#F (GR 0F!"#F ( 8(F!#F B0J[D!;a0F"#F (  ya0F!"#F ( (F!#F BI[DO@F-GFHFFFxD (IyD\F(@HFQFHF8F и  O2a'``  V.!pa(F!((F=(F0 +C)F F{/7<.+9\@F  )FRF(Vx)F@F@B Uu`pg`a @RF]'`0 (./PF30(F:!F:B8F$(8JF{/ .(3^@F )FRF(&`8Frx)F@B@F WSu`pg`ap`(FS:/./&*ODmbO2D`(F%I F$Ju$K yDzD{DY(0I`,FKPF{DhGFK{D+FI FyD0( !F70 F( F?F& F0Fjj<=<hhУhhsF Fh #(F !"FF F0F #(F!"FF F(Fp-CF#JFF"KFzDX0hF09F(F.#F0IHFyDhGI:F FCFyD( !F0 F` FF F@F3hB O FnB ֢hHIxDyDƺ p U05FVj#bPk  Fp@ ,H-IpxDyD +K{DhF UjVjjB>jb)!HxDb(1 DA gF < U `bHxDbb!B\0J!FzDh ( F K!{Dh p Fpp~ppgHgHxDn0 P007F(#x.+##p0-FC FOAx.!.+/.)# A.*2)٣0 ) )٣0 )-+_+FF pG pG;+!]) pG pG7 #Od$ K{DS, L!|D F "K{D FJesF 0Pl N 0Pdd-OlMFIF JPDzDPX+@hd$+bO` F(H!FxDU& FϨ'OhIyDHF :F^h+hIF FyD/(`@!F  h   \IF FyDl ù1x 2FJzD FSISF F yDQ )@𨀶)(@𣀶 4 F$}I4ByD7yIyD(@`4xxJ" *L&BnJ!FzDF ( kHxD2F!F#DB  aF F 0 0S_H!FxD! F / !F(F.  ABTHxD!F0 F&QIyD)#B  F  CGH!FxD! F  (F. !F YBovDo"XHF1FFj(h*(F ?Ϯh@F F(h&IF FyD{ !F(F !F7dD hB (F lMO dT;hB A lM f>dQd"dccc*dcccuchc6cbFH"xDȽ9-OFFF"FF(D heIF(FyDo# HnF H Fƞ*F HJ0@ D dF  Ԉ[ 0 S(FI ZFyD(Fd! ; )F d@񳀒H)FxD#FF H)FxD FF ~H)FxD"FF tH)FxD!FF jH)FxDj#FF{ `H)FxDT FFe VH)FxD>"FFO LH)FxD(!Fή; CH)FxDda+AF =IFSF(FDyDAF FKFYF(FAF F YF(FAF FYF (Fd10o )Fw!F8F"#8F!F" #8F!F"@#8F!F"# ѹ ,  )F:b*b.b baaakaCaa```-OFx F lL|D*kI FyD_yxy: BayZzXxxAG,zA e I E{A({O J{GJbBNJE.EMM@DJI8qDDS" N#Oz~<"/BOW OE wU2<%'d%`F0FZFTFFD1F#IyD (F!HxD I F yD$, BF 8F 0F (F Fig_zDDD^F#FE   .)3"x**;(D .(3FC F Biilqc LAaah|Dh"Ch!Kh{D F F^#HO!xD$(F1F"r(ѽ(F(h(<(F!2peF( O31 %F&O7!B Cq65F h!#`-AF FF#F1AE+a+"*qG FP˰BG3 FP+BG+р41KJ-O Fh]F{DXh eJ '%`````>DQ!Or0F`h#'O1%OTX'aOZp5c dqhqqqq 9FOZr 4QIyD:pqIJpyDh1F F"%FohWdo x!@F h@F.!Ob F((FYOr(Fd'Lcd.)7T NE/ "2`hkHDkNxD]~D.!?0F W0FaHxDH`HxDnFxh# #aF` EhBphaTH9FTJxDzDH;FHHDDDx)xF3 ( ((FIF"ah(hԿ`Hh@-h?HxD-(FQF"Ch(ʿ!``a`@4HahxD(FYF ", (̿#`hȿ`@)HhxD^'I(F"yDh #H9F#JxDzDLhA`HxDI(F "yD0I(F "yDhC3 'Ycdccgcjc(FO? )FbF:p@#  =,I(F"yDZF.3(I5(FyD>(F?#)FJpFX0D(I(F "yD:I 5"(FyD2hBC I(F"yD'h!C`+F ? (ѧ ]3X?b0bWWa8a8aapa!`pGpG-OFlKF4MkJFFjN{DXTX~D h,'xoph IFRF[FOl F!JFSF ChKJ\AF2FcF F f hEHxDD&,\BF F+F1F$h7K1A C1*2HxD0HxD&a`=x2*5hbF@.voHxD- -mz! v!rQ`l!`O0@F,D*hBB 4M @/ `q`>`U`$`-OF8KFF7J FMh<{DXhF  0JzD*F8t!FKF-HxD* Fo#1`O03$ .* !F8FBF@C E:Ӹxx()є x(+ 1࢈RB+  5@A8F2FKFQFW(D E0FF^FFHF#FQ(O0 t&hB M% -O}UF5F 2`}DX ( h'%Dhd1LLjXxDTAF FCF2hh7hԿ''#'![F' h2h ( F 'iW h%2h `5a.>оB6 O JO#iE1ڹ9!HFgC9F2F(۹0+IF8FK   & F`aa'FO~O:"iBsDࡹI 67!h0OZ#i^ꨀ" ~ڡFFF'B!#Z{" $ 7   *ꩀ"j xFD 0ڡO"n! Dh8hdh+@؀  *@a.0( ( O O K@"Io FX#`(h]/&IhhyD Z9 #iBJhBބ   801 / /  # K!B{Dq)?b*' h '[FRFaG(Q DGm?{# ! jxBF@C (.^JCFXzT" hh>6 ;+ +  & ! r(5!1! x#$ zQF`( F1#PF9F( !$"KFd(!B(! F8""Io Fz|X#`(th]/ !IhhyDIhhhyDfQ"!s$"( MIhhhyDQ$ nWU`U5TRRR,F 9'(  hyDh"ch̑)ȿ#iOHFȿ !HF O BbsHF9F s(O3'& pF"QFF" ` PFJh h$JHF*HF! 7C hyD;F! FA!1F ` Q@F1F">)F xF ` PF+ "&B\O DafhPhhyD.AF2(@1D 0(XF'FB@݂hPFjXTMO 02 *@R[F2*@ǂЛ7N  |12*@pEyhd1OF DO KhhhyDG_i"!s$"`( FN1( @hhyD1FJF( hhyD3F2hIjXxDT9FBF#HF@EIhhyDj `h.ȿ i&ȿPF)!0F"Arh3h0F; KHI{DxDyD HFJ"*( h@ NHYxDT1lSIhhyDL z#"F&`YFHF'"6I hyDF .hնJIX2FyDT0& FZ#8pEЦHhd!& H+XT ]hP FQFHhdd U 0T A0) SՐՐOHYxDT IF' FYFKFB2Fa FFi&78FZF[DOOxNN NMMK?@ h F FU o"|n"`w` h xO0GhBoR/F("1D $Qhhh,IyD FBh(* F7#f5!IhhhyDaF(OrOs(1 2JXTF!' FYFEBF?0#t }KK-OFF*?+=,;%T50 5&FFF < E)3h GF9h:FqF# 7#(Whh8FF PFJFGahrhB@F  6  -GF3KFB}2JAF {DX:F3hFOsM(D8FOqt FE<(F9FBF(i(5!z)az*) bz+9F(  J8FOqizD$(Fؔ@E 9F%' U %Dhp  `B( B} <=-OMF@4FJHDK{DXhTF(߀ ((O@ـOؑOD   Bʀ +:D(6"iIyDhIyDXF `XFgDBBO [F[_J  OqXFzDXFOq DEYFD$l** * &ih `K`OD )zyhRhA+i?hi D)kz()/Z.Z D O OY (3ЅaF*FOs8O @(FOq]`FY L4hh(FBB?x8F)F2F Y ((FaF:F3FFaF:F3FHO O FFXFt3hB M F[I}I.<-AF%A - --  F AϾ).Ŀ!pJ+Fm+Fm"    $)AbOO2bbKibpGK {DS2 Ph,pGX-AF FFFF. F)F(0DУB!ybyB$D>BZ%`O0-AGFB6xAxA$,B.؆x#x@( 4B$l3+L!ѨF&F0 F9F2F(@D6.ѼBZ%F`O7 nbbbO0)-AF FFFCjBQ{j/E B$mjB F)F;jB j*FahX(\jbDb@G3Fj(Mjah aEbA_x\G"$jbxxG"$jb5T TT3ghB"ӓYyyO BB`@G"$jbyN, jahb $BZ$`O0tj2Dbj_b GE Fi pFFF#x㱞 F1F( `B8p\*axF)4"x*.*F`p-OF FD SFh~ : h9F&h3x@*h*/@'7p&hpp ?9x).)zx7\3.) +hB." '2T h p`F`^D`!hD!`+h*`$h%%p '`O0FhF FFB% `O09Fh*F h(D `1h J2`'h8p-OFhFFhF(H!xD(;ۼB,Ҕ #DB%!FD|DD O*FPFIxH8F!2F+F(9FXF!2F+F( FH!2F+FxD( #`0`O0/`wCQCSCC-CF/hKB H!"F+FxDm( O08pDHF!"F+FZ(/`O06 BB-O.]F /W .U .P80  /S]F /R .^ h .\h 2h<{D^Y<h7hD /R `YF( !xD /U"F (;'MXFIFnFF /^!"F xD(}''| !xD /\XF9F"F (  Й9.) Й0C *  .( /W(F "#F!) .\ /R 4h *h ن /^V   h`DF `F@FXd";(F!{D /\(F  "Ff( /P!  :F#F`D(򘆸iظ-ظ ظԀЀظŀ ظ  𺀸ظ~ ظcӾڂɾ ظ𺾸y𰾸-.ظ% ظ!ظÆ𚾸#3$2𐾸)ظ&'I+|3ظ2𔁸/𤅸0𯄸1ejظ7𧅸c W݇HELЉDx .X<:h*9{D> /^  QF26 /[V "F x(V /S"F 3Dx F!xDF(򉅸@V B@ /[  BFKFQF(l, /^!"F xD(^ /\QF BFKF (O /Y!"F xD(AV /V,F /[ "FxDF!(%8(F!d"{DXF(F /UIF"F ( /^! "#FHF>(d /\ !"F xD(V /[jV<F!8 DF,PF"F(ل /Y!h8F *ḧ́ /^'h +hDZ!'`#F*`"( /\ !"F xDi(V &FV "FPF /ZF !S( /YXF!h :h /^%h  hD"%`#F`!(w\"F /T! xD&(iV FV /\0 !"FDFV2"!F< 48F{D /\F"F8F f( /^V "F x(`V, /[! DF,N"F~D0FE( /S"F 3X(|@ /W"F D0F!'(j /\"F :(^"P /^!"F DHPxD(K /TQF BFKF (:K{D .X<h+?V  VFF FV 0F V,!2"F  QF2FKF<(ہH!"F;FxD(сG QF2FX .\ <;h+ /YV, ;h /[V /ZBV@F hV|F}K9`:y(FF!{Dd"F"F(F J(VKF! x{D(FOF"F(F (V B#BF1/\,H /^!"F xD(DN * B2A ALd>cc.>>==j==<R<<;;2_T9]h]78\7t\-7mF7y06:' 5ܕDO E"!HFM /SF"FHF 3B( /\0)0! "F 1(t 0 /5!d"(F{D"F /TF (F(߀X` /[!"F xD(ID5{D͸ .R<h(@V 7V<FF,x F VF F,0F! d"4(F{DJ /\F (F"F3F(XFFE8hu9h D:`V!d"[F(F%F"F(F3F(߇8hZ;h9`>!d"[F(F F"F(F3F(LJ8h=:h!d";`<4(F{DF"F(F3Fl(F QF:FKF(8h B#RF a(F H!"F3FxDJ(D(0ؓD%B!HF:F"FHF3F1(ty 0)0!"F3F$(g05/@H!"F3FxD(݇VK{Dۿ /^  QFBFKF(AV O &O HDB0JX\+Ya LB0F!d"KF(FO /\F (F"F(6V /ZuVK!{Dp(Fi- /U7 QF:FKF @(߅0H /\!"F xD(҅;h8`E>h XD8`>:h%h8`8!IF(FyD9h8`'h8F8D `3Y4v44>4PR0~$d2W2*2H 21"0V0f0vUN/vTh .[ <9h)|V !<x(F{Dd" /SF"F(F 3(YV|>x.^ BU8 BN5!8F"YF /[ bF "h9Fh 'h8Fv /QD h'`p`gDp.T /U! "F[FxD(K QFBFKFX(| ;{Dy (F!;d"{D#F(F+H EA .Y <h(~V /ZFV|!d"F<:(F{DF"F(F r(V,(F /X 7xd"D[F!F"F(FSFW( .^<h*־V !d"CF QF2FKF (3%zD 3hB_F7`+'0` OE3h6] O  /ZO rOO 3hK]B !d" (F0F"F(FSF(7KD3`V " _(!xD /U"F (M BFE/ /\!"F xDm(DDO E"!XF^ /YF"FXF R( /S0)0! "F 3B( 0 /@!xD4{D .X<h(@=V<  .X<h)* .[ <8h( .\ <h)@(4{D$!d"x(FD[Fx /\F"F(F (/V|![FxF zx(Fd"] /SF"F(F 3(V[Fd" /[OF|Hx!(FCF"F(F ( Q\ +LH /^!"F xDJ /[V, hhVPF% /\V<  9hF,8` /ZV, ;h /XHVHF h V|F`F /\ QFBFKF(V B1"O _٪H!xDC ZFBG/ݤH /U!"F xD'(j|DxD&B!PF /\F"FPF (Q۹ /S0)0! "F 3(C06/@ĀH!xD"F /T (0K{DVB HF F;F  V,! F|  [EtH"F /T! xD(O0mK!d"(F /X{D/F"F(F ( /^O D EV<!(Fx[Fd"F"F(F;F(VHF RH!"F;FxDu( V ZF u-XF"F;Fa(`F .D`AN~DB0F!"F[FK(K QFBFKF(ڃ5H!"F;FxDx3K{D1K{D .^ HX<hA/X+JzDW7>Rf-!.> \( 8P<<<<t<Q?>'&L&p&%:i:%8 $IP$#B$B$w##"z"`"*SJzD(FRK!d" /Y {D?F"F(F;F(IK({DD Xl Bn(F  -#.&B PFYF\DC (FQF"F;F(Ǯ. 1I(FO yD -H!"F;FxDn( 0!"#F(ڥ 0.#   pE F(&|(F "F;F@( D`X\( .^.h9hB) .])0o"y1y!c FFhAhF#xI "F JzD4 D(F ;-AFKFJ {DX2";h!@FK{DZ!hF0B (hAF[*h 2D*`%h#`O0?hB <#-G'F !f'e(FW!kF($O0J,F@FD!kF(4G8FH!kF(4F0FM!kF(4m OFPFS!kFr(4,NFK,# F( F x@x@ pGCxxAlxxLC pG Hp ppG p p JpppGFF FFB-Z"`O01F(F(!,.*, l\.,|\/<.# +U,D`pKJ F{D!FX@B+h 8(O0 f8F1F@B( F1F8 /hB   x*@* A+ @x(OpO pGFpGO0pG-OFF FDD 𾀼BдB.!4(F( fE@򪀻@ rJ5Od + !\ zDAw$O{c Oܻ Կ"" " D"DB| FAF  [F+eF  *xPFIFF(aۂD+!0JI PFyD DI#PFyD(9ۂD>IPFZFyD(0ۂD ,\D`;)+(+  VE ٢F  cpTFBM"+$+;+.+@+\+B#FѴB."4pBZ$`O0/  *!]  VEٳ p4 :_ 3_ 0D0F0 B"6DFE A*A 1* 0B *1x! ,Z# D##`+oB%%`> kpa?(p;E CsE :!P  ./HFFBIF(FBFD5FQ0Z#`O0 FLŰ&K|DX%hC+FCFO0(F9FJ00FC!hBE` -CFLFŰKF"0|DX!hC)FQB(F9F2FKFC'hBmE pFhFBxD@**b( D0 FB[Z!`O0p(` psFFFhF!"8 FppG LD DBDL3 XR`B`@pGɚ;BRL; bD`B`@pGʚ;#F( O0  +Կ   0F)F  hF!(%%`e`Ozr!``` F00 o@B `D%hF0 h+B FH(F F0 JOzphFA=!~]@B8F 03 $|`O08 FF!j1iG5 (O5 i#kh@@B k"``l#cd Oq``` Fj(F8FMFF}D 3F(8FOr'O"$` H Ja N)X HabXbYb-XK F%b!"s F@K{DhpHKxDh h @P9"@`pGIJyDzD hhhR DIC @yD hBK{DhB JzDh IyD ` K{D`pGmNAnMMMHMMMMMMDKMt{Dh FB HxDh BR<03 c+ܿC3B;JKOzDh{DD` !$>`B}4VMZMMLMF HxDU K{Dh IyD h` FH@xD.:LL 8L|D F5DF F(F8FFFF Hg! J KxDzD{D +F0"x ,FO.'$+hptE!O *̿7 0 DF 1] (̿O7 O0 `DXptEpF!(Fp3u#sKA{DJXhQBxpG pGKA{D JXhQBxزpG pGhKB{DJXhQBxpG pG@KB{D JXhQBxزpG pGKA{DJXhQBxpG pGKB{DJXhQBxDpG pGF!hF8( `O0K({DJ0Xh1pGK({DJ0Xh1pG`-OxFF 0 +0, DxX)0O xO 0O F%4#Ѥ0 * A0 F  F-0( OA Oa C|x7.,VEFF[x|x4(> F<(<c+,2+ +*(Ee?").OlLF-/(, ;CAA&5C-P  bO0]" LF@J۲|D! FzDM FMoK-AFJ FAx {DX3h xx!JxzD@F,(ݸB%Y` (FAF:F(F 6hB6  o-OF{K({J{DXh (@؀  !XF "#RF^O 3WT + LGT,O8!F[!p' 5 ХBF%,FFO>1)GF𖀥BF,GFO7IN%F. ~Dz нB :BڽB;FNEQ:"p0F4FNEI:#-pϹ,.1F 0.(T0F%0D#, O|aEF [%00FqFY(`E0D5-{ HE m-Ot&F Fm5FFO D{HF9FBh"x/6.'p%./e. `pF4.`  8F!-OiKF(hJ{DXh  (г0F!8F"0x:(ux:- 6ZJ%YKFFFFh7W\%>h7W\o4*FObj1FiG(@D-(_s)ՂF NO'Р hCЪE(F1FRF"h#hSDF`#`VD *->h7W\hB i"h  OI E1x(ci aPDh ` bD`!iBUE 1FRF!h FQD!`m(xbiBj1FiG m*F1FhF hZ(D` `1 hE4SF+F!ibiB5ّDKE2JF1F"h FJD"`8(DѺ ;ND)?->h7W\O 0F !*FKC  O Bj1FiG F1Fhh!hFD`!` FF祉E@O0 KJ-AF&{DXhgh?Ե 0+(FGCT5$h,0F-AFOsB FFؚBفO1B K$j`G@ $7FgC#(Fe)k!iO0a(FF(Fn0FKJ˰{DX hFI`xV ```H"`xD`%F "h1F5El!0F I#E k`yD)`(!F DJI?hBK:  KRH{DXTv]pG8F FiP F0 %`O08!k!iO3ahA)`ڢiB + hA!`p8(F!F8@L8 FFF!F(FF F(F8KJ{DXT10FL K!MD"|D{DdYT0#iO0aT4 FF F- O0 0  )߼ pG?K@JF{DXh !a`_ai_Lr_`3 #` Y_ q Fp(Tѡ`a!@ "khp@BB!k `kb`k#`#i FooABoR@HxDW   * F2!ibicji!`G(``!R L  ``L@O0 `E! FF F#`F("mD"e#QpFFFհ!"(蠉*F Q1Fp@ FB#RCQ e 𢺊h F J`F#`c`FP5-OFL%l]F{D kX hd5 iO5a 9iY ,8E "`O0 B  +DѰ_ C?O AF"40OGȀ*̀ YpOg#`i#aj`gaa Fb2F  FI@EO;f E@XF[''!#%/ {&%<``{`!    $F!F(F! +hTD%+< B$д oA Eyh xh HZD(;`x` 9F/ x]D xAӁ#O2eF{0}0 iO  Z,jp`d4bbbbbbbbb"`"cnq {!~%..F % O O { * "MJ HEX N/EOD x F10 *$+%;2%&%'6%R;@   5 % P6` ^F@^F  +ڳOYB J +"{ k* $SF$ !]F  *x0 ( sMBLCL /tED$*%;2&'%%%P4  k %T6vFvF  Au RXJBL /B D  0 )ٻ$%;2'%&%&F+J ( 0 ]D0 ( =LBL /B$? 2&'%%kJ "xh*4JjJ@ JZ +xl+i J J JzJjHF {%#t*Q6&Fh&F  XF*E F@T'F% 6fFfF  $%{PG  J _LF % *EfF> fF% E4% o% @ 06@^F  @o 6@^F  @ P6@^F$h^F  ,uX-!dBeE{Pa*x!p }zDZX$P }@}D\ 3 F %#"-vF vF% "$,i  '`[-vF vF  "$,r5$ $hoBB|O }w_`Ra-K ?! F#&%(#vF vF! #,#"$#F) !! (.т%-vF vF! "$- "", (?]#hB|cEoC#`"-%{P#oDB! xN( ѻ`DD${@ `DD*$8e$Jr b+ G,  B$qN*F,E;WpF[B-!+! +Qp O F 0sF +0I0 eE03E- 0%ppF-,D[,4%a+F$O, %TDIJ QMF %SvFE#  vF  E~% `% @36@ fF  ,` #6@%fFfF  ,xS6@,hfF  %c%IF$T6@%vF hvF  %x"} xDKLFk(F%R6PvF%hvF  -kY (*`F `FB&) F" *F)( FhbFC DBF0`BF*( `%"F`uCXF1T'` PD @& 5% P6fFfF  DDXF\!FI@K(%F{PBJ _HF %s)EF8 F$ E.% o@56@^F  o6@^F  x %U6@%^Fh^F  %#_THF}DTHF}D_ %)EvF< vF$ E2% o% @36@fF  o6@fF  x #S6@%fFhfF  %T}#O {#HT* )b++ ~Hc  |E0KF0 < UKT\FB0*@0%F\;- , F)F "#*0 F)F " =#F F0 ; ,cEKF UKT { | d,(̃%Yd8$F{P ,,8{B!F)FJ}0I  BݳK" |{D"ݸh0 xh`A)y` 9F(@}F yhhJHSD(zDx``* 9F(@c x{ ұ {h!0{hBY`)y` 9F(@E x}h!0"0{h| Y`)y` 9Fj(@% x(I  BpK" |{D"ݸh0 xh`A)y` 9F;(@F {hhZIZPD*yDz`` 9F(@؂ x--:OJ# zzD-ݸh#xh`A)y` 9F(@F=>IhyDD`}hk+{` 9F(@ x/IyD(@#+h+*I"|hh yDaC)`y` 9F(@k x@$xhh@0CJ+{``)/Z1 A7K Q ,,+p+>+** 9Fj(@% x,hdB,<$# zzD,ݸh#xh`A)y` 9FE(@FD5FET)0  O iDQ`h+oL BԿ""BB"" D`FpG pG)hCBoC[BԿ##D`FpG pGHxDhHxDh( ocOr `DCC-O-FFF hF5P8^@/FUIE3FE1f,u!O ) BqRlFREJ}#BsQ 6$E}O  D d"2zOW.D.PFO1( O| 3+ЖFFiO  hHDxDOd 0O O~0(O W, BۉOd 0! Or3+!P!PFv!v(Я@FDI@?m(`xz#or)F`DOabD F+30#)F FOab#FFFF<"#)F F<"#JD d!p Oz w/ L0#%P|DGW BCv06"$@F ` QQQRlF-OF FZ#@ B8F x<+ F1FF+*N>*хF^x/B F(;H!F"xDF!!`p/* FHF.xG,/;/ M  ab x!HxDx,+;+@ 09FuF( x0,+@Fg(߀@ـ ^ ,`OFD" @BH BRKByB@w0xDS( 8FFj F8FFbFOdq ! Opp(!JEO O P!HACFFZF@@E4 D!0IF( P D!0FD R  7_EF@ ` Y  g``DBP YB  ppbk`h{O0+O CEP~ I Rh9hyB "F#O#3! [ I P i i XDa J PhAB32CEX FD zB W " KB0#:`y`BW`b)D~.T1F &*FPFOsO  `]  XF `0F E*  DE!Q8b:al`-O7 F8bzaDXP(hxdJ(PF`(:j!aa!atg~D>bpDXFnFhd'dX0`'yD[FzD`y`F (s2` , ;h?r*?㮳o?߮2(?ܮyjB)֮EйЮ", "yjDDHDEO !FE &y`;`5yhRv;h лѰOuO OBa   D"! FBvE \ 1 \2\FFa` O hE0FH 3y+H 8FM!F"}D(F0(F!F"8@8FLFF|D#hkCJ##`zD` H1F+FxDh8h"F.<.\ ODODb>WjWZWP8 FF!"F F(FF(F8IyDV( HxDo HxD!* C Q#!HxD(HxDo HxD!* C "Q#@ A# HxD!1/BHxD*HxD!@a0OɲDBF ;B+F FH!xD) FBH!xD7-AFFFFFa5"0[B;HIxDl2B$,p0F8'BHIxDX@8+B8HIxDʱ FF[[5D3B\:aB8H!xD.88 FFF?BH!xDT;@pGS^]pGKJ-AF{D0FXF+hcjCFA6A!0FK@EFX!O4`8F1F c F*hB2d KJ𵋰F{DFX! " F+h  "FlH"F#(8F!F"Fh')!`0F' 8F-hB @ S]pG-CFKJ{DXhhF8(=FU K|Uo!HHFD2FAF8 < @FKJ{DXT-G-L.N|D F~D,KXhF FH)JF)IXyDOFDD F!" 4+DT5c~-D lp%@Y/FD dD D|D|!"cT5 F`OAME a HxD| H" xDG88[RUG,-ODLEK|DXh BHxD7AJXh}h=Զ @,JT6?h/;HxD@@XF(`ؠ $&OH`D`gyRt`DT6FNE QFT"TF$"D |V$ G`V$!V$,HOxDD;h=``hHO O{ xD~3k!"1``q`1aqaaqdd`5ki`7k0kOAa0F8F\Y&L-GFOsFB FFؚBّO0IE K"` L@ JFjCF F'k'iO0aah)!a`Fgj1FJFiG(ݹ D FGF0F!hWERFVD hPD ` F( Fo:Feh F#hDf`'`_HF p F% oE$!F"= OrOq OC 8 %:$  4p p@pG"𵞰#FU{$!FOqOr OC oF2 9F0 *F n ,p@pGi9-AFP;FYF0h,  O@F@F F @DE!hBѢhci"lD,~.a!" 4/hW? GlhT/ GhHxDGRtdM @- -p x p/`>p% FH! F6!F" g OS>1F2F !F*F S  8FH FF)F"FxD7sFH FF1F*F#FxD8 hJ`IhBOzsYCA` pG pG?B h`JhOzqC`pG K JF{DXh,4!k@پ K JF{DXh4!k@gxK{Dh h*BHhpG1FpGU K{Dh AHxDx*   hU-CFhF<%h9ET/OD/ѪB{F !F"+F03hG[!!`d#hF!F "oC0+h/`[ F!FF(C`O0F:`O00L|D hhMhhY Ce[T @iF 069)#`O0h#! ` 0#`O0!" OPpGIK-OFHJMFF{DX#h 4AHxDhAi>JzDhF-- - OOOO3I0FyD (5O`OeF3FFx8%(Zxm*XFF*F F<B((FD-3%* - !F=3+bp F p=43- pF OaXFJFSF EHFJ@F9F[FzD d:hBA M SRX]pGHxD-RHxDͽR(h8 pG pG K{DR JzDR-OF F:OD8F 9FT f$  F1F  EW)hQ+))P PF:FAI  DB*hR ) :FBF  4DO E)h +` F!ٹ)`XF:FCF(h 0F,` `EYF2FJ&@FlRFO2#FxDpBLFB EFxB E ҄xB ГBx3B0 p`Fp(FphBhDB``pGhAhB؂`xL pGO0pGK{DhhBFpGP@hpȱl8"h hB &0Fh`0F: Fp@N%Fhp!hF]@KAJ-OM{DX*F;h|4x(c۵G 8FLFͪMFUEK@F!*F3FP$*& 4XFDIFBЃDIFXFCXD ) 0mB(FB(FF5$ h&F(F!2FCFp8B(FF6NE$| F?hB~ M HxD!hH!OrxDhH!@xDR\bOP-OFh(% h   @k$?h/o:h0Bgyi@Bb8i`E1Dx _qOHF!!PFHFFPFB>.7 8FhchB">` 8 8-G FFF\N("!l}a(  E ҎD? EtB kF@ 9 >`BE]ءxYx/Zѧy#yfy!z yT H\'IY )BV&?D  DB2Zx[(FQFdH(FAF_#?+!D(FIFU((F N((F G((F @(>  aFr] Fhhh`hh`Bh `.`hAa`0FhF"pHxD(FiFHxD 0M~M-CF8FF(}@H@IxDyD3?HxD@FFOT9FPhF<85h,O hB%Fh!/I jF C0myD@F_F(A9F)hF,:v"jB(F1F~0i`iBHFi,kiB Цhh`hh`ii``la`OHxD@F !F80F!F@;e`O NMHMLL-OFhFFm(CHxD1 FF(viFhF+krh0hB/ uiFB )jE)F0FhF#rh0hB0Fhh1i0FhF0FiF0FhF)7HF9FF(0! (8DF0ZF@(;(ajiaIF(iD:FaPD(bP7kx0chbti``ua`uhks`0FiFHxDV &L$K-AF(Q*H*IxDyD )HxD hTF(%HAxD5%Fiɱ i*8i2*0Fi(056-,%adOrwH` cEW/P"DdCJ5JJ-OFhFdKF F"${DaHXHFS!7F \HQFZFCFxD7,% )@! " F@ xOx- e²opDhp lpP--y *uXF:3F9F(jD 9FO{HF-S!-P  *O!AF :3F(EۀD AF~HFy x o  )  qE&  \V@FUJ.@F!2FD8OvO0P{-AFhFFFHxD (0') aUgqq 0ЙHxDO@1F  iI R jO0U)FF=F."!` S"Zc(FF(ЀhBh1F:( F-GF5N$~D)2ِ49B|O  O  O? O0  %FIx) Fx&BO OH) =!xD p& WUW5 =!QUB# FUFHxDpGF8xr+ w+a+Ob !` 8"%FOr$%Cxb+Cx+(3$%xb(3xx(,3Bxe((FB"C `8#$B4[ F@K8FF FHF+F+*)`8P<"8C``-OF iiB~<V$pU$0 z/87+FF`S0+\##C3+0 cC+0xEz(XpEsF@h*<@Fs(+ۀ@+7(FVhZcC+7xNE0zAU$p EIF@ h +<8F -O-N~D(! E`"`K$GOYO ZEBu`>'H"xDH"xDѼ@"H"`xDQ qF S [Q 3"ATD@" ok;D[E   N  A H;"g Q0 qA +|+} };0b:K!+++Jո[E+4,uH{2Xkk<   JOO ,ۢD "#bB  )()ſ9'' & !#!(#F%##D HF O0'!F O1 F !#FF$(?+7/4,[05H #7X+V {O O "!+[1+?gB/:I OsX9OY;ekQKfkI3k`(?aCoc?yPD?u~}O ӱչ(@ak!FOF {{Ps:qǻفGˁyX>V kk{[;3{;K0 q NjvǛ BBh''{ +X( kF0 0q <@ wFEѶ+0; f2@K  ^FF>L0,Р`[ /f,dT%X/[ڹ@9+ OFNF%-2%K 0  @` JE$8  ܴe @N_sI F^FF>9)B0 48p3p5(- 3N 6  D0FpF к EFF  0FFF(?T)FF(?M(F=FJ(FFsF(?@ F(?9 2FcF(?0)"NO^\OLPP      C9ii "   *ДF DDD(FYFF(?謺8FQF|F(?ݬ (F9F((F !"<#F(?ˬ@0F !"F(?)**$8F!"F(?(F9F( '>FC F>F1"4 pO,+݀0FAF!F(? I0FFFQph*F(?o0i  O`XF!(\h)IF(FAFFP)=*UN)  tF  JE(F !"F(?2E@FO Oj}F(?%F9F(FCAF0 (F1F8FF(#(+Ѻ9YF8  *Ŀ1 (+jiF(i()(F!F(?9F(к9 1  j9[F9   E Fp[F(?0F !" F(9F(F0 ii(i(; KE (F !"F(O(F!'F(?9Fq(ZF`-A-FFA  `P8(7$,66666666666 2QH"9F2`xDL (  b2`ͱo@9F"0`EHxDEHoD9F"4`xDq -ȿ,F%,F%(F(bk DO BsEB YB A,ap$ < ,]-_scODx- уB!p2h5`npD<`'yB#Fxp`2+@'𵅰F F F:F3F#hBrBoC#`FKJ{DX F'F -K{DS%@&hC%`!& -OO OKJ{DhzD  D`F8e``%8F%a` FiE\<8FK{DBh *ݽ8@o HX(F4 K(Fbh{DS"C"@!`8@Ϳ8^i Eh "Ԛ[` pG` pG  " 2 22[2`FpG pG pG-OFF0O h  #3@+CEC0+UKTE P8F  p@FFrta @@F ""O2pO2@O2(@PpGFpG pGF #Daa-OFiF iBFFhph Bȿ0(K! sFcEC  QE+Q#ЀpuF+h;W+S+ #C++F1hZEpjFzfF,aV]-<-GFFD -JYzDR!"F(GпH(M}D,h'HX ,hL@q dF(`(0#` O  0F!F\F0F.F%h ,FIX %hE F!FCF `0 a 0Ff\9-CF#iOaF@hh B0RF#FCEA#3(r !i  hF CG SsE!:FP`@ S sEB r F*a(Fi iO 0 bDSMRBO0B  F -CF F(N"Faa'#F',FF`h(=`!i@*iT[S˼l I7xtEzAӟ BSKK 2x0zAWm9a-CF FF F?F(A WC̱hFX "Lqaua- $$a4a$ 04aqa?3A5D 2@8ib00FphBBhDBӀh(pGcBDKBa` DL`(!{DQ`iaAHxDpW?HxDp?FHxDSsO3%F1F(F5""#MCFH)F"F3FxDHV FpAMVS@-OO arFFF.!h  0hh /@ Dah+@!( DbEhiBdhiBСh(iBhBјhB``*Ri0B101+)iB6mHxDtcis#iS 0aFXi ((iBi"hh k`)iBiB aSa+a i *iBaaai!(iBYaaQFXaD>FA`v: )OqB$آ|ON  P QDB  D:  ' @"aOLihJi`E#@!*U#0R"Xh  EOqOJ S.F*iB?FC.@a`` *ihB;B8````@sXFE, +b9-CFHh hDAF(@QF*D`ELfiBO!؆h h ( NEfE9hB6ѵB hO  %`~MEeE'ӯhB$``thiB!E pBѯhB P._i 0qB-0Q 'iB2HxD$Ei]i=/i GPFoi /Epi%`h g`*'iB7iB 5aua-ai&'iB.aa@i&iBhaa_h- Ѣ`Yh!\`BC`P&iBXh@𵀧iBha2D`BJ``iB@Jea`eiB ѧhaa:D`BL`P O BD$؝hh( eEеBshBoB h# '`j`EаB`hB\``^hiBПhBQhBKXi Xi 8iGFGi/E3p-4i0qB0&iB iO gh 'c`&iB/iB (aha(ai-'iBaa[i+&iBCaaBN`PciB Ѣ` _`BK`P("hO  (I5F#`h iBЮ````O)?$ҩuOH V3 `DE/  D<  " E %a'MaL afhHg`D,a (T,0@]h%BOy@ S'P +F"iB?kC'a``$ihB_B\```#`ahBP`` F H!FxDp( F0 L88HLxD|D#h#F8$HO2O`a`!`xD#aaa(FU5%%B#`% HxD=H I JxDyDzD 89979!IK-AF F{DhA!|i) (4Eg?J(FzDhhF ]ԸD3 >qhBN0hs BcEEӛh+4*J,HBxDD oFADB$ `BdF `?иB<HxDshp`a(Fhi2!:k :F00h!F8D($(FhiBO0a b9:988-GFGhFF'EHxDdEЬB ӲH4J!FxDzDK`$jhиE.0BӨJ zDhG@u%h DIyDHhIFvD`2FBwID"'D%c`#DyDZ`G\iB8aHxD1! fDBa@@aOL DW,B0G,09OD9iB38HxDCki[+i;i A0F_i /EiO xh  }`?iBiB aCa+a(iBaaoi7M}D)iB_aa*eh- BA f`{hCx`3୺@6$7755444r4(443N BJf`K`xh@H}`xD$ F3-OF;{Dh\|yD!, ٯp( \; , 4$$O {Dh% ' D(hhB' %`iBhB``iBN xDnOfhB@N*wO  I 1  ! OY)D D'  ' D@ " DD(hhB %`hB``OD:4Du`Bc`L:P{DhбO h'Yi   (HF`hiBӁ```` yD`La_h/Ђ~B S   DB  D<  $ B"7L{DS&0[*O W'fFXh  BFF(ZXiO{ S(0B`FFF(G.Eo-]B 3O:  # G   0'&DOS zD  # D@ DD LR&0&F]h% E(Fi8FYi FIF+.*V}DhB"fE&3B#hiB#еheEhBїhB``(UiVL }DU)pB/E) V}D/iB1|xD riZ2i:iG EFWi/eE/`i'hh j`-iBiB aBa*a0iBaawi? V}D(iBWaa) !DA1Ds`JhBO`DAu`_`-YPOxDh (B9CF`hiBӓ````|O+?$ҫp  YOJ  GDE(  D8! @ L%'%a]aL azD K B,0U`#(R, @Uh%BOxOJ  R)p:F yDiXE?&B)0a``hxDiBB```"`a6@#O4tDhB~i-0`xaEG`EQ#`{a@0Dr`EhEC`hBhyD h \d~DQPT$zDhBJh(GQh!KBD2aB8ٗB6إB4(FF/KBOP2D#w`7Dy`B=DHB eD=FKB{D@YJBU0kB@NBK(FBF(MH}DhxDh/rBN D B2(FFDXEC &F?!0BFFHxDp/F#KBD@F78FF F@FqzまB(B@ځO HKxD!{Di:DB!!s%i BҏK{DaI@u#HyD hxDaqБBbb3 +(``1F(h۱hXhvEh E эB ӵB 8DX`wHxDhi:DOotIСyDiD sB8ahqEЛh+hHEhH)FxD  ('/ DDPFE8F1F# r 0ʌaq'БF{EبEAhB/!C`n`PCI yD h  (B:CF `h iB:HxD````422C1T100p0G//v/V/.F.----,<,+++:-L+-***~,*h*,,)+)R+8+))(*(~(f(b(4(('1O)?$ҩp  SOH DF7  D>" F!<4& ahaL (a{D_hHC*P^`")S*0IXh BO|ON  S)FJzDiB?$C)Pa``IhyDiBB```#`aODhB ҾiE`2aQ`Dt`6 $&D`HxDqp0FHF%IO6yD!BZh ` F  D^D_`3zB D Dt`L|DiBha D`E]`giBѠhcaDE`_`]QPh)@  O &ؗhh(B$iBDhBAѹB ѫO! D!W`AFd(@0!(BF DoiBO #؇hh(GEзB=hB:ѹB L' xDh%`|AEбB)ӎhB&``rhiB#ЇhB EюhFE``-`idL ~DV,pB/F,N~D7iB2HxDtAi Yi 9iGFOi/Epi%ph w`&6iB/iB )aia)aiB aa@iN~D7iBHaa ^h(Ѫ`]h%Y`,Bx_h@t@ʀHxDiBha*DB`f`GiBAa`HxDiB@b!]FiBчhDa:D`Bc`PQ' ObD.*؝hh(BiBlhBhB ѰK%{Dh&`tB ЫN~D7iBThBP``ehiB ПhiBDhB>YiQi1i?1h0FOi/N~D6iB$`-9iHLxDP(`B@()N~D7iBiO Eh %C`iB(iB )aia)ai%B aa[i;zHxDiBKaawKB``P{D]iBњ`'X`Bc`P.mOOD:h (BEF9`h>iB````O,?#Ҭq  S FDA  0D8" A!KK' a`aL a{D^hHC%@_`!)S%0IXh BO|I S(P +F5N~D2iB?UC(@a``/IhyDiBHBE```#`a(HxDjabY$H!F$JxDzDc J`"IyD1 pAhB``ސ!!  x 4"L4 t$ |~8h@ =BO4F FF8P!"F(F8 FF F@}A $`)%#H ) %%xD!)F"8FIFyD1 ppR(' FBF(V\1F% "" B("F0F8FKJ{DXhpG(?F0#` F@?-GFOFKFDXh N("= F . .8.6 F"- F4S %m 2FiGFF FO7উp#kbhhVk-1 h!i eDDO &`O UF!i F# @+@_NRlH?XEд Nj (iF(pBOѠ@gdViF(@ ODOFѥ miQF"GEn"kahhE k- kch"ihIkD k!h  SD _AgE B JD"`b`h@@Bk k'`% +l"CBi)FG0&!i" kb`!`h@@ `EL#k"`! F`ehB &hc`>D&` F'*& FFF(iIF2FG0?#kh@@B!k ` & F%if`( %` 8F>F FNF(~D 8`iF(p@QKBS:`Oa)`O/`d MjvYBO`O`O`Z<F iFFFPFC! ` aaa HFxD%`%a`a1FGc𵟰F F!F"F>OC,$ oD`Oq Or 21F&0 :F  >p6p p p/` p p p/` Cp p p/` zp p p/` p p p/` -pp p/`z K JiF{DX#h U "h8 B V: wp pKJpF{DX(h(`.(hp,hCBsBB&D0FB(` !`O0p Fp:pF FF $M}D.)F p@8$4p )F2(F3()FT p@44p p$c#`! je ksT$B`O0p O  O  O B? nT:L5ppC#OBLO\C; \  pGGrBQ  pG pG-OFFFF\DXF!  PNO F~DXF(0xzHFXF XF!0x*)+dO8'$ O'$O'$Oh'$O "JE8FE XF| (G(C;E/XF![@O E IFXFO  N?C GE ӧXDoӧH)/`YF/%(FO<  X(0U  2 .kPW%PC 0X0S> X0 000\  0 0 0 P ( 0 $0(P? 0 00S(0U0000(,400 S ?  0SPQ=Y~PZ  0  ,Ѝ+000C-@CMPQS!8 `0` S 8   R%hXS%X RSqVXRBppSXV  SH W 0 00Y WVW Pf8 U0 ڀ0P1B0bQ%'*1W B/V!3b@∀ R 0Y0Y80 MDVLW> L;S7X"x%X0S10 0P1R`O80qPC pc R%'*Q8P0RS0 01M`J8 00 S8 8Cߍ488-! /! / / / / /!1AQaq/!1AQaq///--0 -@HЍ/--0 -.@HЍ/--0 -B@HЍ/--0 -0@HЍ/--0 - @HЍ/0S  0S 0C 00 00 00C00$ # //@- 00 0 ЍG-P`p P@W @0@ @ 0" 0 0@j !0SD P *"(0_P pS 0 S  0 0S  Y".) S8Pw P 0kP 0f@ 0  @\? PQ0 00S @ 'S2P<0 0&P1 P 0%0S@  (P  0Pm00 &0Sa@ '0PX)Ѝ@-L0 $    0 0Ѝ@- H@- L0 @-@-QO-MPp@pPp@S r0@X `\2?oS c5"c&X (p ")8 Q!*G* QG20k  )p Q!*`G*VG2 Ȍ\`?oS0fP8 c c7!5&s +   '8  Q P!*PJ* QPJ200l00x'x  Q !* J* Q J200kX&00*)8Q !* K*Q K20g  v )p   Q!*`G* VG2ȌZXVoYW UP3P## P!N*L 0i0d@&@?4? t?X0hx d  ,8| \ l|tg xjppqq,rrtss@t?tu$u@@upuv4v8xx(yy4}l ``,44.Čl܏ lll@ \ T\L ȳ \Է< Xt\d ,\t$0DL tL4X` L=?H  t?8X0h`h  P$8Xx?(  d*  $ " ))*p,-H.d/ 00H1 12\5P66:;? ?`?@\BhD EE8HtI M$$MNXO?@Q77l9!D; <(> A|$AAB HXIJO0P&Q"T8TWpX,X8LZ(dZ]]] h^@__ aaahiij$llmxn|n$oqq(s x({@{\ddtxؓ@d,04x $(Ĝ.dԝ0Dt((dPܢܢpL\T` D  Tb̧dttf~ȩL h 4`$̸ȹx Թ| ع lLd< 8l$h  x lh   t t   PA( P(jP t `l T \Z8B ?l? L < dtpXp   | x"" $<%d%%%&&` &&'T))*? *4 *8+H+++,(-D-D-X- DC^CCpDDE(FFFG 8GIII J$JNJdJJJJK.KLK\ TKHPzPPQR$S0 DS4 V0[Dcdcccc (d ldd e 8eee e e?#0f f f ggg$i j lj jjxkkk l lLlll lpmmmt nx nnt Tox hooppp4qT 8qjqP tqT xrX rssXutu u v wxPzz{{{f||||}܇|~8|ΊTd4΍Ď`tLltDܲ<8d$ TX\L xt`0<pr?8(<0P  ? X\`dd`??  IJڲ 'PCLM DATABLOBPP7*eth1Authentication_RequestAssociation_RequestReassociation_RequestDisassociation_Request_TXDisassociation_Request_RXDeauthentication_Request_TXDeauthentication_Request_RX$H`lAC_BEAC_BKAC_VIAC_VODSSS1DSSS2DSSS5DSSS11OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54MCS0MCS1MCS2MCS3MCS4MCS5MCS6MCS7VHT8SS1VHT9SS1VHT10SS1VHT11SS1DSSS1_MULTI1DSSS2_MULTI1DSSS5_MULTI1DSSS11_MULTI1OFDM6_CDD1OFDM9_CDD1OFDM12_CDD1OFDM18_CDD1OFDM24_CDD1OFDM36_CDD1OFDM48_CDD1OFDM54_CDD1MCS0_CDD1MCS1_CDD1MCS2_CDD1MCS3_CDD1MCS4_CDD1MCS5_CDD1MCS6_CDD1MCS7_CDD1VHT8SS1_CDD1VHT9SS1_CDD1VHT10SS1_CDD1 VHT11SS1_CDD1 MCS0_STBC MCS1_STBC MCS2_STBC MCS3_STBC MCS4_STBC MCS5_STBC MCS6_STBC MCS7_STBC VHT8SS1_STBC VHT9SS1_STBC VHT10SS1_STBC VHT11SS1_STBC MCS8 MCS9 MCS10 MCS11 MCS12 MCS13 MCS14 MCS15 VHT8SS2VHT9SS2VHT10SS2VHT11SS2DSSS1_MULTI2DSSS2_MULTI2DSSS5_MULTI2DSSS11_MULTI2OFDM6_CDD2OFDM9_CDD2OFDM12_CDD2OFDM18_CDD2OFDM24_CDD2OFDM36_CDD2OFDM48_CDD2OFDM54_CDD2MCS0_CDD2MCS1_CDD2MCS2_CDD2MCS3_CDD2MCS4_CDD2MCS5_CDD2MCS6_CDD2MCS7_CDD2VHT8SS1_CDD2VHT9SS1_CDD2VHT10SS1_CDD2VHT11SS1_CDD2MCS0_STBC_SPEXP1MCS1_STBC_SPEXP1MCS2_STBC_SPEXP1MCS3_STBC_SPEXP1MCS4_STBC_SPEXP1MCS5_STBC_SPEXP1MCS6_STBC_SPEXP1MCS7_STBC_SPEXP1VHT8SS1_STBC_SPEXP1VHT9SS1_STBC_SPEXP1VHT10SS1_STBC_SPEXP1VHT11SS1_STBC_SPEXP1MCS8_SPEXP1MCS9_SPEXP1MCS10_SPEXP1MCS11_SPEXP1MCS12_SPEXP1MCS13_SPEXP1MCS14_SPEXP1MCS15_SPEXP1VHT8SS2_SPEXP1VHT9SS2_SPEXP1VHT10SS2_SPEXP1VHT11SS2_SPEXP1MCS16MCS17MCS18MCS19MCS20MCS21MCS22MCS23VHT8SS3VHT9SS3VHT10SS3VHT11SS3DSSS1_MULTI3DSSS2_MULTI3DSSS5_MULTI3DSSS11_MULTI3OFDM6_CDD3OFDM9_CDD3OFDM12_CDD3OFDM18_CDD3OFDM24_CDD3OFDM36_CDD3OFDM48_CDD3OFDM54_CDD3MCS0_CDD3 MCS1_CDD3 MCS2_CDD3 MCS3_CDD3 MCS4_CDD3 MCS5_CDD3 MCS6_CDD3 MCS7_CDD3 VHT8SS1_CDD3!VHT9SS1_CDD3!VHT10SS1_CDD3"VHT11SS1_CDD3"MCS0_STBC_SPEXP2#MCS1_STBC_SPEXP2#MCS2_STBC_SPEXP2#MCS3_STBC_SPEXP2#MCS4_STBC_SPEXP2#MCS5_STBC_SPEXP2#MCS6_STBC_SPEXP2#MCS7_STBC_SPEXP2#VHT8SS1_STBC_SPEXP2$VHT9SS1_STBC_SPEXP2$VHT10SS1_STBC_SPEXP2%VHT11SS1_STBC_SPEXP2%MCS8_SPEXP2&MCS9_SPEXP2&MCS10_SPEXP2&MCS11_SPEXP2&MCS12_SPEXP2&MCS13_SPEXP2&MCS14_SPEXP2&MCS15_SPEXP2&VHT8SS2_SPEXP2'VHT9SS2_SPEXP2'VHT10SS2_SPEXP2(VHT11SS2_SPEXP2(MCS16_SPEXP1MCS17_SPEXP1MCS18_SPEXP1MCS19_SPEXP1MCS20_SPEXP1MCS21_SPEXP1MCS22_SPEXP1MCS23_SPEXP1VHT8SS3_SPEXP1VHT9SS3_SPEXP1VHT10SS3_SPEXP1VHT11SS3_SPEXP1MCS24,MCS25,MCS26,MCS27,MCS28,MCS29,MCS30,MCS31,VHT8SS4-VHT9SS4-VHT10SS4.VHT11SS4.OFDM6_TXBF1/OFDM9_TXBF1/OFDM12_TXBF1/OFDM18_TXBF1/OFDM24_TXBF1/OFDM36_TXBF1/OFDM48_TXBF1/OFDM54_TXBF1/MCS0_TXBF10MCS1_TXBF10MCS2_TXBF10MCS3_TXBF10MCS4_TXBF10MCS5_TXBF10MCS6_TXBF10MCS7_TXBF10VHT8SS1_TXBF11VHT9SS1_TXBF11VHT10SS1_TXBF12VHT11SS1_TXBF12MCS8_TXBF03MCS9_TXBF03MCS10_TXBF03MCS11_TXBF03MCS12_TXBF03MCS13_TXBF03MCS14_TXBF03MCS15_TXBF03VHT8SS2_TXBF04VHT9SS2_TXBF04VHT10SS2_TXBF05VHT11SS2_TXBF05OFDM6_TXBF26OFDM9_TXBF26OFDM12_TXBF26OFDM18_TXBF26OFDM24_TXBF26OFDM36_TXBF26OFDM48_TXBF26OFDM54_TXBF26MCS0_TXBF27MCS1_TXBF27MCS2_TXBF27MCS3_TXBF27MCS4_TXBF27MCS5_TXBF27MCS6_TXBF27MCS7_TXBF27VHT8SS1_TXBF28VHT9SS1_TXBF28VHT10SS1_TXBF29VHT11SS1_TXBF29MCS8_TXBF1:MCS9_TXBF1:MCS10_TXBF1:MCS11_TXBF1:MCS12_TXBF1:MCS13_TXBF1:MCS14_TXBF1:MCS15_TXBF1:VHT8SS2_TXBF1;VHT9SS2_TXBF1;VHT10SS2_TXBF1<VHT11SS2_TXBF1<MCS16_TXBF0=MCS17_TXBF0=MCS18_TXBF0=MCS19_TXBF0=MCS20_TXBF0=MCS21_TXBF0=MCS22_TXBF0=MCS23_TXBF0=VHT8SS3_TXBF0>VHT9SS3_TXBF0>VHT10SS3_TXBF0?VHT11SS3_TXBF0?OFDM6_TXBF3@OFDM9_TXBF3@OFDM12_TXBF3@OFDM18_TXBF3@OFDM24_TXBF3@OFDM36_TXBF3@OFDM48_TXBF3@OFDM54_TXBF3@MCS0_TXBF3AMCS1_TXBF3AMCS2_TXBF3AMCS3_TXBF3AMCS4_TXBF3AMCS5_TXBF3AMCS6_TXBF3AMCS7_TXBF3AVHT8SS1_TXBF3BVHT9SS1_TXBF3BVHT10SS1_TXBF3CVHT11SS1_TXBF3CMCS8_TXBF2DMCS9_TXBF2DMCS10_TXBF2DMCS11_TXBF2DMCS12_TXBF2DMCS13_TXBF2DMCS14_TXBF2DMCS15_TXBF2DVHT8SS2_TXBF2EVHT9SS2_TXBF2EVHT10SS2_TXBF2FVHT11SS2_TXBF2FMCS16_TXBF1GMCS17_TXBF1GMCS18_TXBF1GMCS19_TXBF1GMCS20_TXBF1GMCS21_TXBF1GMCS22_TXBF1GMCS23_TXBF1GVHT8SS3_TXBF1HVHT9SS3_TXBF1HVHT10SS3_TXBF1IVHT11SS3_TXBF1IMCS24_TXBF0JMCS25_TXBF0JMCS26_TXBF0JMCS27_TXBF0JMCS28_TXBF0JMCS29_TXBF0JMCS30_TXBF0JMCS31_TXBF0JVHT8SS4_TXBF0KVHT9SS4_TXBF0KVHT10SS4_TXBF0LVHT11SS4_TXBF0LK "$'a)+m.-14-7r:=AwEIMRsW\bgnt{قВ|Ӹ`Ϫۮxwl_get_chanspec_txpwr_max   $$ $ 0 0 0 <<<HLTTT```lllxxx !"#$%&'()*+,-./0123456789:;<= > ? @A B C D,E,F,G8H8I8JDKDLDwl_scb_bs_dataBLOBwl_interface_create_actionauto%s %d %s %d %s %s VHT : : %dx%d Rates%.2d %d.%d Mbit/s %.2d %d Mbit/s MCS indexes:%d MCS %d VHT indexes:%d VHT %d Nss %d UNKNOWNSorry, your driver has smfs_version %d but this program supports only version %d. Frame type: %s Ignored Count: %d Malformed Count: %d Successful/Failed Count: %s %d Count: %d %s MCS : [ %d ]Failed to allocate dump buffer of %d bytes bcnlenhistLAST %d BEACON LENGTH's: %d MAX BCNLEN: %d MIN BCNLEN: 0 MIN BCNLEN: %d wl_chspec_from_legacy: output chanspec (0x%04X) malformed send_frameMAX_PEER_WLU=%dCURRENT MAXIMUM PEERS = %d - Link Power Control parameters -tp_ratio_thresh = %d rate_stab_thresh = %d pwr_stab_thresh = %d pwr_sel_exp_time = %d tsf0x%08X 0x%08X %s: %s: error parsing "%s" as an integer Interference params structure version (%d) is not the version (%d) supported by this toolIntference params: period[%x] cnt[%x] txfail_thresh[%x] tcptxfail_thresh[%x] Txdelay params: ratio[%d] cnt[%d] period[%d] tune[%d] Error finding the remote server %s fixedtxchainC3C2C1C0: 0x%04X %s invalid %d args UTX 0x%02x Invaild UTX parameter: %s URX 0x%02x Invaild URX parameter: %s DTX 0x%02x Invaild DTX parameter: %s DRX 0x%02x Invaild DRX parameter: %s Password length is highError setting variable %s %c a b ? missing country abbrev invalid country abbrev: %s missing band abunsupported band: %s %d mW (%d.%d dBm) Byte count %d is odd srom[%03d]: 0x%04x %s (0x%x) invalid chanspec (0x%x) chanspecerror: missing argumentsunrecognized band value %d allband option "all" is for set only, not get%s is 0x%04x(%d) OffLoose interpretation of 11h spec - may join non 11h AP.Strict interpretation of 11h spec - may not join non 11h AP.802.11d modeLoose interpretation of 11h+d spec - may join non-11h APsinvalid value 0x%x passphrase must be between %d and %d characters long longdebugunknown0x%04x onoffchanspecs_defset%s: This IOVAR doesn't take any arguments. wl_dump_chanspecs_defsetbcmerror%s (0x%04x) monitor_promisc_level0x%x %sBits >32 are not supported on this driver version 0x%04x %s, %smsg values may be a list of numbers or names from the following set. Use a + or - prefix to make an incremental change.wme_ac_apwme_ac_staapstaAC ParametersWarning: AC params out of order%s: raw: ACI 0x%x ECW 0x%x TXOP 0x%x dec: aci %d acm %d aifsn %d ecwmin %d ecwmax %d txop 0x%x eff: CWmin %d CWmax %d TXop %dusec bebkvivoacm10acm value must be 1|0 aifsnaifsn %d out of range (%d-%d) ecwmaxecwmax %d out of range (%d-%d) ecwminecwmin %d out of range (%d-%d) txoptxop %d out of range (%d-%d) unexpected param %s g2b/gmacregx0x%08x OnqtxpowerTxPower is %d qdbm, %d.%d dbm, %d mW Override is %s -o-d-q-mError: Missing require chip ID<4325, 4329, 43291, 4330a1, 4330 or hsic> 432543294329143304330a1hsicError: Unsupported chip ID %s initError: %s: failed to initialize the dongle dhd_init()4325 is the selected chip id 4329 is the selected chip id 43291 is the selected chip id 4330b0 is the selected chip id 4330b04330a1 is the selected chip id hsic interface is selected nonechip init must be called before firmware download. using 4325 ram_info using 4329 ram_info using 43291 ram_info using 4330 b0 ram_info using 4330 a1 ram_info Error: unknown chip argv=%s filename required wbmembytesdhd_upload(): failed reading %d membytes from 0x%08x dhd_upload(): error writing to file %s Could not parse "%s" as a regulatory revision in the country string "%s" Could not parse a 2-3 char country code in the country string "%s" 1.363.77.0 (TOB) (r570264-20190331-1)verError %d on query of driver dump nvsetnvset: missing argumentsnvset error: extra arg "%s"; format is name=value (no spaces around '=') nvset error: no '=' in "%s", format is name=value (no spaces around '=') RSNWPAWPA2WPA2-PSKWPA-PSKNo sRSN (WPA2):WPA: multicast cipher: NONEWEP64WEP128TKIPAES-OCBAES-CCMPUnknown-%s(#%d) Unknown-%02X:%02X:%02X(#%d) unicast ciphers(%d): NONE WEP64 WEP128 TKIP AES-OCB AES-CCMP WPA-Unknown-%s(#%d) AKM Suites(%d): None %s FT-802.1x FT-PSK Unknown-%s(#%d) Unknown-%02X:%02X:%02X(#%d) Capabilities(0x%04x): %sPre-Auth, %sPairwise, %d PTK Replay Ctr%s%d GTK Replay Ctr%s No %s Capabilities advertised %s/NONE%s/WEP40%s/TKIP%s/AES%s/WEP104%s/0x%x0x%02x%02x%02x/0x%02xcapmbss16mbss4%d join_pref%02xPref RSSI <%d extra bytes in pref data> Pref BAND: len = %d 0x%x AUTO (no preference) 0x%x 5 GHz 0x%x 2.4 GHz 0x%x Use ASSOC_PREFER value 0x%x Pref WPA: len = %d %d ACP Specs %s-NONE%sU:M:Any <%d extra bytes> RSSI Delta for Pref BAND: len = %d RSSI boost %ddb Pref 0x%x: len = %d XX54g Legacy B54g Auto54g Only54g B Deferred54g Performance54g LRS%s (%d) legacygonlybdeferperflrsrb%s: No such file or directory Programming %s... error reading %s Committing image to flash... Done Successfully downloaded %d bytes *** UPGRADE FAILED! *** (status %ld) -vparsing "%s", too many rates specified, max is %d rates unable to convert the rate parameter "%s" .5(b)unable to convert trailing characters "%s" in the rate parameter "%s" empty legacy rateset not supported cur_ratesetparsing "%s", too many mcs rates specified, max is %d rates unable to convert the mcs parameter "%s" Error: Too many VHT rate masks specified, max %d Error converting VHT rate mask value '%s' Error: VHT rate mask must be 0 (disabled), 0xff (MCS0-7), 0x1ff (MCS0-8), 0x3ff (MCS0-9) or 0xfff (MCS0-11). dumpdump: error on query of WLC_DUMP dump: error on query of dump list srclearsrcrcerror parsing value "%s" as an integer for byte count error %d reading %s File %s is too large File %s is %d bytes but lacks a REV4/ signature File %s is %d bytes but lacks a REV11/ signature File %s is %d bytes but lacks a REV12/ signature File %s is %d bytes but lacks a REV13/ signature File %s is %d bytes, not %d or %d or %d or %d bytes srcrc only takes one arg %s is not an integer Byte offset (%d) is odd or negative Data extends past %d bytes Writing srom. ioctl %d, iolen %d, sroff %d, len %d dhd_rwl_download: %s: %s dhd_rwl_download: Unable to allowcate %d bytes! dhd_rwl_download: Short read in %s! Starting %s, total file length is %d dhd_rwl_download: failed to put dongle to download mode sending %d bytes block: %s: error %d on writing %d membytes at 0x%08x wl_set()dhd_rwl_download: failed to take dongle out of download mode %s: MCS %u out of range (>32) in ratespec 0x%X wl_ratespec2rate%s: expected rate encoding in ratespec 0x%X MediumHighLowNo memory to allocate return bufferInvalid option!!Reached input limitation!!AIBSS TXFAIL config beacon timeout duration: %d Max consecutive Tx failure before TXFAIL event:%d Max ATIM failures before TXFAIL event: %d Incorrect number of argumentswrong extra argumentsAIBSS Initial beacon check duration: %d AIBSS beacon check duration:%d AIBSS beacon flood duration:%d event_log_set_shrinkevent_log_set_expandevent_log_set_initError: Input %d SAR values, need total %d SAR values 2G: %4d %4d %4d %4d 5G[%1d] %4d %4d %4d %4d errorReceive: good packet %d, bad packet %d, othercast good packet %d Transmit: good packet %d, bad packet %d LOGPRINTevent_log_tag_controlradioregsyntx0tx1rx0rx1cr0cr1cr2pllToo many arguments (%d) for command %s country%s (%s/%d) %s No country set%s () %s listSupported countries: country code and long name%s %s Argument "%s" could not be parsed as a country name, country code, or country code and regulatory revision. Argument 1 "%s" could not be parsed as a country code, or country code and regulatory revision. Argument "%s" had a revision. Arg 2 must be a country name or country code without a revision Argument 2 "%s" could not be parsed as a country name or country code Driver does not support full country spec interface, only a country name or code may be sepcified vendorid 0x%x deviceid 0x%x radiorev 0x%x chipnum 0x%x chiprev 0x%x chippackage 0x%x corerev 0x%x boardid 0x%x boardvendor 0x%x boardrev %s driverrev 0x%x ucoderev 0x%x bus 0x%x phytype 0x%x phyrev 0x%x anarev 0x%x nvramrev %d --pciecis-pWriting in PCIe CIS formatciswritelen %d sizeof(cish) %d total %d ciswrite failed: %d wme_dpDiscard oldest first: BE=%d BK=%d VI=%d VO=%d %s: Invalid parameter %s: STA only wme_qosinfoMax SP Length = %d, APSD: BE=%d BK=%d VI=%d VO=%d %s: AP only wme_maxbw_paramsWME bandwidth limit: %s: bandwidth limit %d Need value following %s Unknown access category: %s wme_tx_paramsWME TX params: %s: short %d. sfb %d. long %d. lfb %d. max %d Unknown access class: %s shortsfblfbmax_ratemaxrateUnknown parameter: %s Value for %s must be < %d External SPROMBuilt-in defaultUnknown?Internal OTP-bInvalid byte count %d, must be even Count %d too large cisdumpFailed cisdump request: %d Source: %d (%s) Maximum length: %d bytes Byte %3d: 0x%02x Error writing %d bytes to file, rc %d! Wrote %d bytes to %s Problem opening file %s --previewcisupdate hex string must contain an even number of digits cisupdate invalid hex digit(s) in %s cisupdate failed to read cis: %d cisupdate offset %d plus update len %d exceeds CIS len %d cisupdate: OTP update incompatible: update[%d](0x%02x)->cis[%d](0x%02x) offset %d data %s cislen %d cisupdate cis write failed: %d - Beacon Trim Statistics -M_BCNTRIM_N : %d M_BCNTRIM_TIMEND : %d M_BCNTRIM_TSFTLRN : %d M_BCNTRIM_PREVBCNLEN : %d M_BCNTRIM_N_COUNTER : %d M_BCNTRIM_STATE : %d M_BCNTRIM_TIMLEN : %d M_BCNTRIM_BMPCTL : %d M_BCNTRIM_TSF_L : %d M_BCNTRIM_TSF_ML : %d M_BCNTRIM_RSSI : %d M_BCNTRIM_CHANNEL : %d M_BCNTRIM_SBCNRXED : %d M_BCNTRIM_CANTRIM : %d M_BCNTRIM_TRIMMED : %d M_BCNTRIM_BCNLENCNG : %d M_BCNTRIM_TSFADJ : %d M_BCNTRIM_TIMNOTFOUND : %d Error: txpwr_target failed. Make sure interface is up. Error: version [%d] mismatch Driver version:%d Maximum Tx Power Target (chanspec:0x%x): %2d.%02d Heap Total: %d(%dK), Heap Free: %d(%dK) Scan in progress.current scan channel %d No scan in progress.current mac channel %d target channel %d (Override ON)%d.%d dBm = %d mw. %s -uRequire dongle image filename dongle image file is %s vars filename missing, assuming no var file dongle var file is %s downloadret = %d nvdownloadusing 4330a1 ram_info using hsic interface dhd_download: %s: %s dhd_download: Unable to allowcate %d bytes! dhd_download: Short read in %s! check_file: Error: trx bad hdr %x! dhd_download: Failed input file check on %s! Starting download, total file length is %d dhd_hsic_download: failed to put dongle to download mode dhd_hsic_download: failed to take dongle out of download mode %s file_size=%d %s: failed to put dongle in download mode dhd_iovar_setint()downloading %s, file_size=%d %s: error reading file %s fread()memblock= %s feof()the original varbuf=%s after process_nvram_vars(), %s nvram_len=%d %s var_size=%d, start=0x%0X last4bytes=0x%0X sending %d bytes block: %s: failed to take dongle out of download mode ssid <%s> exceeds %d bsscfg:err - module count over %d Version mismatch, please upgrade. Got %d, expected %d or 1 -a-ierror: expected interface name after option %s -x-h--help--clientbatch--es-W--wlcerror: expected wlc integer index after option %s %s %s %s %s %u cfgconfigconfiguration%s: could not parse "%s" as an integer for the configuartion index wl_chspec_to_legacy: input chanspec (0x%04X) malformed wl_chspec_to_legacy: unable to convert chanspec %s (0x%04X) to pre-11ac format %s: could not parse [%s] as band %s: invalid band %d %s: could not parse [%s] as bandwidth %s: invalid bandwidth %d %s: you need to set a bandwidth, '-w <20|40|80>' %s: you need to set a band, '-b <5|2>' %s (0x%04x) %2d.%02d(dbm) wl_dump_chanspecs%s: could not parse "%s" as an int for band %s: could not parse "%s" as an int for bandwidth %s: bandwidth 80 MHz is not supported by this version driver. %s: please provide country abbrev Usage: %s [channel | All ] per_chan_infoInvalid ChannelNot supported in current localeChannel %d A BandB Band, RADAR Sensitive, Restricted, Passive, Temporarily Out of Service for %d minuteswl_sc_chan%s: could not parse "%s" as an int for the channel %s: invalid channel %d %s: could not parse "%s" as an int for ctl sideband %s: invalid ctl sideband %d %s: you need to set a channel, '-c ' %s: you need to set a bandwidth, '-w <20|40>' %s: you need to set a ctl sideband, '-s <-1|0|1>' SC Chanspec set to 0x%x wl_chanspecChanspec set to 0x%x DFS Preferred channel list:: %s(0x%x) (0x%x) DFS Preferred Channel:: 0x0 (None)DFS Preferred Channel:: %s (0x%x) DFS Preferred Channel:: 0x%x -lPlease provide channel listList Configuration is not supported in this version of driver, channel should be prefixed with +/-Invalid channel specifiedIgnoring chanspec 0x%x Maximum %d channels supported err=%d version=%d version: %d, num_sub_status: %d @%d: Unknown dfs state %d. state: %s, time elapsed: %dms, chanspec: %s (0x%04X), chanspec last cleared: none, chanspec last cleared: %s (0x%04X), none, sub type: 0x%02x (a)RPICCABasicrm_repMeasurement Report: token %d, length %d Parallel | LateIncapableRefusedflags : 0x%02x (%s) flags : 0x%02x token : %4d channel : %4d %s start tsf: 0x%x:%08x duration : %4d TU Error: partial report element, %d report bytes remain, element claims %d Basic bits: 0x%08x Carrier Fraction: %d / 255 Power <= %3d: %3d < Power <= %3d: %3d < Power : %3d Report : %s Report : %d rm_reqwl_rm_requestp%s: could not parse "%s" as an int for the token %s: could not parse "%s" as an int for channel %s: could not parse "%s" as an int for duration basicccarpi%s: could not parse "%s" as a measurement type %s: no measurement requests specified NO RADAR DETECTED DFS: NONE ########## RADAR DETECTED ON CHAN %s DFS: FCC-5 ########## RADAR DETECTED ON CHAN %s ########## lp_csect_single = %d, Time from last detection = %u, = %dmin %dsec AT %dMS DFS: %s ########## RADAR DETECTED ON CHAN %s ########## detected_pulse_index= %d, nconseq_pulses = %d, Time from last detection = %u, = %dmin %dsec AT %dMS Pruned Intv: %d-%d Pruned PW: %i-%d Pruned FM: generic_dloadclmloadincrementalbaseunable to open input file %s fstat on input file %s return error %s input file %s is empty (i.e. zero length) unable to allocate %u bytes based on input file size! size of input file %s is less than %d bytes. This can't be a CLM file! read of input file %s wasn't good based on fstat size %u Downloading CLM blob format file %s Downloading legacy, obsolete CLM binary format file %s as a %s CLM input file is missing CLM binary or CLM blob magic string too few arguments (none) too mang arguments (3 or more) size of input file %s is less than %d bytes. This can't be a txcap file! Downloading txcap package format file %s txcaploadinput file is missing txcap package magic string size of input file %s is less than %d bytes. This can't be a cal file! Downloading calibration package format file %s calloadinput file is missing calibration package magic string Bad value: %s -15.5%d%s Mbpssetget5g_%s2g_%s%s: driver band must be locked to %s %s, use %s/%s instead wl_rate_mrate stbc ldpc sgi2040801601052.5???rate %d%s Mbps Tx Exp %dht mcs %d Tx Exp %d BW %s%s%s%svht mcs %d Nss %d Tx Exp %d BW %s%s%s%scmd %s not supported in this version of the driver, ioctl version 1. %s: malloc failure for rate string buffer. wl_rate%s: malloc failure for option_name buffer. lg%s: cannot mix positional args and options. Got positional arg "%s" after options. %s: unexpected parameter "%s" after rate value. -%c%s: expected a value for %s option %s: could not parse "%s" as a value for %s option htvht%s: expected a value start with c for %s option ssexp%s: tx expansion %d out of range [0-3] stbc%s: unexpected a value for %s option ldpcsgibandwidth%s: unexpected bandwidth specified "%s", expected 2.5, 5, 10, 20, 40, 80, or 160 %s: must specify one of "auto", legacy rate -r/--rate, HT (11n) rate -h/--ht, or VHT (11ac) rate -v/--vht %s: cannot use legacy rate -r/--rate and HT rate -h/--ht at the same time %s: cannot use legacy rate -r/--rate and HT rate -v/--vht at the same time %s: cannot use HT rate -h/--ht and HT rate -v/--vht at the same time %s: cannot use -s/--ss option with non VHT rate %s: cannot use STBC/LDPC/SGI options with non HT/VHT rates ERROR: no valid ether addr provided%02x:%02x:%02x:%02x:%02x:%02x sch: %s (%u) / prio: %u mac_rate_histoOnly Access Category 0x10 and 0x4 is supportedFirst TSF Timestamp: %08x%08x Last TSF Timestamp : %08x%08x auth_ptk_m1auth_gtk_bad_m1auth_gtk_m1ptkgtk_badgtkUnknown optionMac address missingprio %d out of range [0, 3] Set SCB prio: 0x%x SCB prio: 0x%x tpcerror: unknown measurement type %s error: missing target addresserror: could not parse MAC address %s Error allocating %d bytes for probe params --missing " = " in long param "%s" missing value after " = " in long param "%s" only single char options, error on param "%s" missing value parameter after "%s" ssiddoesn't support multiple ssids "%s" ssid bssidcould not parse "%s" as an ethernet MAC address "%s" bssid address da"%s" MAC address "%s" ignored sendprbSTA MAC not specified, deauth all Malformed STA MAC parameter ac %d out of range [0, 3] or -1 to indicate all too few parameters.%02XACTIVEEXTERNALno: ------addr------ : l.aid : state : p.aid : mppid :llid : plid : entry_state : rssi%d: %s : 0x%x : %s : 0x%x : %4d : %4d : %4d : %s : %d %d: %s : %s : %s : %s : %s : %s : %s : %s : %s NA NA TIMEDOUTmesh_peer_statuscancelProblem parsing MAC address "%s". maclist count: %d [%d]:%s %s adddelerror: unknown operation option%s txdelay_stats_t version is mismatched This is partial results for SCBs caused by insuffient IOCTL buffer If you want to get full SCBs Please use iteration for each of specific mac_address which can be got from other iovars such as assoclist[SCB%d] %s %s: PLoss %d/%d (%d%%) Delay stats in usec (avg/min/max): %d %d %d Txcnt Hist : %d Delay vs Txcnt: -1 Delay Hist : %d(%d%%) : pmkid entries : %d PMKID[%d]: %s =%02x set cmd ignoredAssoc req: len 0x%x Assoc resp: capab 0x%x listen 0x%x reassoc bssid %s assoc_req_iesassoc req IEs: status 0x%x aid 0x%x assoc_resp_iesassoc resp IEs: 0x%02x %s: argv[0] missing -noreset-raw-tab-comma-noidle-help%s: unknown option: %s wlu / wl driver mismatch, expect V%d format, got %d. No stations are currently associated.%17s%cStation Address%9.9s %9.9s %9.9s %9.9s %9.9s %9.9s %9.9s %9.9s %9.9s retry_droprtsfailretrytxrate_maintxrate_succackedthroughputtime_deltaairtime%10s%c%10s%c%10s%c%10s%c%10s PHY MbpsData MbpsAir UseData UseRetries%9d %9d %9d %9d %9d %9d %9d %9d %9d %10.1f%c%10.1f%c%9.1f%%%c%9.1f%%%c%9.1f%% prec: rqstd, stored,selfsave, saved,fulldrop, dropped,sacrficd, retried, rtsfail,rtrydrop, psretry,supprssd, acked,utlisatn,q length,Data Mbits/s,Phy Mbits/s,Rate Mbits/s, %%air, %%effcy (v%d) prec: rqstd, stored, dropped, retried, rtsfail,rtrydrop, psretry, acked,utlisatn,q length,Data Mbits/s,Phy Mbits/s, %%air, %%effcy (v%d) prec: rqstd, stored, dropped, retried, rtsfail,rtrydrop, psretry, acked,utlisatn,q length,Data Mbits/s,Phy Mbits/s (+v%d.) prec: rqstd, stored,selfsave, saved,fulldrop, dropped,sacrficd, retried, rtsfail,rtrydrop, psretry,supprssd, acked,utlisatn,q length,Data Mbits/s,Phy Mbits/s,Rate Mbits/s (+v%d.) %02u: %7u, %7u, %7u, %7u, %7u, %7u, %7u, -, -, %7u, %7u, %7u, %7u, %7u, %7u, %8.2f, -, - %02u: %7u, %7u, %7u, %7u, %7u, %7u, %7u, -, -, %7u, %7u, %7u, %7u, %7u, %7u, %8.2f, -, -, -, - %02u: %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %8.2f, %8.2f, %8.2f %02u: %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %8.2f, %8.2f, %8.2f, %6.1f, %5.1f %02u: %7u, %7u, %7u, -, -, %7u, %7u, %7u, %7u, %7u, %8.2f, - %02u: %7u, %7u, %7u, -, -, %7u, %7u, %7u, %7u, %7u, %8.2f, -, -, - %02u: %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %8.2f, %8.2f %02u: %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %7u, %8.2f, %8.2f, %6.1f, %5.1f Unknown/unsupported binary format (%x) Parameter %c:%s not valid Total time in ps pretend state is %d milliseconds Bad parameter '%s' Bad precedence %d (will be ignored) Ignoring excess parameter '%s' (maximum number of params is %d) Error getting variable %s unable to allocate memory Cannot get assoclist No available addresses in assoclist for automatic operation Error getting %s Destination: %s Could not find corresponding scb from given mac address. %s %s clear:::%u.%u.%u.%u%x%u.%u.%u.%uError allocating %d bytes for route table No entries presententry%d %s %s wrong command format \x%02X%04d: ssid too longget returned error 0x%x set returned error 0x%x %d/%d/%d build %d%d.%d RC%d.%dcould not parse channel number starting at substring "%s" in list: %s ,too many channels (more than %d) in channel list: %s string "%s" before ',' or ' ' is too long could not parse chanspec starting at "%s" in list: %s too many chanspecs (more than %d) in chanspec list: %s prescannedwl_parse_assoc_params: missing " = " in long param "%s" wl_parse_assoc_params: missing value after " = " in long param "%s" wl_parse_assoc_params: only single char options, error on param "%s" wl_parse_assoc_params: missing value parameter after "%s" could not parse as an ethernet MAC address chanspecserror parsing chanspec list arg cannot use bssid/channel options with prescan option no arguments to wl_reassoc Error allocating %d bytes for scan params could not parse %s as an Ethernet MAC address could not parse reassociation parameters wl_scan: missing " = " in long param "%s" wl_scan: missing value after " = " in long param "%s" wl_scan: only single char options, error on param "%s" wl_scan: missing value parameter after "%s" scan_typeactivepassiveprohibitoffchanhotspotscan_type value should be "active", "passive", "prohibit", "offchan" or "hotspot", but got "%s" bss_typebssinfraibssadhocanybss_type value should be "bss", "ibss", or "any", but got "%s" nprobescould not parse "%s" as an int for value nprobes could not parse "%s" as an int for active dwell time could not parse "%s" as an int for passive dwell time homecould not parse "%s" as an int for home channel dwell time ssid count %d exceeds max of %d additional ssids exceed params_size escanescanabortunknown escan command: %s iscan_siscan_cunknown iscan command: %s --duration=could not parse "%s" as an int for duration iscanGET roam scan paramsroamscan_parmsError retrieving roamscan params: %d Roam Scan Parameters:scan_type: %d nprobes: %d active_time: %d passive_time: %d home_time: %d Channels:Channel number 0x%x Setting Roam Scan parameters params_size %d [ %d%s%s Warning: Basic rate attribute ignored for "%s" command Can't parse phy type nlpssnlcnlcn40acWrong phy type: %s Can't parse band type Wrong band type: %s Can't parse cck Wrong cck: %s Can't parse basic rates Wrong basic rates: %s Can't parse mcs Wrong mcs: %s Can't parse bandwidth Wrong bandwidth: %s Can't parse tx/rx streams txtxstreamsCan't get tx streams rxrxstreamsCan't get rx streams Wrong tx/rx streams: %s default_ratesetdefault_rateset failed OFDM: BCM OFDM: BCMERR: more than max. of %d ofdm rates ERR: failed to convert %s ERR: no ofdm rate specified ERR: exceed max. %d bitmask bytes; parsing %s ERR: exceed max. %d bitmasks; parsing %s ERR: vht bitmask must be 0 (disabled) or up to a maximum of 0xfff (MCS0-11). ERR: %s is an invalid ofdm rate AUTHENTICATED ASSOCIATED AUTHORIZED BRCM WME PS No-ERP APSD_BE APSD_BK APSD_VI APSD_VO N_CAP VHT_CAP AMPDU AMSDU MIMO-PS MIMO-PS-RTS RIFS LDPC 40MHz GF SGI20 SGI40 STBC-Tx STBC-Rx D-BlockAck 40-Intl SGI80 SGI160 SU-BFR SU-BFE MU-BFR MU-BFE TXOPPS VHT-HTC ERROR: unknown driver station info version %d [VER %d] STA %s: aid:%d rateset idle %d seconds in network %d seconds state:%s%s%s flags 0x%x:%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s HT caps 0x%x:%s%s%s%s%s%s%s%s%s VHT caps 0x%x:%s%s%s%s%s%s%s%s%s%s%s tx total pkts: %d tx total bytes: %llu tx ucast pkts: %d tx ucast bytes: %llu tx mcast/bcast pkts: %d tx mcast/bcast bytes: %llu tx failures: %d rx data pkts: %d rx data bytes: %llu rx ucast pkts: %d rx ucast bytes: %llu rx mcast/bcast pkts: %d rx mcast/bcast bytes: %llu rate of last tx pkt: %d kbps - %d kbps rate of last rx pkt: %d kbps rx decrypt succeeds: %d rx decrypt failures: %d tx data pkts retried: %d per antenna rssi of last rx data frame: %d per antenna average rssi of rx data frames: per antenna noise floor: tx total pkts sent: %d tx pkts retries: %d tx pkts retry exhausted: %d tx FW total pkts sent: %d tx FW pkts retries: %d tx FW pkts retry exhausted: %d rx total pkts retried: %d IE header truncated: ID: 0x%02X IE data truncated: ID: 0x%02X Len: %d ID: 0x%02X Len: %d Data:Data: ManagedAd Hocmesh2.4 -- 0-8 -- 0-11 0-7 0-9 0-8, 10-110-7, 10-11SSID: "%s" Mode: %s RSSI: %d dBm SNR: %d dB noise: %d dBm Flags: FromBcn Cached RSSI on-channel Channel: %s BSSID: %s Capability: ESS IBSS Pollable PollReq WEP ShortPre PBCC Agility ShortSlot RRM CCK-OFDM Supported Rates: VHT Capable:HT Capable: Chanspec: 5GHz channel %d-%d 80+80MHz (0x%x) Chanspec: %sGHz channel %d %dMHz (0x%x) Primary channel: %d HT Capabilities: 40Mhz SGI20 SGI40 Supported HT MCS :-%d Negotiated VHT MCS: NSS%d : %s Supported VHT MCS: NSS%d Tx: %s Rx: %s WPS: V%d.%d V1.0 UnconfiguredConfiguredUnknown StateHotspot 2.0 capablePoOSEN supportedevent_msgsCannot create socket %d Cannot get index %d Cannot bind %d Cannot not allocate %d bytes for events receive buffer can't allocate memory for bsssync_id: %d, status:%d, misc. error/abort Scan timeout! Receive scan results failed!Failed to revert event mask, error %d Interface name %s too long WLC_E_ESCAN_RESULT, (sync_id,status) = (%d,%d) sync_id: %d, WLC_E_STATUS_PARTIAL sync_id: %d, WLC_E_STATUS_SUCCESS => SCAN_DONE MOREINFO: (sync_id,buflen,ielen) = (%d,%d,%d) ERROR: IE tlv sanity check failed for (ssid,sync_id,buflen,ielen,remainder) = (%s,%d,%d,%d,%d) Sorry, your driver has bss_info_version %d but this program supports only version %d. Not associated. Last associated with iscanresultswl_get_iscan buflen 0iscanresults incompleteiscanresults completeiscanresults pendingiscanresults abortediscanresults returned unknown status %d 0xccmocbnotx%2.2f%2.2f %-23s%d %s%s %s%s%s %s%s%s%s %s%s%s%s%s %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s - - (NO_RATE) - - - - - - - - - - - - - - - - - - - Rate Chains 2.5MHzRate Chains 5MHzRate Chains 10MHzRate Chains 20MHzRate Chains 20in40 40MHzRate Chains 20in80 40in80 80MHz 20in 40in 80inRate Chains 160 160 160 160 20in 40in 80in chan1 chan2Rate Chains 80+80 80+80 80+80 80+80 80+80 20in 20in 40in 20in 40in 80in 20in 40in 80in chan1 chan2Rate Chains 2.5 5 10 20 40 40 80 80 80 160 160 160 160 80+80 80+80 80+80 80+80 80+80illegal ppr data! Error: Unknown bandwidth %d Error: Unknown rate %d Error allocating rates array HWSWError: clock not active, do wl up (if not done already) and force mpc 0 to active clock Allocating mem failed for curpower --verbose--briefIgnoring arguments for %s Error: Curpower failed. Bring up interface and disable mpc if necessary (wl mpc 0) error: version mismatch - driver %d, wl executable was expecting %d Error: read ppr board limit failed Error: read ppr target power failed Error: read ppr regulatory limits failed %-23s%s Output Format Version:8%-23s%s, %s Power Control:Current Channel:BSS Channel:%-23s%d.%d dBm BSS Local Max:%-23s%d.%d dB BSS Local Constraint:%-23sChannel Width:2.5MHz5MHz10MHz20MHz40MHz80MHz160MHz80+80MHzUser Target:SROM Antgain 2G:SROM Antgain 5G:SAR:%d.%d dB -Open loop:Current rate:[%s] %s Regulatory Limits:%-23s%d Core Index:Board Limits:Power Targets:Maximum Power Target among all rates: Last est. power : Power Target for the current rate : - Last adjusted est. power : Last est. power: %2d.%02d dBm Last CCK est. power: %2d.%02d dBm set: missing argumentsset: missing value argument for set of "%s" set: error parsing value "%s" as an integer for set of "%s" get: missing arguments%d (0x%x) get: error, extra arg "%s" %s(): wlu_var_getbuf failed %d ifname: %s bsscfgidx: %d mac_addr %s Currently limited to %d types in one query malloc failed to allocate %d bytes Type '%s' (arg %d) not a number? Power stats version mismatchVersion: %d, Length %d bytes Bad len %d for tag %d, remaining len %d Resrved bits in len %d for tag %d, remaining len %d Short len for %d: %d < %d PHY: TX Duration: %u RX Duration: %u SCAN: User-Scan: Count: %u Duration: %u Assoc-Scan: Count: %u Duration: %u Roam-Scan: Count: %u Duration: %u PNO-Scan: Count: %u Duration: %u Other-Scan: Count: %u Duration: %u HSIC: Suspend count: %u Resume count: %u Disconnect count: %u Reconnect count: %u Active duration: %u Suspend duration: %u Disconnect duration:%u link stats are not supported for this pcie corePCIE: D3 Suspend count: %u D0 Resume count: %u PERST# assert count: %u PERST# deassert count: %u Active duration: %u ms D3 Suspend duration: %u ms PERST# duration:%u ms l0 cnt:%u dur:%u usecs l1 cnt:%u dur:%u usecs l1_1 cnt:%u dur:%u usecs l1_2 cnt:%u dur:%u usecs l2 cnt:%u dur:%u usecs LTR_ACTIVE Count %u Duration: %u ms LTR_SLEEP Count %u Duration: %u ms DeepSleep Count %u Duration: %u ms # of submissions %u - # of h2d doorbell:%u # of completions %u - # of d2h doorbell:%u # of rx_completions %u - # of d2h drbl. for rx_completions %u # of tx_completions %u - # of d2h drbl. for tx_completions %u Avg. # of subm./doorbell:%d.%d, Avg. # of subm./doorbell:0.0, avg. # completions/MSI:%d.%d avg. # completions/MSI:0.0PM WAKE: Current Time: %u HW MACC: 0x%08x SW MACC: 0x%08x PM Dur: %u MPC Dur: %u TSF Drift (Last/Min/Max/Avg/Cnt): %d/%d/%d/%u/%u Frts (end_cnt/dur): %u/%u Unexpected idx %d > %d State: %2d reason: 0x%04x time: %u --- Event: %2d Wake-Duration: %u Connect: Count: %u Duration: %u Skipping uknown %d-byte tag %d Invalid length remaining %d %-8s %8s %8s %8s %8s %8s NameSZMaxCurrHiWaterFailed%-8s %8d %8d %8d %8d %8d -n-curband-c-cs-s%d: Num of seconds must be <= %d Must pick at least one of averages or individual secsCCA: Can't get currrent chanspecUsing channel %d unable to allocate memoryBogus num of seconds returned %d chan dur ibss obss interf time%-3u %4d %4u %2d%% %-6s %4u %2d%% %-6s %4u %2d%% %-6s %d Summaries:chan dur ibss obss interf num seconds%-3u %4d %4s %2d%% %-6s %4s %2d%% %-6s %4s %2d%% %-6s %d Cannot find a good channel due to: %s Recommended channel: %d get external assert logs: %d Version mismatch: version = 0x%x, expected 0x%x id: time(ms) string%d: %d %sstate %s time elapsed %dms radar channel cleared by dfs channel %s (0x%04X) Read rclass fails: chanspec:0x%x rclass=0x%x nvget: missing argumentsnvget error: extra arg "%s" nvram_getnvdump error: extra arg "%s" nvram_dumprdvarwrvarcisconvertcis_sourceFail to get sromrev from nvram file!sromrevInvalid sromrev %d. RAWRAW1manfproductnamemanfidprodidmacaddrArgument does not look like a MAC address: %s ccodecctlrssismf2grssismc2grssisav2gbxa2grssismf5grssismc5grssisav5gbxa5gantswctl2gtriso2gpdetrange2gextpagain2gtssipos2gantswctl5gtriso5gpdetrange5gextpagain5gtssipos5guuidtempthreshtemps_periodtemps_hysteresistempoffsettempsense_slopetempcorrxtempsense_optionphycal_tempdeltafemctrlpapdcap2gtworangetssi2gpdgain2gepagain2gtssiposslope2ggainctrlsphpapdcap5gtworangetssi5gpdgain5gepagain5gtssiposslope5grxgains5gtrelnabypa0rxgains5gtrisoa0rxgains5gelnagaina0rxgains2gtrelnabypa0rxgains2gtrisoa0rxgains2gelnagaina0rxgains5ghtrelnabypa0rxgains5ghtrisoa0rxgains5ghelnagaina0rxgains5gmtrelnabypa0rxgains5gmtrisoa0rxgains5gmelnagaina0rxgains5gtrelnabypa1rxgains5gtrisoa1rxgains5gelnagaina1rxgains2gtrelnabypa1rxgains2gtrisoa1rxgains2gelnagaina1rxgains5ghtrelnabypa1rxgains5ghtrisoa1rxgains5ghelnagaina1rxgains5gmtrelnabypa1rxgains5gmtrisoa1rxgains5gmelnagaina1rxgains5gtrelnabypa2rxgains5gtrisoa2rxgains5gelnagaina2rxgains2gtrelnabypa2rxgains2gtrisoa2rxgains2gelnagaina2rxgains5ghtrelnabypa2rxgains5ghtrisoa2rxgains5ghelnagaina2rxgains5gmtrelnabypa2rxgains5gmtrisoa2rxgains5gmelnagaina2pdoffset2g40ma0pdoffset2g40ma1pdoffset2g40ma2pdoffset2g40mvalidInput array size error!sromrev %d buffer size %d bytes: 0x%.02x sromrev not defined in nvram file!CIS parse failure!cisvarBad variable name: %s Variable %s does not exist in sromrev %d %s=%s%s=0x%x%s=%d%s=%u,0x%x,%d,%uwrvar missing value to write for variable %s Bad value: %s for variable %s Error %d writing the srom err=%d version=%d, move status=%d AP Target Chanspec %s (0x%x) dfs AP move in IDLE statewl_dfs_ap_move"%s" wlc_ver iovar doesn't take any arguments wlc_ver %d.%d epi_ver %d.%d.%d.%d Incorrect version of counters struct: expected %d; got %d %s: tx frames: %u bytes: %u failed frames: %u failed bytes: %u rx frames: %u bytes: %u failed frames: %u failed bytes: %u foward frames: %u bytes: %u tx frames time expired: %u set: error parsing value "%s" as an integer ESTPWR LUT FOR CORE %d BSS peer info version/structure size mismatch driver %d firmware %d ERROR : peer list received exceed the buffer size PEER%d: MAC: %s: RSSI %d TxRate %d kbps RxRate %d kbps age : %ds rateset PMU Control : 0x%08x PMU Capabilities : 0x%08x PMU Status : 0x%08x Resource State : 0x%08x Resurce Pending : 0x%08x PMU Timer : 0x%08x Minimum Resource Mask: 0x%08x Maximum Resource Mask: 0x%08x PMU ChipControl[%d] : 0x%08x PMU RegControl[%d] : 0x%08x PMU PllControl[%d] : 0x%08x PMU Resource Up/Down Timer[%d] : 0x%08x PMU Resource Dependancy Mask[%d] : 0x%08x caldumpcaldump: total dump size %d bytes caldump: total dump size too largeunable to open output file %s write TxCal to output file %s wasn't complete for %u bytes caldump: to file %s Too few arguments %s: Length must be specified Error reading svmp memory %s %d %04x CORE %d Channel = %d Temperature = %d Tx pwr idx at anchor power is %d Starting Power = %d Num of Entries = %d TSSI values: %d Entries exceeded max allowedIncorrect Number of Entries. Expected %d, Entered %d Starting Power = %d Num of Entries = %d TSSI values:CORE%d TSSI PWR %d %d Failed to get stats. Seconds test run %d No of dma completed %d Bytes transfered per dma %d Bus throughput: %d mbps Failed to allocate buffer. %s: could not parse "%s" as an int for max_dma_descriptors failed to trigger measurement %d DISABLEDORANDERRORlogic: %d (%s) low_ms: %d high_ms: %d rx_pkts_threshold: %d tx_pkts_threshold: %d txrx_pkts_threshold: %d rx_bytes_threshold: %d tx_bytes_threshold: %d txrx_bytes_threshold: %d Invalid logic value %u Usage: %s [logic] [ Parameters:logic : 0=disable, 1=OR, 2=AND all non-zero switching thresholds.low_ms : Low pm2_sleep_ret value.high_ms : High pm2_sleep_ret value.rxP : Switching threshold in # of rx packets. eg. Switch from the low to high FRTS value if rxP or more packets are received in a PM2 radio wake period. 0 means ignore this threshold.txP : Switching threshold in # of tx packets.txrxP : Switching threshold in # of combined tx+rx packets.rxB : Switching threshold in # of rx bytes.txB : Switching threshold in # of tx bytes.txrxB : Switching threshold in # of combined tx+rx bytes. %s Invalid argument, Please enter mac address or enter "0" for auto ar selectionToo few argumentsip: %s netmask: %s gw: %s txfifo_szfifo %d size %d ag0ag1Missing ag0antgainMissing ag1wl_antgain: fail to setwl_antgain: fail to get antgainag0=%x ag1=%x required args: virt_addr phy_addr sizeInvaild virtual address: %s Invaild physical Address: %s Invaild size: %s Setting virtual Address 0x%x to physical Address 0x%x, size is %d fail to allocate event_msgsstructure of %d bytes old firmware support only 128 eventssetting only the first 128 eventsInvalid mask %d old firmware support only 128 eventsgetting only the first 128 eventslifetimeLifetime for access class '%s' is %dms error: missing counterror: missing channeluerror: invalid frame type: %s Error: bad parameters "%s" Clear Radar Status Error allocating %d bytes for assoc params wsecwepkeywepkeyInvalid key index %d specified imodemode%s %s: expected argument after "infra" keyword but command line ended. ad-hocmanaged%s %s: unrecongnized parameter "%s" after "infra" keyword amodeauthopensharedopensharedwpanonewpawpapskwpa2wpa2pskftpskwpa2-sha256wpa2psk-sha256-passive%s %s: unable to parse parameter "%s" Using passive assoc scanError allocating %d bytes for extjoin joinFailed to allocate %d-byte buffer for scanresults failed to fetch scan results, err %d scan parsing failed (expect version %d, got %d) --------------------------------Can't fit bssids for all %d APs found Mismatched channel and bssid counts! No matches found, issuing normal join.Passing %d channel/bssid pairs. ie tag:0x%x ie len:0x%x ie data:country ie len is odd(%d), padding by 1 octet Error allocating %d bytes country ie 2g5gbad version (=%d) in return data bad length (=%d) in return data flag:%02x RSSI[%d,%d] delta:%d boost:%d.by.%d nfscan:%d period(full:%ds partial:%ds.x%d.%ds) msglevel0x%x%08xMsg bits >32 take only numerical input in hex Invalid entry for msglevel 0x%x00000000 %sUnsupported parameter [%s] interface_removesmfstatswpa_auth0x%x Disabled%s is not a valid WPA auth mode Inavlid user argument. Values may be a bitvector or list of names from the set. 0x%04x %sSSIDCurrent %s: "%s" SSID arg "%s" must be 32 chars or less Setting %s: "%s" Total IEs %d IE index = %d -----------------Pkt Flg = 0x%x Length = %d OUI = %02x:%02x:%02x Error %d getting IOVar iemissing parameter type %s len %d %s Data: Data bytes should be specified for IE of length %d Please specify all the data bytes for this IE Ignoring data bytes for IE of length %d memory alloc failure Error parsing data arg Invalid length Data bytes should be specified for non-zero length Error allocating %d bytes for IE params hs20_iewl_actframe: unable to allocate frame actframeInvalid packet flag 0x%x (%d) IE length is %d, should be <= %d IE length is %d, should be >= %d Invalid OUI length %d Ignoring data bytes for IE of length %dError parsing OUI arg Failed to allocate buffer of %d bytes Usage: %s [-a|i ] [-h] [-d|u|x] [-w|--wlc ] [arguments] -h this message and command descriptions -h [cmd] command description for cmd -a, -i adapter name or number -d output format signed integer -u output format unsigned integer -x output format hexdecimal -w index of WLC for RSDB only toe_olarp_olNot a valid commandTotal %d host addresses 0XData invalid format. Needs to start with 0xData invalid format. Needs to be of even lengthseq_startcalling seq_start() when it's already in batching modeseq_stopcalling seq_stop when it's already out of batching modeno command batchedfailed to send seq_startseq_listfailed to send seq_listfailed to send seq_stopId :%d Period (msec) :%d Length :%d Packet :0xMCS SET : [ VHT SET : ratesetdefaultBad Args: at least one rate must be marked Basic bg_rate2g_ratebg_mrate2g_mratea_rate5g_ratea_mrate5g_mrateWPA-NONEWPA-802.1xWPA2-802.1x1X-SHA256FTPSK-SHA256disabledETSI_1ETSI_2ETSI_3ETSI_4S2S3UNCLASSIFIEDFCC-5JP1-2/JP2-3JP2-1JP4FCC_1Status_codeReason_codeassocreassocdisassoc_txdisassoc_rxdeauth_txdeauth_rxAC_BEAC_BKAC_VIAC_VOIDLE OPNSNTCNFRCVOPNRCVESTAB HOLDNGRadar Free On ChannelRadar Found On ChannelRadar Scan In ProgressRadar Scan AbortedRSDB Mode switch in Progress For ScanpromiscctrlfcsNo errorPreferred bandDwell Duration too lowChannel prefsInterference too highOnly 1 channel inoputagentsnoophost_auto_replypeer_auto_replytx_csum_olrx_csum_olscanwowlcoexrtdcprotobtachanimwmfp2pitfrmchantdlspstamcnxprottbtttimelpctsomqchanlogp2pownmpcieerrtraceprhdrsprpktinforminfoinftmpoidasprusrpsmodeswportdualwsec_dumplogbcntrimpfnregulatorytafmpcapstadfsmumimomumbsscacamsduampduffpldIDLEPRE-ISM Channel Availability Check(CAC)In-Service Monitoring(ISM)Channel Switching Announcement(CSA)POST-ISM Channel Availability CheckPRE-ISM Ouf Of Channels(OOC)POST-ISM Out Of Channels(OOC)varunrecognized name, type -h for helpget version informationcmdsgenerate a short list of available commandsupreinitialize and mark adapter up (operational)downreset and mark adapter down (disabled)outmark adapter down but do not reset hardware(disabled) On dualband cards, cards must be bandlocked before use.clkset board clock state. return error for set_clk attempt if the driver is not down 0: clock off 1: clock onrebootReboot platformradioSet the radio on or off. "on" or "off"Give suboption "list" to list various suboptionsClears first 'len' bytes of the srom, len in decimal or hex Usage: srclear srdumpprint contents of SPROM to stdoutsrwriteWrite the srom: srwrite byteoffset valueWrite specified to the SDIO/PCIe CIS source (either SROM or OTP) Usage: ciswrite [-p|--pciecis] -p|--pciecis -- Write OTP for PCIe full-donglecisupdateWrite a hex byte stream to specified byte offset to the CIS source (either SROM or OTP) --preview option allows you to review the update without committing it [--preview]Display the content of the SDIO CIS source -b -- also write raw bytes to -- optional count of bytes to display (must be even)Print CIS tuple for given name=value pairRead a named variable to the sromWrite a named variable to the sromprint nvram variables to stdoutset an nvram variable name=value (no spaces around '=')nvgetget the value of an nvram variablerevinfoget hardware revision informationset driver console debugging message bitvector type 'wl msglevel ?' for valuesPMset driver power management mode: 0: CAM (constantly awake) 1: PS (power-save) 2: FAST PS modewakeset driver power-save mode sleep state: 0: core-managed 1: awakeset promiscuous mode ethernet address reception 0 - disable 1 - enablemonitorset monitor mode 0 - disable 1 - enable active monitor mode (interface still operates)fragDeprecated. Use fragthresh.rtsDeprecated. Use rtsthresh.cwminSet the cwmin. (integer [1, 255])cwmaxSet the cwmax. (integer [256, 2047])srlSet the short retry limit. (integer [1, 255])lrlSet the long retry limit. (integer [1, 255])force a fixed rate: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratemrateforce a fixed multicast rate: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateforce a fixed rate for the A PHY: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateforce a fixed multicast rate for the A PHY: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateforce a fixed rate for the B/G PHY: valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateforce a fixed multicast rate for the B/G PHY: valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateForce a fixed rate for data frames in the 2.4G band: Either "auto", or a simple CCK/DSSS/OFDM rate value: 1 2 5.5 11 6 9 12 18 24 36 48 54 Or options to specify legacy, HT, or VHT rate: -r R, --rate=R : legacy rate (CCK, DSSS, OFDM) -h M, --ht=M : HT MCS index [0-23] -v M[xS], --vht=M[xS] : VHT MCS index M [0-9], : and optionally Nss S [1-8], eg. 5x2 is MCS=5, Nss=2 -c cM[sS] : VHT (c notation) MCS index M [0-9], : and optionally Nss S [1-8], eg. c5s2 is MCS=5, Nss=2 -s S, --ss=S : VHT Nss [1-8], number of spatial streams, default 1. : Only used with -v/--vht when MxS format is not used -x T, --exp=T : Tx Expansion, number of tx chains (NTx) beyond the minimum : required for the space-time-streams, exp = NTx - Nsts --stbc : Use STBC expansion, otherwise no STBC -l, --ldpc : Use LDPC encoding, otherwise no LDPC -g, --sgi : SGI, Short Guard Interval, otherwise standard GI -b, --bandwidth : transmit bandwidth MHz; 2.5, 5, 10, 20, 40, 80, 160Force a fixed rate for mulitcast/broadcast data frames in the 2.4G band: Either "auto", or a simple CCK/DSSS/OFDM rate value: 1 2 5.5 11 6 9 12 18 24 36 48 54 Or options to specify legacy, HT, or VHT rate: -r R, --rate=R : legacy rate (CCK, DSSS, OFDM) -h M, --ht=M : HT MCS index [0-23] -v M[xS], --vht=M[xS] : VHT MCS index M [0-9], : and optionally Nss S [1-8], eg. 5x2 is MCS=5, Nss=2 -c cM[sS] : VHT (c notation) MCS index M [0-9], : and optionally Nss S [1-8], eg. c5s2 is MCS=5, Nss=2 -s S, --ss=S : VHT Nss [1-8], number of spatial streams, default 1. : Only used with -v/--vht when MxS format is not used -x T, --exp=T : Tx Expansion, number of tx chains (NTx) beyond the minimum : required for the space-time-streams, exp = NTx - Nsts --stbc : Use STBC expansion, otherwise no STBC -l, --ldpc : Use LDPC encoding, otherwise no LDPC -g, --sgi : SGI, Short Guard Interval, otherwise standard GI -b, --bandwidth : transmit bandwidth MHz; 2.5, 5, 10, 20, 40, 80, 160Force a fixed rate for data frames in the 5G band: Either "auto", or a simple OFDM rate value: 6 9 12 18 24 36 48 54 Or options to specify legacy OFDM, HT, or VHT rate: -r R, --rate=R : legacy OFDM rate -h M, --ht=M : HT MCS index [0-23] -v M[xS], --vht=M[xS] : VHT MCS index M [0-9], : and optionally Nss S [1-8], eg. 5x2 is MCS=5, Nss=2 -c cM[sS] : VHT (c notation) MCS index M [0-9], : and optionally Nss S [1-8], eg. c5s2 is MCS=5, Nss=2 -s S, --ss=S : VHT Nss [1-8], number of spatial streams, default 1. : Only used with -v/--vht when MxS format is not used -x T, --exp=T : Tx Expansion, number of tx chains (NTx) beyond the minimum : required for the space-time-streams, exp = NTx - Nsts --stbc : Use STBC expansion, otherwise no STBC -l, --ldpc : Use LDPC encoding, otherwise no LDPC -g, --sgi : SGI, Short Guard Interval, otherwise standard GI -b, --bandwidth : transmit bandwidth MHz; 2.5, 5, 10, 20, 40, 80, 160Force a fixed rate for mulitcast/broadcast data frames in the 5G band: Either "auto", or a simple OFDM rate value: 6 9 12 18 24 36 48 54 Or options to specify legacy OFDM, HT, or VHT rate: -r R, --rate=R : legacy OFDM rate -h M, --ht=M : HT MCS index [0-23] -v M[xS], --vht=M[xS] : VHT MCS index M [0-9], : and optionally Nss S [1-8], eg. 5x2 is MCS=5, Nss=2 -c cM[sS] : VHT (c notation) MCS index M [0-9], : and optionally Nss S [1-8], eg. c5s2 is MCS=5, Nss=2 -s S, --ss=S : VHT Nss [1-8], number of spatial streams, default 1. : Only used with -v/--vht when MxS format is not used -x T, --exp=T : Tx Expansion, number of tx chains (NTx) beyond the minimum : required for the space-time-streams, exp = NTx - Nsts --stbc : Use STBC expansion, otherwise no STBC -l, --ldpc : Use LDPC encoding, otherwise no LDPC -g, --sgi : SGI, Short Guard Interval, otherwise standard GI -b, --bandwidth : transmit bandwidth MHz; 2.5, 5, 10, 20, 40, 80, 160Set Infrastructure mode: 0 (IBSS) or 1 (Infra BSS)Set or get the BSS ID value (mac address, e.g. 00:11:20:11:33:33, colons optional)bssmaxget number of BSSes channelSet the channel: valid channels for 802.11b/g (2.4GHz band) are 1 through 14 valid channels for 802.11a (5 GHz band) are: 36, 40, 44, 48, 52, 56, 60, 64, 100, 104, 108, 112, 116,120, 124, 128, 132, 136, 140, 144, 149, 153, 157, 161, 184, 188, 192, 196, 200, 204, 208, 212, 216clmverGet version information for CLM data and toolsroam_channels_in_cacheGet a list of channels in roam cacheroam_channels_in_hotlistGet a list of channels in roam hot channel listGet all the valid chanspecs (default: all within current locale): -b band (5(a) or 2(b/g)) -w bandwidth, 20, 40 or 80 [-c country_abbrev]Get default chanspecs for current driver settings (default: all within current locale)Set current or configured channel: 20MHz : [2g|5g][/20] 40MHz : [2g|5g]/40[u,l] 80MHz : [5g]/80 optional band 2g or 5g, default to 2g if channel <= 14 channel number (0-200) bandwidth, 2.5, 5, 10, 20, 40, or 80, default 20 primary sideband for 40MHz on 2g, l=lower, u=upper OR Set channel with legacy format: -c channel number (0-224) -b band (5(a) or 2(b/g)) -w bandwidth 20 or 40 -s ctl sideband, -1=lower, 0=none, 1=uppersc_chanrclassGet operation class: chanspec dfs_channel_forcedSet [a,b][n][u,l] channel number (0-224) band a=5G, b=2G, default to 2G if channel <= 14 bandwidth, n=10, non for 20 & 40 ctl sideband, l=lower, u=upper Set channel list using -l option wl dfs_channel_forced {-l | 0} 20MHz : [/20] 40MHz : {{l|u}|/40} 80MHz : /80 Channels specified using '-l' option should be seperated by ','/' ' and should be prefixed with '+'/'-' Deletes existing configuration when '0' specifiedtxpwrSet tx power in milliwatts. Range [1, 84].txpwr1Set tx power in in various units. Choose one of (default: dBm): -d dBm units (range: -32 - 31) -q quarter dBm units (range: -128 - 127) -m milliwatt units Can be combined with: -o turn on override to disable regulatory and other limitations Use wl txpwr -1 to restore defaultstxpwrlimitReturn current tx power limitucflagsGet/Set ucode flags 1, 2, 3(16 bits each) offset [ value ] [ band ]shmemGet/Set a shared memory location: offset [ value ] [band ]macregGet/Set any mac registers(include IHR and SB): macreg offset size[2,4] [ value ] [ band ]shmemxGet/Set a shared memory location of PSMX: offset [ value ] [band ]Get/Set any mac registers(include IHR and SB) of PSMX: macreg offset size[2,4] [ value ] [ band ]ucantdivEnable/disable ucode antenna diversity (1/0 or on/off)helpList commands by categoryiovGet information on driver IOVARsiovarsshownetworksPretty-print the BSSID listloopenable mac-level or mii-level loopbackpiomodeGet/Set piomodeshmem_dumpDeprecated. Folded under 'wl dump shmem'pcieregdumpDeprecated.Folded under 'wl dump pcieregs'gpiodumpDeprecated. Folded under 'wl dump gpio'tsf_dumpDeprecated. Folded under 'wl dump tsf'ampdu_dumpDeprecated. Folded under 'wl dump ampdu'amsdu_dumpDeprecated. Folded under 'wl dump amsdu'amsdu_clear_countersclear amsdu countersfixrateget/set the fixrate per scb/ac: To get: wl fixrate xx:xx:xx:xx:xx:xx (the remote mac addr). To set: wl fixrate xx:xx:xx:xx:xx:xx , where = -1 means for all ACs, and is the index to the rate set, -1 means auto.ratedumpPrint driver rate selection tunables and per-scb state to stdout based on remote station mac address[xx:xx:xx:xx:xx:xx]bpind [value] MSB bit in high addr has to be set to access host addr sample: wl bpind 0x80000000 0x0001e040 n_bwget/set mimo channel bandwidth (10=10MHz, 20=20Mhz, 40=40Mhz), will cause phy to resetmimo_ofdmget/set stf mode for legacy ofdm frame (0=SISO, 1=CDD)hwkeysDump all keys in h/wSend a Vendor specific Action frame to a channel usage: wl actframe channel dwell-time antdivSet antenna diversity for rx 0 - force use of antenna 0 1 - force use of antenna 1 3 - automatic selection of antenna diversitytxantSet the transmit antenna 0 - force use of antenna 0 1 - force use of antenna 1 3 - use the RX antenna selection that was in force during the most recently received good PLCP headerplcphdrSet the plcp header. "long" or "auto" or "debug"phytypeGet phy typerateparamset driver rate selection tunables arg 1: tunable id arg 2: tunable valuewsec_restrictDrop unencrypted packets if WSEC is enabled 0 - disable 1 - enableeaprestrict traffic to 802.1X packets until 802.1X authorization succeeds 0 - disable 1 - enablecur_etheraddrGet/set the current hw addressperm_etheraddrGet the permanent address from NVRAMauthorizerestrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthorizedo not restrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthenticatedeauthenticate a STA from the AP with optional reason code (AP ONLY)wireless security bit vector 1 - WEP enabled 2 - TKIP enabled 4 - AES enabled 8 - WSEC in software 0x80 - FIPS enabled 0x100 - WAPI enabledset/get 802.11 authentication type. 0 = OpenSystem, 1= SharedKey, 3=Open/SharedBitvector of WPA authorization modes: 1 WPA-NONE 2 WPA-802.1X/WPA-Professional 4 WPA-PSK/WPA-Personal 64 WPA2-802.1X/WPA2-Professional 128 WPA2-PSK/WPA2-Personal 0 disable WPAwpa_capset/get 802.11i RSN capabilitiesset_pmkSet passphrase for PMK in driver-resident supplicant.Send a probe request. -s S, --ssid=S SSIDs to scan -b MAC, --bssid=MAC particular BSSID MAC address, xx:xx:xx:xx:xx:xx -d MAC, --da=MAC Destnation Addresssend the ethernet frame provided in hexInitiate a scan. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanset/get roam scan parameters Use standard scan params syntax below,but only active/passive/home times, nprobes, type,and channels are used. All other values are silently discarded. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanroam_profget/set roaming profiles (need to specify band) Usage: wl roam_prof_2g a|b|2g|5g flags rssi_upper rssi_lower delta, boost_thresh boot_delta nfscan fullperiod initperiod backoff maxperiod Initiate an incremental scan. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanContinue an incremental scan. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanStart an escan. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanAbort an escan. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanGet/Set regulatory domain mode (802.11d). Driver must be down.spectGet/Set 802.11h Spectrum Management mode. 0 - Off 1 - Loose interpretation of 11h spec - may join non-11h APs 2 - Strict interpretation of 11h spec - may not join non-11h APs 3 - Disable 11h and enable 11d 4 - Loose interpretation of 11h+d spec - may join non-11h APsscanabortAbort a scan.scanresultsReturn results from last scan.Return results from last iscan. Specify a buflen (max 8188) to artificially limit the size of the results buffer. iscanresults [buflen]Print information about current network association. (also known as "status")statusPrint information about current network association. (also known as "assoc")disassocDisassociate from the current BSS/IBSS.chanlistDeprecated. Use channels.channelsReturn valid channels for the current settings.channels_in_countryReturn valid channels for the country specified. Arg 1 is the country abbreviation Arg 2 is the band(a or b)curpowerReturn current tx power settings. -v, --verbose: display the power settings for every rate even when every rate in a rate group has the same power.txpwr_target_maxReturn current max tx target power settings. chanspec_txpwr_maxReturn valid chanspecs with max tx power settings. -b band (5(a) or 2(b/g)) -w bandwidth, 20, 40, 80, 160 or 8080 Returns or sets the supported and basic rateset, (b) indicates basic With no args, returns the rateset. Args are rateset "default" | "all" | [-m|-v ] default - driver defaults all - all rates are basic rates arbitrary rateset - list of rates List of rates are in Mbps and each rate is optionally followed by "(b)" or "b" for a Basic rate. Example: 1(b) 2b 5.5 11 At least one rate must be Basic for a legal rateset. -m sets HT rates (bitmasks, 00-ff). Least significant bit is MCS0. example: 'rateset -m 0x3f 0x01' limits rates to MCS0-MCS5 and MCS8 -v sets VHT MCS values for each supported count of spatial streams. example: 'rateset -v 3ff 1ff ff' limits vht rates to MCS 0-9 for 1 stream, MCS 0-8 for 2 streams, and MCS 0-7 for 3 streams.txbf_ratesetGet rateset consisting of OFDM, HT and VHT rates, and Broadcom-to-Broadcom group of OFDM, HT and VHT rates by issuing command with no arguments. OFDM rates printed are in Mbps, and each Basic rate in OFDM list is marked by (b) behind it. Example: full list of OFDM rates: 6(b) 9 12(b) 18 24(b) 36 48 54 where 6, 12 and 24 are Basic rates. Set synopsis: wl txbf_rateset < [ofdm_rate_list] [options ...] > OFDM rate specification does not need to mark Basic rates because Basic rates are automatically recognized. Options are processed in order; thus redundant instances of an option will result in only the last instance taking effect for that option. Options: -m ... Set HT rates by bitmask bytes, each ranges from 00 through ff, where the least significant bit is MCS0. Example: '-m 3f 01' specifies HT rates MCS0 - MCS5 and MCS8. -v ... Set VHT rates for each supported count of spatial streams. Example: '-v 3ff 1ff ff' specifies VHT rates: MCS0 - MCS9 for 1 stream, MCS0 - MCS8 for 2 streams, and MCS0 - MCS7 for 3 streams. -b Set for Broadcom-to-Broadcom group of rates. Otherwise without the -b option, the standard group of rates are set accordingly. Returns supported rateset of given phy. You have to insert following Args Arg 1. Phy Type: have to be one of the following: [a, b, g, n, lp, ssn, ht, lcn, lcn40, ac] Arg 2. Band Type: 2 for 2.4G or 5 for 5G Arg 3. CCK Only: 1 for CCK Only or 0 for CCK and OFDM rates Arg 4. Basic Rates: 1 for all rates WITH basic rates or 0 for all rates WITHOUT basic rates Arg 5. MCS Rates: 1 for all rates WITH MCS rates or 0 for all rates WITHOUT MCS rates Arg 6. Bandwidth: have to be one of the following: [10, 20, 40, 80, 160] Arg 7. TX/RX Stream: "tx" for TX streams or "rx" for RX streams Example: PHY: AC, Band 2.4G, CCK rates only, With Basec rates, WithOut MCS rates, BW: 40 and TX streams Input: default_rateset ac 2 0 1 0 40 tx roam_triggerGet or Set the roam trigger RSSI threshold: Get: roam_trigger [a|b] Set: roam_trigger [a|b|all] integer - 0: default 1: optimize bandwidth 2: optimize distance [-1, -99]: dBm trigger valueroam_deltaSet the roam candidate qualification delta. roam_delta [integer [, a/b]]roam_scan_periodSet the roam candidate qualification delta. (integer)supratesReturns or sets the 11g override for the supported rateset With no args, returns the rateset. Args are a list of rates, or 0 or -1 to specify an empty rateset to clear the override. List of rates are in Mbps, example: 1 2 5.5 11prb_resp_timeoutGet/Set probe response timeoutchannel_qaGet last channel quality measurmentchannel_qa_startStart a channel quality measurmentSelect Country Code for driver operational region For simple country setting: wl country Where is either a long name or country code from ISO 3166; for example "Germany" or "DE" For a specific built-in country definition: wl country [] Where is a country country code followed by '/' and regulatory revision number. For example, "US/3". And where is either a long name or country code from ISO 3166. If is omitted, it will be the same as the built-in country code. Use 'wl country list [band(a or b)]' for the list of supported countriescountry_ie_overrideTo set/get country ieautocountry_defaultSelect Country Code for use with Auto Contry DiscoveryJoin a specified network SSID. Usage: join [key <0-3>:xxxxx] [imode bss|ibss|mesh] [amode open|shared|openshared|wpa|wpapsk|wpa2|wpa2psk|wpanone|ftpsk] [options] Options: -b MAC, --bssid=MAC BSSID (xx:xx:xx:xx:xx:xx) to scan and join -c CL, --chanspecs=CL chanspecs (comma or space separated list) prescanned uses channel and bssid list from scanresults -p, -passive: force passive assoc scan (useful for P2P)Set or get a configuration's SSID. wl ssid [-C num]|[--cfg=num] [] If the configuration index 'num' is not given, configuraion #0 is assumed and setting will initiate an assoication attempt if in infrastructure mode, or join/creation of an IBSS if in IBSS mode, or creation of a BSS if in AP mode.macSet or get the list of source MAC address matches. wl mac xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...] To Clear the list: wl mac nonemacmodeSet the mode of the MAC list. 0 - Disable MAC address matching. 1 - Deny association to stations on the MAC list. 2 - Allow association to stations on the MAC list.bandReturns or sets the current band auto - auto switch between available bands (default) a - force use of 802.11a band b - force use of 802.11b bandbandsReturn the list of available 802.11 bandsphylistReturn the list of available phytypesshortslotGet current 11g Short Slot Timing mode. (0=long, 1=short)shortslot_overrideGet/Set 11g Short Slot Timing mode override. (-1=auto, 0=long, 1=short)pktcntGet the summary of good and bad packets.upgradeUpgrade the firmware on an embedded devicegmodeSet the 54g Mode (LegacyB|Auto||GOnly|BDeferred|Performance|LRS)gmode_protectionGet G protection mode. (0=disabled, 1=enabled)gmode_protection_controlGet/Set 11g protection mode control alg.(0=always off, 1=monitor local association, 2=monitor overlapping BSS)gmode_protection_overrideGet/Set 11g protection mode override. (-1=auto, 0=disable, 1=enable)protection_controlGet/Set protection mode control alg.(0=always off, 1=monitor local association, 2=monitor overlapping BSS)legacy_erpGet/Set 11g legacy ERP inclusion (0=disable, 1=enable)isupGet driver operational state (0=down, 1=up)rssiGet the current RSSI val, for an AP you must specify the mac addr of the STAfasttimerDeprecated. Use fast_timer.slowtimerDeprecated. Use slow_timer.glacialtimerDeprecated. Use glacial_timer.dfs_statusGet dfs statusdfs_status_allGet dfs status of multiple cores or parallel radar scansradar_statusGet radar detection statusclear_radar_statusClear radar detection statuspwr_percentGet/Set power output percentagetoeEnable/Disable tcpip offload featurearpoeEnable/Disable arp agent offload featurewetGet/Set wireless ethernet bridging modebiGet/Set the beacon period (bi=beacon interval)dtimGet/Set DTIMmeasure_reqSend an 802.11h measurement request. Usage: wl measure_req Measurement types are: TPC, Basic, CCA, RPI Target MAC addr format is xx:xx:xx:xx:xx:xxquietSend an 802.11h quiet command. Usage: wl quiet , , pm_mute_txSets parameters for power save mode with muted transmission path. Usage: wl pm_mute_tx 1 : attempts to enable mode as soon as timer of (milliseconds) expires. wl pm_mute_tx 0 : disables mode csaSend an 802.11h channel switch anouncement with chanspec: [a,b][n][u,l][frame type] mode (0 or 1) count (0-254) channel format: 20MHz : [2g|5g][/20] 40MHz : [2g|5g]/40[u,l] 80MHz : [5g]/80 optional band 2g or 5g, default to 2g if channel <= 14 channel number (0-200) bandwidth, 20, 40, or 80, default 20 primary sideband for 40MHz on 2g, l=lower, u=upper csa frame type(optional), default is broadcast if not specified, u=unicastconstraintSend an 802.11h Power Constraint IE Usage: wl constraint 1-255 dbRequest a radio measurement of type basic, cca, or rpi specify a series of measurement types each followed by options. example: wl rm_req cca -c 1 -d 50 cca -c 6 cca -c 11 Options: -t n numeric token id for measurement set or measurement -c n channel -d n duration in TUs (1024 us) -p parallel flag, measurement starts at the same time as previous Each measurement specified uses the same channel and duration as the previous unless a new channel or duration is specified.Get current radio measurement reportSet/Get join target preferences.assoc_prefSet/Get association preference. Usage: wl assoc_pref [auto|a|b|g]wmeSet WME (Wireless Multimedia Extensions) mode (0=off, 1=on, -1=auto)wme_acwl wme_ac ap|sta [be|bk|vi|vo [ecwmax|ecwmin|txop|aifsn|acm ] ...]wme_apsdSet APSD (Automatic Power Save Delivery) mode on AP (0=off, 1=on)wme_apsd_staSet APSD parameters on STA. Driver must be down. Usage: wl wme_apsd_sta : number of frames per USP: 0 (all), 2, 4, or 6 : value 0 to disable, 1 to enable U-APSD per ACSet AC queue discard policy. Usage: wl wme_dp : value 0 for newest-first, 1 for oldest-firstwme_countersprint WMM statswme_clear_countersclear WMM counterswl wme_tx_params [be|bk|vi|vo [short|sfb|long|lfb|max_rate ] ...]wl wme_maxbw_params [be|bk|vi|vo ....]Set Lifetime parameter (milliseconds) for each ac. wl lifetime be|bk|vi|vo []reinitReinitialize devicesta_infowl sta_info staprioSet/Get sta priority Usage: wl staprio : 0~3pktq_statsDumps packet queue log info for [C] common, [A] AMPDU, [N] NAR or [P] power save queues A:, N: or P: are used to prefix a MAC address (a colon : separator is necessary), or else C: is used alone. The '+' option after the colon gives more details. Up to 4 parameters may be given, the common queue is default when no parameters are supplied Use '/' as suffix to restrict to certain prec indices; multiple ///...can be used Also, '//' as a suffix to the MAC address or 'C://' will enable automatic logging of all prec as they are seen. Full automatic operation is also possible with the shorthand 'A:' (or 'A://'), 'P:' (or 'P://') etc which scans through all known addresses for those parameters that take a MAC address. wl pktq_stats [C:[+]]|[A:[+]|P:[+]|N:[+]][/[/]][//]...bs_dataDisplay per station band steering data usage: bs_data [options] options are: -comma Use commas to separate values rather than blanks. -tab Use to separate values rather than blanks. -raw Display raw values as received from driver. -noidle Do not display idle stations -noreset Do not reset counters after readingdriver capabilitiesmalloc_dumpDeprecated. Folded under 'wl dump mallocchan_infochannel infoadd_ieAdd a vendor proprietary IE to 802.11 management packets Usage: wl add_ie length OUI hexdata : Bit 0 - Beacons Bit 1 - Probe Rsp Bit 2 - Assoc/Reassoc Rsp Bit 3 - Auth Rsp Bit 4 - Probe Req Bit 5 - Assoc/Reassoc Req Example: wl add_ie 3 10 00:90:4C 0101050c121a03 to add this IE to beacons and probe responsesdel_ieDelete a vendor proprietary IE from 802.11 management packets Usage: wl del_ie length OUI hexdata : Bit 0 - Beacons Bit 1 - Probe Rsp Bit 2 - Assoc/Reassoc Rsp Bit 3 - Auth Rsp Bit 4 - Probe Req Bit 5 - Assoc/Reassoc Req Example: wl del_ie 3 10 00:90:4C 0101050c121a03list_ieDump the list of vendor proprietary IEsrandGet a 2-byte Random Number from the MAC's PRNG Usage: wl randbcmerrorstrerrorstringfreqtrackSet Frequency Tracking Mode (0=Auto, 1=On, 2=OFF)eventingset/get hex filter bitmask for MAC event reporting up to application layerevent_msgs_extset/get bit arbitrary size hex filter bitmask for MACset/get hex filter bitmask for MAC event reporting via packet indicationscountersReturn driver counter valueswlc_verreturns wlc interface versiondelta_stats_intervalset/get the delta statistics interval in seconds (0 to disable)delta_statsget the delta statistics for the last intervalassoc_infoReturns the assoc req and resp information [STA only]autochannelauto channel selection: 1 to issue a channel scanning; 2 to set chanspec based on the channel scan result; without argument to only show the chanspec selected; ssid must set to null before this process, RF must be upcsscantimerauto channel scan timer in minutes (0 to disable)closedhides the network from active scans, 0 or 1. 0 is open, 1 is hidepmkid_infoReturns the pmkid tableprobresp_mac_filterSet/Get MAC filter based Probe response mode. 0 - Disable MAC filter based Probe response mode. 1 - Enable MAC filter based Probe response mode. No parameter - Returns the current setting.eap_restrictset/get EAP restrictionreset_d11cntsreset 802.11 MIB countersstanameget/set station name: Maximum name length is 15 bytesapnameget AP nameoverlayoverlay virt_addr phy_addr sizeSet temp ag0/1 value usage: wl antgain ag0=0x1 ag1=0x2phy_antselget/set antenna configuration set: -1(AUTO), 0xAB(fixed antenna selection) where A and B is the antenna numbers used for RF chain 1 and 0 respectively query: [AUTO] [AUTO] [AUTO] [AUTO] where utx = TX unicast antenna configuration urx = RX unicast antenna configuration dtx = TX default (non-unicast) antenna configuration drx = RX default (non-unicast) antenna configuration advanced paramaters to set: where utx = TX unicast antenna configuration -1 = AUTO urx = RX unicast antenna configuration, -1 = AUTO dtx = TX default (non-unicast) antenna configuration, -1 = AUTO drx = RX default (non-unicast) antenna configuration, -1 = AUTOset/get the txfifo size; usage: wl txfifo_sz escan_event_checkListen and prints the escan events from the dongle escan_event_check syntax is: escan_event_check ifname flag flag 1 = sync_id info, 2 = bss info, 4 = state + bss info [default], 8 = TLV check for IEsescanresultsStart escan and display results. Default to an active scan across all channels for any SSID. Optional arg: SSIDs, list of [up to 10] SSIDs to scan (comma or space separated). Options: -s S, --ssid=S SSIDs to scan -t ST, --scan_type=ST [active|passive|prohibit|offchan|hotspot] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --chanspecs=L comma or space separated list of chanspecs to scanset hotspot 2.0 indication IE usage: wl hs20_ie rate_histoGet rate hostrogramauth_rekey_initinit/de-init group key rekey(for send_wpa_m1 cmd) Must be enabled before connection for sendingwpa_m1send a WPA M1 to mac address Usage: wl wpa_m1 xx:xx:xx:xx:xx:xx ptk: Send a WPA PTK M1 gtk: Send a WPA GTK M1 gtk_bad: Send a invalid WPA GTK M1wme_apsd_triggerSet Periodic APSD Trigger Frame Timer timeout in ms (0=off)wme_autotriggerEnable/Disable sending of APSD Trigger frame when all ac are delivery enabledInitiate a (re)association request. Usage: wl reassoc [options] Options: -c CL, --chanspecs=CL chanspecs (comma or space separated list)send_nulldataSed a null frame to the specified hw addresssrchmemg/set ucode srch engine memoryDownload CLM data into a driver. Driver must be down. Usage: wl clmload Note obsolete syntax 'wl clmload 0/1 ' is still accepted but the download type 0/1 is no longer applicable and is ignored. Incremental CLM download is no longer supported. Also reverting to the original built-in CLM is no longer supported. (This syntax was 'wl clmload 0/1')Download CAL data into a driver. Driver must be down. Usage: wl calload to download existing calibration data file Dump calibration data and save it with calibration storage format. Usage: wl caldump to dump current calibration info to file bmac_rebootReboot BMACfindserverUsed to find the remote server with proper mac address given by the user,this cmd is specific to wifi protocol.assertlogget external assert logs Usage: wl assertlogassert_typeset/get the asset_bypass flag; usage: wl assert_type <1/0> (On/Off)cca_get_statsUsage: wl cca_stats [-c channel] [-s num seconds][-n] -c channel: Optional. specify channel. 0 = All channels. Default = current channel -n: no analysis of results -s num_seconds: Optional. Default = 10, Max = 60 -i: list individual measurements in addition to the averages -curband: Only recommend channels on current bandget/clear selected management frame (smf) stats wl smfstats [-C num]|[--cfg=num] [auth]|[assoc]|[reassoc]|[clear] clear - to clear the statsdonglesetEnable uart drivermanfinfoshow chip package info in OTPpm_durRetrieve accumulated PM duration information (GET only) mpc_durRetrieve accumulated MPC duration information in ms (GET) or clear accumulator (SET) Usage: wl mpc_dur txdelay_paramsget chanim stats Usage: wl txdelay_params ratio cnt period tunedlystatsdump delay statistics Usage: wl dlystats [xx:xx:xx:xx:xx:xx] (optional mac address) If mac_addr is not specified, dump all of scbsdlystats_clearclear delay stats Usage: wl dlystats_clearintfer_paramsset/get intfer params Usage: wl intfer_params period (in sec) cnt(0~4) txfail_thresh tcptxfail_thresh period=0: disable Driver monitor txfaildngl_wdenable or disable dongle keep alive watchdog timer Usage: wl dngl_wd 0\1 (to turn off\on)set/get tsf register Usage: wl tsf [ ]Usage: wl mac_rate_histo (MAC address e.g. 00:11:20:11:33:33) (Access Category(AC) - 0x10:for entire MAC or 0x4:for video AC for this MAC) (num_pkts (optional) - Number of packets to average - max 64 for AC 0x10, max 32 for AC 0x4)rwl_downloadrwl_download rwl_download transfer firmware and nvram via remote interface init Initialize the chip. Currently only 4325, 4329, 43291, 4330a1 and 4330 (b1) are supporteddownload download file to dongle ram and start CPU vars file will replace vars parsed from the CISuploadupload upload the entire memory and save it to the filerpmtrpmt set/get IE Usage: For set: wl ie type length hexdata For get: wl ie typemempoolGet memory pool statisticssr_enable Get/Set SaveRestore functionalitysr_dump_pmuDump value of PMU registerssr_pmu_keep_onKeep resource onsr_power_islandKeep power islands on/off. Usage: For get:wl sr_power_island For set:wl sr_power_island 0x???? where ?-> 0 power_island off ?-> 1 power_island on eg: wl sr_power_island 0x1101nwoe_ifconfigConfigure the network offload interface, or display current settings Usage: wl nwoe_ifconfig [ ] antdiv_bcnloss0 - Disable Rx antenna flip feature based on consecutive beacon loss X - beacon loss count after which Rx ant will be flipped Usage: wl antdiv_bcnloss lpc_paramsSet/Get Link Power Control params Usage: wl powersel_params nar_clear_dumpClear non-aggregated regulation counterssar_limitSet/Get sar_limit usage: (set) sar_limit <2Gcore0 2Gcore1 2Gcore2 2Gcore3 5G[0]core0 5G[0]core1...> (get) sar_limit, return sar limit table unit: all input/output values are absolute and in unit of qdbm bmon_bssidSet monitored BSSID usage: bmon_bssid xx:xx:xx:xx:xx:xx 0|1 Initialize an event log set Usage: wl event_log_set_init Increase the size of an event log set Usage: wl event_log_set_expand Decrease the size of an event log set Usage: wl event_log_set_expand Modify the state of an event log tag Usage: wl event_log_tag_control rmc_arSet active receiver to the one that matches the provided mac address If there is no match among current RMC receivers, it will return fail If mac address is set to all 0 (00:00:00:00:00:00), auto selection mode is enabled and the transmitter will choose the active receiver automatically by RSSI usage: wl rmc_ar [mac address] Get the device mac that is set to be the active receiver for this transmitter usage: wl rmc_ar pm2_sleep_ret_extGet/Set Dynamic Fast Return To Sleep paramssta_monitorwl sta_monitor [ ]Set a bitmap of different MAC promiscuous level of monitor mode. Usage: wl monitor_promisc_level [ | <+|-name>] bitmap values and corresponding name are the following: Args: bit:0:promisc: When set, address filter accepts all received frames.When cleared, the address filter accepts only those frames that match the BSSID or local MAC address bit:1:ctrl: When set, the RX filter accepts all received control frames that are accepted by the address filter. When cleared, the RX filter rejects all control frames other than PS poll frames. bit:3:fcs: When set, the RX filter forwards received frames with FCS errors to the driver.When cleared, frames with FCS errors are discarded. Example: wl monitor_promisc_level +promisc Example: wl monitor_promisc_level 0x2 Example: wl monitor_promisc_level 0wl taf [ []] wl taf [coeff []|dump|list] wl taf enable [0|1]|order [0|1]|bypass [0|1]|high []|low []|force []|listaibss_bcn_force_configGet/Set AIBSS beacon force configuration wl aibss_bcn_force_config Usage: wl bcnlenhist [0]bss_peer_infoGet BSS peer info of all the peer's in the indivudual interface If a non-zero MAC address is specified, gets the peer info of the PEER alone Usage: wl bss_peer_info [MAC address]dump_modesw_dyn_bwswUsage : wl dump_modesw_dyn_bwswpwrstatsGet power usage statistics Usage: wl pwrstats [] ...memuseGet memory usage statistics Usage: wl memusedrift_stats_resetReset drift statisticsaibss_txfail_configSet/Get txfail configuration for bcn_timeout, max tx retries and max atim failures Usage: wl aibss_txfail_config [bcn_timeout max_retry max_atim_failure]ibss_route_tblGet/Set ibss route table Usage: wl ibss_route_tbl num_entries [{ip_addr1, mac_addr1}, ...]ip_route_tableGet/Set ip route table Usage: wl ip_route_tbl num_entries [{ip_addr1, mac_addr1}, ...]rsdb_modeSet/Get the RSDB mode. Possible values auto(-1), mimo(0), rsdb(1), 80p80(2)desired_bssidSet or get the desired BSS ID value Usage: wl desired_bssid [BSSID]ht_featuresdisable/enable/force proprietary 11n rates support. Interface must be down.mesh_add_routeSet Mesh route Usage: wl mesh_add_route mesh_del_routeDelete Mesh route Usage: wl mesh_del_route mesh_findFilter Address Usage: wl mesh_find mesh_filterFilter Address Usage: wl mesh_filter mesh_peerpeer or cancel peering with a given mac address OR list present addresses in the list Usage: [1] to add: wl mesh_peer ... [2] to get present list: wl mesh_peer [3] to cancel all the peerings: wl mesh_peer cancel [4] to cancel peering with a particular peer: wl mesh_peer ... list of peered addresses along with all data Usage: wl mesh_peer_status mesh_delfilterDelete Filter Address Usage: wl mesh_delfilter mesh_max_peersSets the maximum number of peerings possible Usage:wl mesh_max_peers Gives the current value of mesh_max_peers(default value = 8) Usage:wl mesh_max_peerssae_passwordSet Sae password Usage: wl sae_password modesw_timecalUsage: wl modesw_timecal 0~1 for disable /enable wl modesw_timecal to get Time statisticsatimSet/Get the current ATIM window sizepcie_bus_tputMeasure the pcie bus througput Usage: wl pcie_bus_tput -n 64 interface_createcreate an AP/STA interface on a WLC instance that receives the IOVAR Usage: wl interface_create ap/sta [MAC-address] MAC-address: xx:xx:xx:xx:xx:xxDeletes the interface on which this command is received Usage: wl interface_remove wl -i interface_remove wl interface_remove -C phy_read_estpwrlutRead EstPwr LUT: wl phy_read_estpwrlut coretxcal_gainsweepstart Gain Sweep for TX Cal: wl txcal_gainsweep [ipg] [len] [nframes] [gidx_start:step:gidx_stop] ipg: inter packet gap in us len: packet length nframes: number of frames; 0 indicates continuous tx test gidx_start: Starting TX gain Index gidx_stop: Stopping TX gain Index step:step size for tx gain index incrementtxcal_gainsweep_measGet TSSI/PWR measurments from last TX Cal Gain Sweep: wl txcal_gainsweep_meas Set PWR measurements for TX Cal Gain Sweep: wl txcal_gainsweep_meas core p0 p1 ... p127txcal_pwr_tssi_tblGet the saved consolidated TSSI/PWR table: wl txcal_pwr_tssi_tbl Generate consolidated TSSI/PWR table from last TX Cal Gain Sweep: wl txcal_pwr_tssi_tbl Ps: Starting Power in 6.3 format N: Number of entries in the table covering the power range (Ps : (Ps+N-1)) Set the cosolidated TSSI/PWR table: wl txcal_pwr_tssi_tbl Ps: Starting Power in 6.3 format N: Number of entries in the table covering the power range (Ps : (Ps+N-1)) Ch: Channel Number Tssi_X: Adjusted TSSI corresponding to Power X Max number of channel data allowed: 32 olpc_anchoridxGet the saved tx power idx and temperature at the olpc anchor power level: wl olpc_anchoridx Set the temperature and tx power idx at the olpc anchor power level: wl olpc_anchoridx olpc anchor power level is specified via nvram paramter or iovar. bcntrim_statsGet Beacon Trim Statistics Usage: wl bcntrim_stats dfs_ap_moveMove the AP interface to dfs channel specified: Default: Get the dfs scan status -1: Abort given AP move request 20MHz : [5g][/20] 40MHz : [5g]/40[u,l] 80MHz : [5g]/80 channel number (36-200) bandwidth, 20, 40, or 80, default 20 primary sideband for 40MHz on 2g, l=lower, u=upper OR Set channel with legacy format: -c channel number (36-224) -w bandwidth 20 or 40 -s ctl sideband, -1=lower, 0=none, 1=upperpmacGet mac obj values such as of SHM and IHR usage: wl pmac -s -n -b -r : a single address, or multiple, upto 16 addresses, in Decimal or Hex = 0 or 2 or 4 : how many to print : 32-bit value -r option is used to specify internal address:vasip_counters_clearclear vasip counterssvmp_memUsage: wl svmp_mem [ ] With 2 params, read svmp memory at offset for len of 16-bit width. With 3rd param, set the same range to the given value mimorsdb80p80disableenableAFGHANISTANAFALBANIAALALGERIADZAMERICAN SAMOAASANDORRAADANGOLAAOANGUILLAAIANTARCTICAAQANTIGUA AND BARBUDAAGARGENTINAARARMENIAAMARUBAAWASCENSION ISLANDACAUSTRALIAAUAUSTRIAATAZERBAIJANAZBAHAMASBSBAHRAINBHBANGLADESHBDBARBADOSBBBELARUSBYBELGIUMBEBELIZEBZBENINBJBERMUDABMBHUTANBTBOLIVIABOBOSNIA AND HERZEGOVINABABOTSWANABWBOUVET ISLANDBVBRAZILBRBRITISH INDIAN OCEAN TERRITORYIOBRUNEI DARUSSALAMBNBULGARIABGBURKINA FASOBFBURUNDIBICAMBODIAKHCAMEROONCMCANADACACAPE VERDECVCAYMAN ISLANDSKYCENTRAL AFRICAN REPUBLICCFCHADTDCHILECLCHINACNCHRISTMAS ISLANDCXCLIPPERTON ISLANDCPCOCOS (KEELING) ISLANDSCCCOLOMBIACOCOMOROSKMCONGOCGCONGO, THE DEMOCRATIC REPUBLIC OF THECDCOOK ISLANDSCKCOSTA RICACRCOTE D'IVOIRECICROATIAHRCUBACUCYPRUSCYCZECH REPUBLICCZDENMARKDKDJIBOUTIDJDOMINICADMDOMINICAN REPUBLICDOECUADORECEGYPTEGEL SALVADORSVEQUATORIAL GUINEAGQERITREAERESTONIAEEETHIOPIAETFALKLAND ISLANDS (MALVINAS)FKFAROE ISLANDSFOFIJIFJFINLANDFIFRANCEFRFRENCH GUIANAGFFRENCH POLYNESIAPFFRENCH SOUTHERN TERRITORIESTFGABONGAGAMBIAGMGEORGIAGEGERMANYDEGHANAGHGIBRALTARGIGREECEGRGREENLANDGLGRENADAGDGUADELOUPEGPGUAMGUGUATEMALAGTGUERNSEYGGGUINEAGNGUINEA-BISSAUGWGUYANAGYHAITIHTHEARD ISLAND AND MCDONALD ISLANDSHMHOLY SEE (VATICAN CITY STATE)VAHONDURASHNHONG KONGHKHUNGARYHUICELANDISINDIAININDONESIAIDIRAN, ISLAMIC REPUBLIC OFIRIRAQIQIRELANDIEISRAELILITALYITJAMAICAJMJAPANJPJERSEYJEJORDANJOKAZAKHSTANKZKENYAKEKIRIBATIKIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKPKOREA, REPUBLIC OFKRKUWAITKWKYRGYZSTANKGLAO PEOPLE'S DEMOCRATIC REPUBLICLALATVIALVLEBANONLBLESOTHOLSLIBERIALRLIBYAN ARAB JAMAHIRIYALYLIECHTENSTEINLILITHUANIALTLUXEMBOURGLUMACAOMOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMKMADAGASCARMGMALAWIMWMALAYSIAMYMALDIVESMVMALIMLMALTAMTMAN, ISLE OFIMMARSHALL ISLANDSMHMARTINIQUEMQMAURITANIAMRMAURITIUSMUMAYOTTEYTMEXICOMXMICRONESIA, FEDERATED STATES OFFMMOLDOVA, REPUBLIC OFMDMONACOMCMONGOLIAMNMONTENEGROMEMONTSERRATMSMOROCCOMAMOZAMBIQUEMZMYANMARMMNAMIBIANANAURUNRNEPALNPNETHERLANDSNLNETHERLANDS ANTILLESANNEW CALEDONIANCNEW ZEALANDNZNICARAGUANINIGERNENIGERIANGNIUENUNORFOLK ISLANDNFNORTHERN MARIANA ISLANDSMPNORWAYNOOMANOMPAKISTANPKPALAUPWPALESTINIAN TERRITORY, OCCUPIEDPSPANAMAPAPAPUA NEW GUINEAPGPARAGUAYPYPERUPEPHILIPPINESPHPITCAIRNPNPOLANDPLPORTUGALPTPUERTO RICOPRQATARQAQ1REUNIONREROMANIARORUSSIAN FEDERATIONRURWANDARWSAINT HELENASHSAINT KITTS AND NEVISKNSAINT LUCIALCSAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESVCSAMOAWSSAN MARINOSMSAO TOME AND PRINCIPESTSAUDI ARABIASASENEGALSNSERBIARSSEYCHELLESSCSIERRA LEONESLSINGAPORESGSLOVAKIASKSLOVENIASISOLOMON ISLANDSSBSOMALIASOSOUTH AFRICAZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSGSSPAINESSRI LANKALKSUDANSDSURINAMESRSVALBARD AND JAN MAYENSJSWAZILANDSWEDENSESWITZERLANDCHSYRIAN ARAB REPUBLICSYTAIWAN, PROVINCE OF CHINATWTAJIKISTANTJTANZANIA, UNITED REPUBLIC OFTZTHAILANDTHTIMOR-LESTE (EAST TIMOR)TLTOGOTGTOKELAUTKTONGATOTRINIDAD AND TOBAGOTTTRISTAN DA CUNHATATUNISIATNTURKEYTRTURKMENISTANTMTURKS AND CAICOS ISLANDSTCTUVALUTVUGANDAUGUKRAINEUAUNITED ARAB EMIRATESAEUNITED KINGDOMGBUNITED STATESUSUNITED STATES MINOR OUTLYING ISLANDSUMURUGUAYUYUZBEKISTANUZVANUATUVUVENEZUELAVEVIET NAMVNVIRGIN ISLANDS, BRITISHVGVIRGIN ISLANDS, U.S.VIWALLIS AND FUTUNAWFWESTERN SAHARAEHYEMENYEYUGOSLAVIAYUZAMBIAZMZIMBABWEZWRADAR CHANNELSRDRALL CHANNELSALLsmanf sproductname2manfid 2prodid8usbmanfid1sromrev2vendid 2devid 2chiprev 2subvendid 2subdevid2boardrev2pa0b0 2pa0b1 2pa0b2 1pa0itssit 1pa0maxpwr 1opo1aa2g 1aa5g1aa0 1aa11ag0 1ag1 1ag2 1ag34boardflags 4boardflags2 4boardflags3 4boardflags4 4boardflags5 1ledbh0 1ledbh1 1ledbh2 1ledbh3 1ledbh4 1ledbh5 1ledbh6 1ledbh7 1ledbh8 1ledbh9 1ledbh10 1ledbh11 1ledbh12 1ledbh13 1ledbh14 1ledbh152ccode 1cctl2cckpo4ofdmpo2pa1b0 2pa1b1 2pa1b2 2pa1lob0 2pa1lob1 2pa1lob2 2pa1hib0 2pa1hib1 2pa1hib2 1pa1itssit 1pa1maxpwr 1pa1lomaxpwr 1pa1himaxpwr2rdlid0rssismf2g 0rssismc2g 0rssisav2g 0bxa2g0rssismf5g 0rssismc5g 0rssisav5g 0bxa5g4xtalfreq1tri2g1tri5gl 1tri5g 1tri5gh1rxpo2g1rxpo5g2boardnum6macaddr2rdlsn2boardtype2leddc1rdlndis1txchain 1rxchain 2antswitch1regrev0antswctl2g 0triso2g 0pdetrange2g 0extpagain2g 0tssipos2g 0antswctl5g 0triso5g 0pdetrange5g 0extpagain5g 0tssipos5g1maxp2ga0 1itt2ga0 2pa2gw0a0 2pa2gw1a0 2pa2gw2a0 1maxp5ga0 1itt5ga0 1maxp5gha0 1maxp5gla0 2pa5gw0a0 2pa5gw1a0 2pa5gw2a0 2pa5glw0a0 2pa5glw1a0 2pa5glw2a0 2pa5ghw0a0 2pa5ghw1a0 2pa5ghw2a01maxp2ga1 1itt2ga1 2pa2gw0a1 2pa2gw1a1 2pa2gw2a1 1maxp5ga1 1itt5ga1 1maxp5gha1 1maxp5gla1 2pa5gw0a1 2pa5gw1a1 2pa5gw2a1 2pa5glw0a1 2pa5glw1a1 2pa5glw2a1 2pa5ghw0a1 2pa5ghw1a1 2pa5ghw2a12cck2gpo 4ofdm2gpo 4ofdm5gpo 4ofdm5glpo 4ofdm5ghpo2mcs2gpo0 2mcs2gpo1 2mcs2gpo2 2mcs2gpo3 2mcs2gpo4 2mcs2gpo5 2mcs2gpo6 2mcs2gpo72mcs5gpo0 2mcs5gpo1 2mcs5gpo2 2mcs5gpo3 2mcs5gpo4 2mcs5gpo5 2mcs5gpo6 2mcs5gpo72mcs5glpo0 2mcs5glpo1 2mcs5glpo2 2mcs5glpo3 2mcs5glpo4 2mcs5glpo5 2mcs5glpo6 2mcs5glpo7 2mcs5ghpo0 2mcs5ghpo1 2mcs5ghpo2 2mcs5ghpo3 2mcs5ghpo4 2mcs5ghpo5 2mcs5ghpo6 2mcs5ghpo71cckdigfilttype2cddpo2stbcpo2bw40po2bwduppo1rdlrwu1wpsgpio 1wpsled1usbfs1elna2g1elna5g4customvar14ofdm5gpo 4ofdm5glpo 4ofdm5ghpo2usbepnum2cckbw202gpo 2cckbw20ul2gpo 2cckbw20in802gpo4legofdmbw202gpo 4legofdmbw20ul2gpo4legofdmbw205glpo 4legofdmbw20ul5glpo 4legofdmbw205gmpo 4legofdmbw20ul5gmpo 4legofdmbw205ghpo 4legofdmbw20ul5ghpo4mcsbw202gpo 4mcsbw20ul2gpo 4mcsbw402gpo 4mcsbw802gpo4mcsbw205glpo 4mcsbw20ul5glpo 4mcsbw405glpo4mcsbw205gmpo 4mcsbw20ul5gmpo 4mcsbw405gmpo4mcsbw205ghpo 4mcsbw20ul5ghpo 4mcsbw405ghpo2mcs32po2legofdm40duppo1tempthresh 0temps_period 0temps_hysteresis 1tempoffset 1tempsense_slope 0tempcorrx 0tempsense_option 1phycal_tempdelta1muxenab0femctrl 0papdcap2g 0tworangetssi2g 0pdgain2g 0epagain2g 0tssiposslope2g 0gainctrlsph 0papdcap5g 0tworangetssi5g 0pdgain5g 0epagain5g 0tssiposslope5g2subband5gver 2maxp2ga0 2*3pa2ga0 1*4maxp5ga0 2*12pa5ga02maxp2ga1 2*3pa2ga1 1*4maxp5ga1 2*12pa5ga12maxp2ga2 2*3pa2ga2 1*4maxp5ga2 2*12pa5ga21measpower 1measpower1 1measpower2 2rawtempsense2pdoffset40ma0 2pdoffset40ma1 2pdoffset40ma2 2pdoffset80ma0 2pdoffset80ma1 2pdoffset80ma22dot11agofdmhrbw202gpo 2ofdmlrbw202gpo 2sb20in40dot11agofdm2gpo 2sb20in80dot11agofdm2gpo 2sb20in40ofdmlrbw202gpo 2sb20in80ofdmlrbw202gpo4mcsbw805glpo 4mcsbw1605glpo 4mcsbw805gmpo 4mcsbw1605gmpo 4mcsbw805ghpo 4mcsbw1605ghpo 2mcslr5glpo 2mcslr5gmpo 2mcslr5ghpo 4mcsbw80p805glpo 4mcsbw80p805gmpo 4mcsbw80p805ghpo 4mcsbw80p805gx1po 2mcslr5gx1po 2mcslr5g80p80po 4mcsbw805gx1po 4mcsbw1605gx1po4mcsbw205gx1po 4mcsbw405gx1po2sb20in40hrpo 2sb20in80and160hr5glpo 2sb40and80hr5glpo 2sb20in80and160hr5gmpo 2sb40and80hr5gmpo 2sb20in80and160hr5ghpo 2sb40and80hr5ghpo 2sb20in40lrpo 2sb20in80and160lr5glpo 2sb40and80lr5glpo 2sb20in80and160lr5gmpo 2sb40and80lr5gmpo 2sb20in80and160lr5ghpo 2sb40and80lr5ghpo 4dot11agduphrpo 4dot11agduplrpo 2sb20in40and80hrpo 2sb20in40and80lrpo 2sb20in80and160hr5gx1po 2sb20in80and160lr5gx1po 2sb40and80hr5gx1po 2sb40and80lr5gx1po 2sb2040and80in80p80hr5glpo 2sb2040and80in80p80lr5glpo 2sb2040and80in80p80hr5gmpo 2sb2040and80in80p80lr5gmpo 2sb2040and80in80p80hr5ghpo 2sb2040and80in80p80lr5ghpo 2sb2040and80in80p80hr5gx1po 2sb2040and80in80p80lr5gx1po 2sb20in80p80hr5gpo 2sb20in80p80lr5gpo 2dot11agduppo1noiselvl2ga0 1noiselvl2ga1 1noiselvl2ga2 1*4noiselvl5ga0 1*4noiselvl5ga1 1*4noiselvl5ga21rxgainerr2ga0 1rxgainerr2ga1 1rxgainerr2ga2 1*4rxgainerr5ga0 1*4rxgainerr5ga1 1*4rxgainerr5ga21agbg0 1agbg1 1agbg2 1aga0 1aga1 1aga22usbdesc_composite16uuid1wowl_gpio0rxgains5gtrelnabypa0 0rxgains5gtrisoa0 0rxgains5gelnagaina0 0rxgains2gtrelnabypa0 0rxgains2gtrisoa0 0rxgains2gelnagaina0 0rxgains5ghtrelnabypa0 0rxgains5ghtrisoa0 0rxgains5ghelnagaina0 0rxgains5gmtrelnabypa0 0rxgains5gmtrisoa0 0rxgains5gmelnagaina00rxgains5gtrelnabypa1 0rxgains5gtrisoa1 0rxgains5gelnagaina1 0rxgains2gtrelnabypa1 0rxgains2gtrisoa1 0rxgains2gelnagaina1 0rxgains5ghtrelnabypa1 0rxgains5ghtrisoa1 0rxgains5ghelnagaina1 0rxgains5gmtrelnabypa1 0rxgains5gmtrisoa1 0rxgains5gmelnagaina10rxgains5gtrelnabypa2 0rxgains5gtrisoa2 0rxgains5gelnagaina2 0rxgains2gtrelnabypa2 0rxgains2gtrisoa2 0rxgains2gelnagaina2 0rxgains5ghtrelnabypa2 0rxgains5ghtrisoa2 0rxgains5ghelnagaina2 0rxgains5gmtrelnabypa2 0rxgains5gmtrisoa2 0rxgains5gmelnagaina22tx_duty_cycle_ofdm_40_5g 2tx_duty_cycle_thresh_40_5g 2tx_duty_cycle_ofdm_80_5g 2tx_duty_cycle_thresh_80_5g0pdoffset2g40ma0 0pdoffset2g40ma1 0pdoffset2g40ma2 0pdoffset2g40mvalid2*3pa2gccka02*12pa5gbw40a02*12pa5gbw80a02*12pa5gbw4080a0 2*12pa5gbw4080a12subband5gver1paparambwver2rpcal2g 2rpcal5gb0 2rpcal5gb1 2rpcal5gb2 2rpcal5gb34gpdnmaxp2gaitt2gaitt5gapa2gw0apa2gw1apa2gw2apa2gw3amaxp5gamaxp5ghamaxp5glapa5gw0apa5gw1apa5gw2apa5gw3apa5glw0apa5glw1apa5glw2apa5glw3apa5ghw0apa5ghw1apa5ghw2apa5ghw3apa2garxgains5gmelnagainarxgains5gmtrisoarxgains5gmtrelnabyparxgains5ghelnagainarxgains5ghtrisoarxgains5ghtrelnabyparxgains2gelnagainarxgains2gtrisoarxgains2gtrelnabyparxgains5gelnagainarxgains5gtrisoarxgains5gtrelnabypapa5gamaxp5gb4apa2g40amaxp5gb0amaxp5gb1amaxp5gb2amaxp5gb3apa5g40apa5g80adevidboardrevboardflagsboardflags2boardtypesubvidboardnumccregrevledbh0ledbh1ledbh2ledbh3pa0b0pa0b1pa0b2pa0itssitpa0maxpwropoaa2gaa5gag2ag3pa1b0pa1b1pa1b2pa1lob0pa1lob1pa1lob2pa1hib0pa1hib1pa1hib2pa1itssitpa1maxpwrpa1lomaxpwrpa1himaxpwrtri2gtri5gtri5gltri5ghrxpo2grxpo5grxchainantswitchtxpid2ga0txpid2ga1txpid2ga2txpid2ga3txpid5ga0txpid5ga1txpid5ga2txpid5ga3txpid5gla0txpid5gla1txpid5gla2txpid5gla3txpid5gha0txpid5gha1txpid5gha2txpid5gha3il0macaddret1macaddrleddcrawtempsensemeaspowerfreqoffset_corriqcal_swp_dishw_iqcal_enelna2gelna5gmeaspower1measpower2cck2gpoofdm2gpoofdm5gpoofdm5glpoofdm5ghpomcs2gpo0mcs2gpo1mcs2gpo2mcs2gpo3mcs2gpo4mcs2gpo5mcs2gpo6mcs2gpo7mcs5gpo0mcs5gpo1mcs5gpo2mcs5gpo3mcs5gpo4mcs5gpo5mcs5gpo6mcs5gpo7mcs5glpo0mcs5glpo1mcs5glpo2mcs5glpo3mcs5glpo4mcs5glpo5mcs5glpo6mcs5glpo7mcs5ghpo0mcs5ghpo1mcs5ghpo2mcs5ghpo3mcs5ghpo4mcs5ghpo5mcs5ghpo6mcs5ghpo7cddpostbcpobw40pobwduppocckbw202gpocckbw20ul2gpolegofdmbw202gpolegofdmbw20ul2gpolegofdmbw205glpolegofdmbw20ul5glpolegofdmbw205gmpolegofdmbw20ul5gmpolegofdmbw205ghpolegofdmbw20ul5ghpomcsbw202gpomcsbw20ul2gpomcsbw402gpomcsbw205glpomcsbw20ul5glpomcsbw405glpomcsbw205gmpomcsbw20ul5gmpomcsbw405gmpomcsbw205ghpomcsbw20ul5ghpomcsbw405ghpomcs32polegofdm40duppopcieingress_wareu_edthresh2geu_edthresh5grxgainerr2ga0rxgainerr2ga1rxgainerr2ga2rxgainerr5gla0rxgainerr5gla1rxgainerr5gla2rxgainerr5gma0rxgainerr5gma1rxgainerr5gma2rxgainerr5gha0rxgainerr5gha1rxgainerr5gha2rxgainerr5gua0rxgainerr5gua1rxgainerr5gua2sar2gsar5gnoiselvl2ga0noiselvl2ga1noiselvl2ga2noiselvl5gla0noiselvl5gla1noiselvl5gla2noiselvl5gma0noiselvl5gma1noiselvl5gma2noiselvl5gha0noiselvl5gha1noiselvl5gha2noiselvl5gua0noiselvl5gua1noiselvl5gua2noisecaloffsetnoisecaloffset5gsubband5gvercckPwrOffsetswctrlmap_2gboardflags3agbg0agbg1agbg2aga0aga1aga2xtalfreqpa5gbw4080a1tssifloor2gtssifloor5gpdoffset40ma0pdoffset40ma1pdoffset40ma2pdoffset80ma0pdoffset80ma1pdoffset80ma2paparambwverrx5ggainwarpa5gbw4080a0pa5gbw40a0pa5gbw80a0pa2gccka0dot11agofdmhrbw202gpoofdmlrbw202gpomcsbw805glpomcsbw805gmpomcsbw805ghpomcslr5glpomcslr5gmpomcslr5ghposb20in40hrposb20in80and160hr5glposb40and80hr5glposb20in80and160hr5gmposb40and80hr5gmposb20in80and160hr5ghposb40and80hr5ghposb20in40lrposb20in80and160lr5glposb40and80lr5glposb20in80and160lr5gmposb40and80lr5gmposb20in80and160lr5ghposb40and80lr5ghpodot11agduphrpodot11agduplrponoiselvl5ga0noiselvl5ga1noiselvl5ga2rxgainerr5ga0rxgainerr5ga1rxgainerr5ga2rpcal2grpcal5gb0rpcal5gb1rpcal5gb2rpcal5gb3txidxcap2gtxidxcap5gpdoffsetcckma0pdoffsetcckma1pdoffsetcckma2boardflags4pdoffsetcckpdoffset20in40m5gb0pdoffset20in40m5gb1pdoffset20in40m5gb2pdoffset20in40m5gb3pdoffset20in40m5gb4pdoffset40in80m5gb0pdoffset40in80m5gb1pdoffset40in80m5gb2pdoffset40in80m5gb3pdoffset40in80m5gb4pdoffset20in80m5gb0pdoffset20in80m5gb1pdoffset20in80m5gb2pdoffset20in80m5gb3pdoffset20in80m5gb4pdoffset20in40m5gcore3pdoffset20in40m5gcore3_1pdoffset20in80m5gcore3pdoffset20in80m5gcore3_1pdoffset40in80m5gcore3pdoffset40in80m5gcore3_1pdoffset20in40m2gpdoffset20in40m2gcore3mcsbw205gx1pomcsbw405gx1pomcsbw805gx1pomcsbw205gx2pomcsbw405gx2pomcsbw805gx2posb20in80and160hr5gx1posb40and80hr5gx1posb20in80and160lr5gx1posb20in80and160hr5gx2posb40and80hr5gx2posb20in80and160lr5gx2pogpdnagbg3aga3noiselvl2ga3noiselvl5ga3rxgainerr2ga3rxgainerr5ga3rxgains5gmelnagaina3rxgains5gmtrisoa3rxgains5gmtrelnabypa3rxgains5ghelnagaina3rxgains5ghtrisoa3rxgains5ghtrelnabypa3mcs1024qam2gpomcs1024qam5glpomcs1024qam5gmpomcs1024qam5ghpomcs1024qam5gx1pomcs1024qam5gx2pomcsbw1605glpomcsbw1605gmpomcsbw1605ghpomcsbw1605gx1pomcsbw1605gx2poulbpproffs2gmcs8poexpmcs9poexpmcs10poexpmcs11poexpulbpdoffs5gb0a0ulbpdoffs5gb0a1ulbpdoffs5gb0a2ulbpdoffs5gb0a3ulbpdoffs5gb1a0ulbpdoffs5gb1a1ulbpdoffs5gb1a2ulbpdoffs5gb1a3ulbpdoffs5gb2a0ulbpdoffs5gb2a1ulbpdoffs5gb2a2ulbpdoffs5gb2a3ulbpdoffs5gb3a0ulbpdoffs5gb3a1ulbpdoffs5gb3a2ulbpdoffs5gb3a3ulbpdoffs5gb4a0ulbpdoffs5gb4a1ulbpdoffs5gb4a2ulbpdoffs5gb4a3ulbpdoffs2ga0ulbpdoffs2ga1ulbpdoffs2ga2ulbpdoffs2ga3rpcal5gb4sb20in40hrlrpoxswctrlmap4_cfgswctrlmap4_TX2g_fem3to0swctrlmap4_RX2g_fem3to0swctrlmap4_RXByp2g_fem3to0swctrlmap4_misc2g_fem3to0swctrlmap4_TX5g_fem3to0swctrlmap4_RX5g_fem3to0swctrlmap4_RXByp5g_fem3to0swctrlmap4_misc5g_fem3to0swctrlmap4_TX2g_fem7to4swctrlmap4_RX2g_fem7to4swctrlmap4_RXByp2g_fem7to4swctrlmap4_misc2g_fem7to4swctrlmap4_TX5g_fem7to4swctrlmap4_RX5g_fem7to4swctrlmap4_RXByp5g_fem7to4swctrlmap4_misc5g_fem7to4could not find this entry... %s TxFunflw is assumned as max 10 Fifos Unsupported Xtlv: 0x%x Found, No supported counter tables Invalid counter name %s Unsupported counter ver %d counter_tlv_infoError while retriving info from f/w, %d Unsupported Xtlv: 0x%x Found, Need to add support Error %d in parsing xtlv info xtlv version not supported, legacy platform Invalid cntr ver %s Error parsing f/w counter versionMax counters supported: %d FW counter Version %d Mismatch App:FW cntr_ver %d:%d iov_ver %d:%d num_cntr %d:%d len %d:%d %s %d Slice_index: %d type %d: cntbuf length too long! %d > %d May need to use up-to-date wl utility. reinitreason_countsreinitreason_counts: %d(%d) reinit %u resetreset %u pcieresetpciereset %u cfgrestorecfgrestore %u dma_hangdma_hang %u ampdu_wdsampdu_wds %u txframetxframe %u txbytetxbyte %u txretranstxretrans %u txlosttxlost %u txfailtxfail %u txchanrejtxchanrej %u txdatamcasttxdatamcast %u txdatabcasttxdatabcast %u tbtt %u p2p_tbttp2p_tbtt %u p2p_tbtt_missp2p_tbtt_miss %u rxframerxframe %u rxbyterxbyte %u rxerrorrxerror %u txdroppedtxdropped %u txprshorttxprshort %u txdmawartxdmawar %u txnobuftxnobuf %u txnoassoctxnoassoc %u txchittxchit %u txcmisstxcmiss %u txq_end_assoccbtxq_end_assoccb %u txserrtxserr %u txphyerrtxphyerr %u txphycrstxphycrs %u txerrortxerror %u txfragd11_txfrag %u txmultid11_txmulti %u txbcastd11_txbcast %u txretryd11_txretry %u txretried11_txretrie %u txrtsd11_txrts %u txnoctsd11_txnocts %u txnoackd11_txnoack %u txfrmsntd11_txfrmsnt %u rxdroppedrxdropped %u rxcrcrxcrc %u rxnobufrxnobuf %u rxnondatarxnondata %u rxbaddsrxbadds %u rxbadcmrxbadcm %u rxduprxdup %u rxfragerrrxfragerr %u rxruntrxrunt %u rxgiantrxgiant %u rxnoscbrxnoscb %u rxbadprotorxbadproto %u rxbadsrcmacrxbadsrcmac %u rxrtryrxrtry %u rxfragd11_rxfrag %u rxmultid11_rxmulti %u rxbcastd11_rxbcast %u rxundecd11_rxundec %u rxctlrxctl %u rxbaddarxbadda %u rxfilterrxfilter %u rxuflorxuflo: %u tkipmicfailltkipmicfaill %u tkipicverrtkipicverr %u tkipcntrmsrtkipcntrmsr %u tkipreplaytkipreplay %u ccmpfmterrccmpfmterr %u ccmpreplayccmpreplay %u ccmpundecccmpundec %u fourwayfailfourwayfail %u wepundecwepundec %u wepicverrwepicverr %u decsuccessdecsuccess %u rxundec %u rx1mbpsrx1mbps %u rx2mbpsrx2mbps %u rx5mbps5rx5mbps5 %u rx11mbpsrx11mbps %u rx6mbpsrx6mbps %u rx9mbpsrx9mbps %u rx12mbpsrx12mbps %u rx18mbpsrx18mbps %u rx24mbpsrx24mbps %u rx36mbpsrx36mbps %u rx48mbpsrx48mbps %u rx54mbpsrx54mbps %u txmpdu_sgitxmpdu_sgi %u rxmpdu_sgirxmpdu_sgi %u txmpdu_stbctxmpdu_stbc %u rxmpdu_stbcrxmpdu_stbc %u rxmpdu_murxmpdu_mu %u cso_normalcso_normal %u cso_passthroughcso_passthrough %u chainedchained %u chainedsz1chainedsz1 %u unchainedunchained %u maxchainszmaxchainsz %u currchainszcurrchainsz %u txbartxbar %u txpspolltxpspoll %u rxbarrxbar %u rxpspollrxpspoll %u txnulltxnull %u txqosnulltxqosnull %u rxnullrxnull %u rxqosnullrxqosnull %u txassocreqtxassocreq %u txreassocreqtxreassocreq %u txdisassoctxdisassoc %u txassocrsptxassocrsp %u txreassocrsptxreassocrsp %u txauthtxauth %u txdeauthtxdeauth %u txprobereqtxprobereq %u txprobersptxprobersp %u txactiontxaction %u rxassocreqrxassocreq %u rxreassocreqrxreassocreq %u rxdisassocrxdisassoc %u rxassocrsprxassocrsp %u rxreassocrsprxreassocrsp %u rxauthrxauth %u rxdeauthrxdeauth %u rxprobereqrxprobereq %u rxprobersprxprobersp %u rxactionrxaction %u type %d: cnt struct length mismatch! %d != %d txallfrmtxallfrm %u txbcnfrmtxbcnfrm %u txrtsfrmtxrtsfrm %u txctsfrmtxctsfrm %u txackfrmtxackfrm %u txbacktxback %u txdnlfrmtxdnlfrm %u txfunfltxfunfl: txtplunfltxtplunfl %u txphyerrortxphyerror %u rxstrtrxstrt %u rxbadplcprxbadplcp %u rxcrsglitchrxcrsglitch %u rxtoolaterxtoolate %u rxdrop20srxdrop20s %u rxrsptmoutrxrsptmout %u rxbadfcsrxbadfcs %u rxfrmtoolongrxfrmtoolong %u rxfrmtooshrtrxfrmtooshrt %u rxinvmachdrrxinvmachdr %u rxf0ovflrxf0ovfl %u rxf1ovflrxf1ovfl %u rxf2ovflrxf2ovfl %u txsfovfltxsfovfl %u pmqovflpmqovfl %u rxcfrmucastrxcfrmucast %u rxrtsucastrxrtsucast %u rxctsucastrxctsucast %u rxackucastrxackucast %u rxbackrxback %u rxbeaconmbssrxbeaconmbss %u rxdfrmucastmbssrxdfrmucastmbss %u rxmfrmucastmbssrxmfrmucastmbss %u rxbeaconobssrxbeaconobss %u rxdfrmucastobssrxdfrmucastobss %u rxdfrmocastrxdfrmocast %u rxmfrmocastrxmfrmocast %u rxcfrmocastrxcfrmocast %u rxrtsocastrxrtsocast %u rxctsocastrxctsocast %u rxcfrmmcastrxcfrmmcast %u rxdfrmmcastrxdfrmmcast %u rxmfrmmcastrxmfrmmcast %u rxcgprqfrmrxcgprqfrm %u rxcgprsqovflrxcgprsqovfl %u txcgprsfailtxcgprsfail %u txcgprssuctxcgprssuc %u prs_timeoutprs_timeout %u pktengrxducastpktengrxducast %u pktengrxdmcastpktengrxdmcast %u bcntxcanclbcntxcancl %u txfbwtxfbw %u rxnackrxnack %u frmsconsfrmscons %u txnacktxnack %u txampdutxampdu %u txmpdutxmpdu %u txucasttxucast %u txinrtstxoptxinrtstxop %u txrtsfailtxrtsfail %u txper_ucastdttxper_ucastdt %.1f%% txper_rtstxper_rts %.1f%%rxnodelimrxnodelim %u bphy_badplcpbphy_badplcp %u bphy_rxcrsglitchbphy_rxcrsglitch %u rxanyerrrxanyerr %u rxctlucastrxctlucast %u rxdtucastmbssrxdtucastmbss %u rxmgucastmbssrxmgucastmbss %u rxdtucastobssrxdtucastobss %u rxdtocastrxdtocast %u rxmgocastrxmgocast %u rxctlocastrxctlocast %u rxctlmcastrxctlmcast %u rxdtmcastrxdtmcast %u rxmgmcastrxmgmcast %u dbgoff46dbgoff46 %u dbgoff47dbgoff47 %u dbgoff48dbgoff48 %u phywatchphywatch %u rxhlovflrxhlovfl %u missbcn_dbgmissbcn_dbg %u macxsuspmacxsusp %u m2vmsgm2vmsg %u v2mmsgv2mmsg %u mboxoutmboxout %u musndmusnd %u sfb2vsfb2v %u phyovflphyovfl %u lenfovfllenfovfl %u goodfcsgoodfcs %u colormisscolormiss %u txmampdutxmampdu %u txfrag %u Major Version %d and Minor Version %d of WLC interface is not matching he counters:he_rxtrig_myaidhe_rxtrig_myaid %u he_rxtrig_randhe_rxtrig_rand %u he_colormiss_cnthe_colormiss_cnt %u he_txmampduhe_txmampdu %u he_txmtid_backhe_txmtid_back %u he_rxmtid_backhe_rxmtid_back %u he_rxmsta_backhe_rxmsta_back %u he_txfraghe_txfrag %u he_rxdefraghe_rxdefrag %u he_txtrighe_txtrig %u he_rxtrig_basiche_rxtrig_basic %u he_rxtrig_murtshe_rxtrig_murts %u he_rxtrig_bsrphe_rxtrig_bsrp %u he_rxdlmuhe_rxdlmu %u he_physu_rxhe_physu_rx %u he_phyru_rxhe_phyru_rx %u he_txtbppduhe_txtbppdu %u he_null_tbppduhe_null_tbppdu %u Unknown counters type %d!! You may try updating wl utility. Stats received on interface index: %d --nz--invert--rx--tx--err--ucast--mcast--ampdu--ucode--ctrl--sec--assoc--heunrecognized option %s IOVAR buffer short!counters_version %2d %s: WLC_GET_REVINFO failed %d %s: wl_cntbuf_to_xtlv_format failed %d datalen %d malloc fail!error %d Illegal response length received. Got: %d Expected: %d. Expected len must be <= %u unexpected type received: %d Expected: %d error unpacking XTLVs in wl_ifstats_counters: %d Can not allocate %d bytes for counters struct txexptimetxexptime %u txrts %u txnocts %u ifst Can not allocate %d bytes for wl delta stats struct Incorrect version of delta stats struct: expected %d; got %d slice_indexslice_index %u Version mismatch: actual %d, expected %d CORE[%d]: excursionq_end_miss = %d activeq_end_miss = %d no_chanctxt_count = %d txq_end_incomplete = %d txq_start_incomplete = %d Cannot set chanctxt stats active_antauto_enavg_snr_per_ant0avg_snr_per_ant1avg_snr_per_ant2cell_policymws_antsel_ovr_rxmws_antsel_ovr_txrx_policyrxcountswap_alivecheck0swap_alivecheck1swap_ge_rxcount0swap_ge_rxcount1swap_ge_snrthresh0swap_ge_snrthresh1swap_snrdrop0swap_snrdrop1swap_timer0swap_timer1swap_trig_event_idswap_txfail0swap_txfail1tx_active_anttx_auto_entx_policytxfunfl[0]txfunfl[1]txfunfl[2]txfunfl[3]txfunfl[4]txfunfl[5]txfunfl[6]txfunfl[7]txfunfl[8]txfunfl[9]weppeofbadplcpmsduthreshstrmeofstsfifofullstsfifoerrrxerr_statctx_fifo_fullreinitreason_counts[0]reinitreason_counts[1]reinitreason_counts[2]reinitreason_counts[3]reinitreason_counts[4]reinitreason_counts[5]reinitreason_counts[6]reinitreason_counts[7]reinitreason_counts[8]reinitreason_counts[9]reinitreason_counts[10]reinitreason_counts[11]reinitreason_counts[12]reinitreason_counts[13]reinitreason_counts[14]reinitreason_counts[15]reinitreason_counts[16]reinitreason_counts[17]reinitreason_counts[18]reinitreason_counts[19]reinitreason_counts[20]reinitreason_counts[21]reinitreason_counts[22]reinitreason_counts[23]reinitreason_counts[24]reinitreason_counts[25]reinitreason_counts[26]reinitreason_counts[27]reinitreason_counts[28]reinitreason_counts[29]reinitreason_counts[30]reinitreason_counts[31]reinitreason_counts[32]reinitreason_counts[33]reinitreason_counts[34]reinitreason_counts[35]reinitreason_counts[36]reinitreason_counts[37]reinitreason_counts[38]reinitreason_counts[39]reinitreason_counts[40]reinitreason_counts[41]reinitreason_counts[42]reinitreason_counts[43]reinitreason_counts[44]reinitreason_counts[45]reinitreason_counts[46]reinitreason_counts[47]reinitreason_counts[48]reinitreason_counts[49]reinitreason_counts[50]reinitreason_counts[51]reinitreason_counts[52]reinitreason_counts[53]txctltxrunttxuflorxoflorxuflo[0]rxuflo[1]rxuflo[2]rxuflo[3]rxuflo[4]rxuflo[5]d11cnt_txrts_offd11cnt_rxcrc_offd11cnt_txnocts_offdmadedmadadmapepkt_callback_reg_faild11_txfragd11_txmultid11_txretryd11_txretried11_txrtsd11_txnoctsd11_txnoackd11_rxfragd11_rxmultid11_txfrmsntd11_rxundecwepexcludedpsmwdsphywatchdogprq_entries_handledprq_undirected_entriesprq_bad_entriesatim_suppress_countbcn_template_not_readybcn_template_not_ready_donelate_tbtt_dpcrx108mbpsrx162mbpsrx216mbpsrx270mbpsrx324mbpsrx378mbpsrx432mbpsrx486mbpsrx540mbpsrfdisablerxundec_mcsttkipmicfaill_mcsttkipcntrmsr_mcsttkipreplay_mcstccmpfmterr_mcstccmpreplay_mcstccmpundec_mcstfourwayfail_mcstwepundec_mcstwepicverr_mcstdecsuccess_mcsttkipicverr_mcstwepexcluded_mcstpstatxucastpstatxnoassocpstarxucastpstarxbcmcpstatxbcmcreinitreason[0]reinitreason[1]reinitreason[2]reinitreason[3]reinitreason[4]reinitreason[5]reinitreason[6]reinitreason[7]psmxwdstxqueue_starttxqueue_endioc%s:malloc(%d) failed malloc(%d) failed, free %d batched commands and exit batching mode batching %dth command %d calling add_one_batched_cmd() at non-command-batching mode, weirdIOCTL GET command %d is not supported in batching mode %s: socketwlInterface name change not allowed within --interactive %s: Unrecognized command "%s", type -h for help %s : wl driver adapter not found r:wl_get_dev_type/proc/net/devshEnter the shell command, e.g. ls(Linux) or dir(Win CE) Channel will be synchronized by Findserver %s: wl driver adapter not found --interactivelchannel Findserver is called to synchronize thechannel > wl:error: too many args; argc must be < %d qexitGive shell command Findserver is calledafter the join issued to remote --indongle--vista--nodetect--debug--socket--serial--dongleserial device open error --wificould not parse as an ethternet MAC address Retry again Error at inet_ntoa Error in IP address Enter correct IP address/hostname format Usage: %s [] [-T ] [] -h Display help message -i Show description (info) -m Show module name -t Show variable types -a Show all names -d Show default values -1 Display names in a single column -e Exact match of substring -v (verbose) Show module, type, default values -V (verbose) Like -v plus descriptions -u (undoc) Show only driver variables without UI info -x Show only variable with UI info that are not in current driver -T Restrict to variables of the given type (see below) Display all names containing the given substring -u and -x are mutually exclusive Known variable types include: no-typeno-mod-TMust specify type with -t. Unknown variable type: %s -V-t-eERROR: Could not allocate transfer buffer of %d bytes Unable to show variables missing from local info Unable to show module names of type %smatching =%s=%s %-30sVariable name %-8sType %-20sModule %-10sDefaultError on wl_get getting IOV block %-25s%s %-10d? %s UI variables not in driver: No matching variables found Error parsing arguments for command %s Variables Usage: wl %s [-s ] [] Display commands matching substr in any of the given categories Command categories include (use lower case to specify): %-8s %s -gUnrecognized command category: %s No matching commands%-18s PHY and radio; speed, band, etcChannel; subclass of phyRate; subclass of phy, a/b/gPower; subclass of phyMAC; Media accessManagement, association, IE, etcSecurity; subclass of mgmtWME; media extensionsMonitoring device (counters, etc)AP subclass of mgmtSTA subclass of mgmtBoard, hardwareAdministration; software, UI, diagsDevice; low level controlDeprecatedUncategorized so farphychanpowermgmtsecmonboardadmindevdepuncatVariable not found in local infovoidboolint8uint8int16uint16int32uint32bufferabminrateaciargsaddkeyaddwepampdu_clear_dumpampdu_retry_limit_tidampdu_rr_retry_limit_tidampdu_send_addbaampdu_send_delbaampdu_tidap_isolateassoclistattenauthe_sta_listautho_sta_listba_clear_countersba_dumpband_rangebtc_flagsbtc_paramscac_addtscac_deltscac_delts_eacac_tslistcac_tspeccck_txbwclosednetcrsuprsdecryptstatusdiagencryptstrengthevmfipsforcefqacurcyframeburstgpiooutignore_bcnsinterferencekeyslazywdsleaplegacylinklistenlongtrainmimo_ftmimo_psmimo_txbwmode_reqdndis_fragndis_rtsndisscannettypenettypes_supportednoisenratenvotpwofdm_txbwotpdumpotpwpcicfgregpcieregphyregpm2_rcv_durpm2_sleep_retpowerindexprimary_keyradarradarargsrcvdroppedrcvokrestartrmweprndismacrssi_eventsample_collectscan_channel_timescan_home_timescan_nprobesscan_passive_timescan_unassoc_timescansuppressscb_timeoutsd_blockmodesd_blocksizesd_cissd_devregsd_divisorsd_dmasd_drivestrengthsd_hciregssd_highspeedsd_hostregsd_intssd_modesd_msglevelsd_numintssd_numlocalintssendserdespllregserdesrxregserdestxregshortslot_restrictstatstkip_countermeasurestrf_mgmt_configtrf_mgmt_filters_addtrf_mgmt_filters_removetrf_mgmt_filters_listtrf_mgmt_filters_cleartrf_mgmt_bandwidthtrf_mgmt_flagstrf_mgmt_statstrf_mgmt_stats_cleartrf_mgmt_shaping_infotsctssitxinstpwrtxpathpwrwdswds_remote_macwds_wpa_rolewds_wpa_role_oldwepdefaultwepstatuswsec_testxlistxmitokzzzzzno descMulticast rate override setting for .11aRate override setting for .11aactivezoneA-MPDU policy value; to modify, driver must be downampdu_ba_wsizeAdvertized ba window size (in MPDU)Clears AMPDU specific statistics (WLCNT)ampdu_densityAdvertised receive densityampdu_durMax duration of transmitted ampdu (in msec)ampdu_ffpldDisplay the ampdu for each mcs and the estimated minimum dma transfer rateampdu_ffpld_rsvdampdu_hiagg_modeampdu_manual_modeEnables manual mode; addba is sent by user through command line (in msec)ampdu_max_txunflMaximum acceptable tx underflow per ampdu: tx_unfl < ampdu_max_txunfl * ampdusampdu_mpduMax number of mpdu in ampduampdu_probe_mpduampdu_resp_flushampdu_resp_timeoutampdu_retry_limitNumber retries before sending BAR to move windowampdu_rr_retry_limitNumber retries of AMPDU at regular rate before change to fallback rateampdu_rtsampdu_rx_factorAdvertises ampdu max sizeSends addba request and initializes tid initiatorSends delba request and cleans up tid initiatorEnables/Disables AMPDU on a per-tid basisampdu_tx_lowatLow watermark to initiate aggregateampdu_txpkt_weightA-MSDU policy value; driver must be down to modifyamsdu_aggblockManually block all scb A-MSDU aggregationamsdu_aggbytesA-MSDU aggregation bytes limitamsdu_aggflushFlush all scb A-MSDU buffersamsdu_aggsfA-MSDU aggregation MSDU number limitamsdu_countersamsdu_deaggdumpamsdu_hiwmamsdu_lowmamsdu_noackA-MSDU ack policy; send A-MSDU without mac ackamsdu_rxmaxamsdu_simantennasRead only return total number of antennas to be used(1-4 for now)Running as an access pointData frames received by the AP are passed up only, not forwardedapcschspecGet current associated AP; max len 16; if not associated may return stale dataEnable AP-STA modeapsta_dbgDebug mode for AP/STAReturns a wl_assoc_info_t struct with assoc pkts lengths and 802.11 headersReturns the IE portion of the most recent association request pktReturns the IE portion of the most recent association response pktassocroamEnable roaming to assoc preferred band when there is no need to roambaBlock Ack policy value; can only be modified when driver is down2.4G band - 0; 5G band: low - 1, mid - 2, high - 3ba_bar_timeouttimeout in msec to send BARba_barfreqfreq of packets at which BAR is sent.ba_bsizeadvertized ba window size (in MPDU)ba_cf_policyBA/BAR ctrl frame ack policy; 0:normal; 1:noackclear/reset BA counters (BCMDBG)ba_countersReturn BA counters (BCMDBG)ba_delba_timeoutba_ini_pkt_threshmoving average in pkts/sec for prior 8-sec window to initiate addbaba_sendSend unsolicited ADDBA; for testing;ba_simSetup for linuxsim testing;Get the error code corresonding to the last configuration error.Get the error string corresonding to the last configuration error.bcn_timeoutMulticast rate override setting for .11b/gRate override setting for .11b/gEnable BSS configurationbss_maxassocLimit the number of 802.11 Associations the driver should accept for a BSSbtc_modeBluetooth coexistance modes; 0: disable; 1: enable; 2: premptCall Admission Control; CAC can only be enabled if WME is enabledAdd/update TSPEC; requires tspec_arg_t structure as inputcac_addts_timeoutDelete matching TSPEC; requires tspec_arg_t structure as inputGet current list of driver TSINFOGet specified TSPEC with given TSINFOReturns whitespace-separated driver/device capabilitiesccgpioctrlccgpioinccgpiooutccgpiooutenCCK frame tx bandwidth; 2: 20Mhz lower, 3: 20Mhz upperccx_auth_modeCCX authentication modeccx_rmccx_rm_limitccx_versionNetwork ccx version.ccx_ihvUnder IHV controlccx_enableCCX enabledccx_v4_onlyCCXv4 onlyCurrent chanspec in use; set for next BSS createdReturns a list of all of the available chanspecsclkreqtimerBSS Configuration Closed Network attribute; BSS must be disabled to changeGet a buffer containing driver/ucode countersStores the country IE for beacons and probe responsescountry_list_extendedIf true, all countries reported by get_country_listcramAP mode only; send out Channel Switch Announcement management action frameCurrent MAC addresscur_mcssetdbgselThe next dfs channel is forced to this channel for testingdfs_ism_monitorForce ISM to be in monitor-only mode; disables channel swtiching, etcdfs_postismNumber of seconds to listen for radar on new channel for 802.11Hdfs_preismNumber of seconds to listen for radar before initiating a networkReport the status of dfs processingReturns test informationOptions all, list, ; call registered dump functionseirpIs current locale use of txpower EIRP or not128-bit vector to enable MAC event reportingfast_timerWindows NDIS STA; 0: disable; 1: enable; -1: prohibit FIPSfips_add_keyWindows NDIS STA driver; set key for FIPS.fips_oidWindows NDIS STA; change when not associated; OID_FSW_FIPS_MODE requestfips_remove_keyWindows NDIS STA driver; remove key for FIPS.fragthreshCurrent frequency tracking mode; 0: auto; 1: on; 2: offgf_capgf_protectiongf_protection; 0: off, 1: ongf_protection_overrideState of gf_protection_override; -1: auto, 0: off, 1: onglacial_timerSet GPIO pins to given; use with EXTREME caution; see wl gpiodumpgpiotimermaskTimer mask for gpiotimergpiotimervalDeprecated: use leddchtphy_membershipenable/disable HT PHY Membership; 0: off, 1: onibss_allowedibss_gmodekeydatareqled_blinkfastled_blinkmedled_blinkslowgpiotimer value; to enable powersavings for LEDsThis iovar controls the packet lifetime in ms for an access classmallocedmaxassocLimit the number of 802.11 Associations the driver should acceptmcast_listList of multicast addresses to be passed to upper-layer protocols (4320 CDC)mimo_bw_capSupported channel width bit in HT Cap Info field, TRUE = 40MHz; FALSE = 20MHzmimo_preamblen-mode preamb override; -1: auto; 0: mixed-mode; 1: GF-only; device down to setMIMO EWC capability IE; 0: No MIMO, 1: RTS before MIMO, 2: N/A, 3: No Restrictionmimo_ss_stfMIMO frame tx bandwidth; 2: 20Mhz lower, 3: 20Mhz upper, 4: 40Mhz, 5: 40Mhz dupset/get required mode for STA association acceptance with APEnable Minimum Power Consumption in drivermpreqmssidMulti-SSID enabled; driver must be down to setndis_unblock_8021xOverride 802.1x authenticationnmodeEnable pre-n features; driver must be down to setnmode_protectionn_protection; 0: off, 1: mixed-mode, 2: CTS-to-selfnmode_protection_overrideState of n_protection; -1: auto, 0: off, 1: on, 2: MM Hdr 3: CTSnobcnssidnobcprbrespnonerp_presentnphy_5g_pwrgainnphy_aci_scannphy_aci_w2based_detectionphy_antsel_overridenphy_est_powernphy_fixed_noisenphy_forcecalnphy_forcemphasecalnphy_gain_boostnphy_gpioselnphy_mphasecalnphy_mphasecalstatenphy_nextcalnphy_percalnphy_rfseqnphy_rssiselnphy_rxant_confignphy_rxcalparamsnphy_rxiqcalnphy_scraminitnphy_test_tssinphy_test_tssi_offsnphy_tx_tonenphy_txant_confignphy_txiqlocalnphy_txpwrctrlnphy_txpwrindexnphy_txrx_chainband-specific rate override; 0: SISO, 1: CDD, 2: STBC, 3: SDMnreqdRetrieve nvram contents in multi-string, double-null-byte-terminated formatGet an nvram variable by nameofdm_presentOFDM frame tx bandwidth; 2: 20Mhz(lower), 3: 20Mhz upper, 4: N/A, 5: 40Mhz duppcieclkreqpciegpiooutpciegpiooutenpciel1plldownpcielcregVarious channel attributes returned as bitfieldsPermanent MAC addressphy_rssi_antphy_watchdogphynoise_pollingpower mgmt mode 2 receive duty cycle as a percentage (15-85%) of the beacon intervalpower mgmt mode 2 inactive ms before re-entering power save modepmkid cache tableRadar detection parametersradarargs40Report the status of radar detectionClear the status of radar detectionGenerate a random number from MACratesel_maxshortampdusratesel_simratesel_table_indexratesel_table_valueResets the IEEE 802.11 MIB countersrfdisabledlyrifsEWC spec to reduce tx interframe gap; it implies no-ackrtsthreshscan_assoc_timeDwell time in ms when channel scanningDwell time on home BSS channelNumber of probe requests sent during the dwell time on an actively scanned channelDwell time in ms for each channel passively scannedDwell time in ms for each channel actively scanned when not participating in a BSSscanresults_minrssiscb_activity_timeSDIO drive strength in mA(2mA-12mA), in 2mA incrementslow_timerBSS configuration's SSID; can only be changed when the indexed BSS is disabledssidmaskGives station info based on MACsta_retry_timeTime in seconds before retry after failed assoc attemptThe station name; max 16 bytessup_auth_statussup_auth_status_extExtended in-driver supplicant authentication statussup_wpatest_s60txburst_limitget current Tx Burst Limit setting; 0: off, 1: ontxburst_limit_overrideState of txburst_limit_override; -1: auto, 0: off, 1: oncrashForce crash; 0: oops, 1: ASSERTtxctxc_policytxc_stickyPower output based on current TSSItxmaxpktsvblanktsfvlan_modeShould driver strip priority tags (VLAN ID zero)vndr_ieAccess vendor proprietary IEs to 802.11 Management Packets transmitted from the APwdstimeoutWireless ethernet support; wl must be in STA modewet_host_ipv4Enable WET client DHCP relay agentwet_host_macEnable WET host DHCP relay agentwlan_assoc_reasonCCXv4 assocation reason codeswlfeatureflagFlags defined in wlioctl.hMedia extension modes; -1: auto, 1: enabled, 0: disabledAccess class parameters for APAccess class parameters for STAwme_bss_disableDisable WMM/WME advertising for a specific BSS (if wme is enabled in the system)Clear WMM countersGet WME counters maintained by the driverBitmap discard policy per AC; 0: newest 1: oldest; [3:0]: VO VI BK BEwme_noackEnable no-ack WME modewme_prec_queuingPower save delivery info, per access classwme_sta_listGet the WME STA list; AP onlySet/get per-AC TX retry and max rate parametersWPA authentication modeSet/get per-AC max bandwidthRSN capability advertisement; see 802.11 RSN info fieldswpa_msgsEnable WPA event notification to external supp/authwpaieInfo element for WPA associated with E_ASSOC_IND event; Set is STA onlyEncryption types for BSS configwsec_authorizationConvey auth status between upper layerswsec_keyAdd or delete a wsec keyDrop unencrypted packets when WSEC is enabled in bsscfg40_intolerantDevice is 40Mhz Intolerant in the 2.4G Band40_intolerant_detectedIndicates if another 40Mhz Intolerant device has been detectedBluetooth coexistance parametersBluetooth coexistance flagsbrcm_ieEnables brcm ie in the auth requests sent by the staErr: command len exceeds buf len. Checkinitialization cmds rwl_wifi_allocate_actionframe: unable to allocate frame rwlwifivsactionremote_CDC_DATA_wifi_rx: Error in reading the frame %d malloc failure Read bogus subtype %d Missing frag number %d Purge Error in reading the frame rwl_wifi_purge_actionframes:Purge Error in reading the frame wifiactionrwl_wifi_find_server_response: Failedto Send the Frame %d rwl_find_remote_wifi_server : Failed to allocate rwl_find_remote_wifi_server : Failed to allocate Error getting current Mac addr Scanning Channel: %d ... Failed to set the specified channel %d Failed to Send the Frame %d Server is on channel # %d Failed to set the specifiedchannel %d REF now moved to thechannel of server # %d Server is operating on diffrent channel.continue scanning remote_CDC_wifi_tx: data_len (%d) > buf_len (%d) data size exceeds data_len %d remote_CDC_wifi_tx: Failed to allocate memory Unable to read the action frame %d error remote_CDC_tx: data_len (%d) > buf_len (%d) CDC_Tx: Data: Write failed rwl %d %d %d %d rwl %x %d %d %d CDC Header:No of bytes to be sent=%d Data:No of bytes to be sent=%d CDC_Tx: Header: Write failed CDC_Tx: Header: numwritten %ld != n_bytes %d Data_Tx: Header: Write failed Data_Tx: Header: numwritten %ld != len %d CDC_Tx: Header: numwritten %ld != len %d Packet sent! remote_CDC_tx: Failed to get allocated buffer remote_CDC_rx_hdr: Header Read failed remote_CDC_rx_hdr: numread:%d remote_CDC_rx_hdr:No data to receive Unknown Transport Type remote_CDC_rx: remote data len (%d) > msg len (%d) remote_CDC_rx_hdr: Data Receivefailed remote_CDC_rx:Data Receive failed sockconnet SockDes=%d Server is not running rwl_open_serial:%s open COM failed with error %d. tcsetattr:setspeedBaud_rate set is:%d tcsetattr:tcgetattr:tcgetattr:VMIN is:%d tcgetattr:VTIME is:%d Failed to connect() to server errno:%d Error at rwl_bindSocket()Error at rwl_listensocket()Error at rwl_acceptConnection()Failed to send()wanted to send %d bytes sent only %d bytes Failed to Receive()asked %d bytes got %d bytes socket open error WriteToPort FailedErrno:%d rwl_write_serial_port failed numwritten %ld != len %ld ReadFromPort Failedasked for %d bytes got %d bytes Can't open serial port rwl_opensocket Fails: errno:%d Can't open socket rwl_open_transport: Unknown remote_type %d eth0USAGE ERROR:Incorrect network interface USAGE ERROR:Incorrect port USAGE ERROR INFO: Network Interface:%s, Port:%d Error at SetTCPSocketOpt()Waiting for client to connect... Error at rwl_closeSocket()close_pipe: Unknown remote_type %d rem_ptr->msg.len=%d rem_ptr->data_len=%d data_len is:%d No of frames=%d Malloc failed for serial fragmented framelocal result Total bytes=%d Frame (Reverse):%d query_info_fe: Reading CDC header failedquery_info_fe: Send command failed query_info_fe: Reading CDC header failed query_info_fe: needed size(%d) > actualsize(%ld) query_info_fe: No results! ServerIP:%s,ServerPort:%d Error in getting the Socket Descriptor query_info_fe: Reading CDC header failed query_info_fe: needed size(%d) > actual size(%ld) Mem alloc fails for shell cmd buffer Insufficient length for shell cmd buffer Error in getting the SocDes shell_info_fe: Send command failed killrwl_socket_shellresp: Receiving CDCheader failed rwl_socket_shellresp: Mem alloc fails rwl_socket_shellresp: No results! shell_info_fe: Receiving CDCheader failed Mem alloc fails shell_info_fe: No results! shell_info_fe: Receiving CDC header failed Mem alloc fails for shell response buffer shell_info_fe:Receiving CDC header failed Malloc failed for shell response rwl_shell_information_fe(wifi):Send command failed rwl_shell_information_fe(wifi):error in reading shell response Wait time: %lu seconds query_info_fe: response format error. query_info_fe: needed size(%d) greater than actual size(%lu) Malloc failed for query information fecharacter buf ir_queryinformation_fe : retry %dcmd %d ir_queryinformation_fe :Error in reading the frag bytes rwl_queryinformation_fe: Unknownremote_type %d set_info_fe: Send command failed set_info_fe: Reading CDC header failed set_info_fe: response format error. set_info_fe: needed size (%d) greater than actual size (%lu) set_info_fe: fetching results failed Malloc failed for set_info_fe character buf retry %d cmd %d ir_setinformation_fe: Sendcommand failed ir_setinformation_fe: failed to readthe response rwl_setinformation_fe: Unknown remote_type:%d Usage: wl/dhd [--linuxdut/linux] [--debug] [--serial port no][--ReadTimeout n] [--interactive] [--clientbatch] --linuxdut/linux removes the WLC_OID_BASEwhen sending the IOCTL command --debug prints out tx packets sending down the serial line, and other debug info --serial enables the remoteWL serial port number --interactive enables using WL in interactive mode --clientbatch enables command batchinng on the client, the default is batching on driver Usage: wl/dhd --dongle COM1/COM2 (WinXP) or /dev/ttyS0 or /dev/ttyS1 (Linux) - wl, shell or dhd command Depending on the client you are using(wl or dhd) shell command usage: sh Usage: wl/dhd --socket [] IP address of server machine Port no of server If is omitted, use default port number 8000 Usage: wl/dhd --wifi MAC Address Autodetect: %d Autodetect failed, rwl server is either too old or unreachable. Use --nodetect to disable autodetect. Unknown expansion modeERROR: Bad vht mcs spec: %d ERROR: Bad vht ss1 mode: %d, expansion mode %s ERROR: Bad vht ss1 mode: %d, expansion mode: %s ERROR: Bad vht ss2 mode: %d, expansion mode %s ERROR: Bad vht ss2 mode: %d expansion mode: %s ERROR: Bad vht ss3 mode: %d, expansion mode: %s ERROR: Bad vht ss3 mode: %d, expansion: %s ERROR: Bad vht ss4 mode: %d, expansion mode: %s ERROR: Bad vht ss4 mode: %d, expansion: %s ERROR: Bad legacy rate spec: %d ERROR: Bad legacy tx_expansion spec: %d expansion mode %s ERROR: Bad ht mcs spec: %d NO_RATECDDSTBCTXBFDSSS1DSSS2DSSS5DSSS11OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54MCS0MCS1MCS2MCS3MCS4MCS5MCS6MCS7VHT8SS1VHT9SS1VHT10SS1VHT11SS1DSSS1_MULTI1DSSS2_MULTI1DSSS5_MULTI1DSSS11_MULTI1OFDM6_CDD1OFDM9_CDD1OFDM12_CDD1OFDM18_CDD1OFDM24_CDD1OFDM36_CDD1OFDM48_CDD1OFDM54_CDD1MCS0_CDD1MCS1_CDD1MCS2_CDD1MCS3_CDD1MCS4_CDD1MCS5_CDD1MCS6_CDD1MCS7_CDD1VHT8SS1_CDD1VHT9SS1_CDD1VHT10SS1_CDD1VHT11SS1_CDD1MCS0_STBCMCS1_STBCMCS2_STBCMCS3_STBCMCS4_STBCMCS5_STBCMCS6_STBCMCS7_STBCVHT8SS1_STBCVHT9SS1_STBCVHT10SS1_STBCVHT11SS1_STBCMCS8MCS9MCS10MCS11MCS12MCS13MCS14MCS15VHT8SS2VHT9SS2VHT10SS2VHT11SS2DSSS1_MULTI2DSSS2_MULTI2DSSS5_MULTI2DSSS11_MULTI2OFDM6_CDD2OFDM9_CDD2OFDM12_CDD2OFDM18_CDD2OFDM24_CDD2OFDM36_CDD2OFDM48_CDD2OFDM54_CDD2MCS0_CDD2MCS1_CDD2MCS2_CDD2MCS3_CDD2MCS4_CDD2MCS5_CDD2MCS6_CDD2MCS7_CDD2VHT8SS1_CDD2VHT9SS1_CDD2VHT10SS1_CDD2VHT11SS1_CDD2MCS0_STBC_SPEXP1MCS1_STBC_SPEXP1MCS2_STBC_SPEXP1MCS3_STBC_SPEXP1MCS4_STBC_SPEXP1MCS5_STBC_SPEXP1MCS6_STBC_SPEXP1MCS7_STBC_SPEXP1VHT8SS1_STBC_SPEXP1VHT9SS1_STBC_SPEXP1VHT10SS1_STBC_SPEXP1VHT11SS1_STBC_SPEXP1MCS8_SPEXP1MCS9_SPEXP1MCS10_SPEXP1MCS11_SPEXP1MCS12_SPEXP1MCS13_SPEXP1MCS14_SPEXP1MCS15_SPEXP1VHT8SS2_SPEXP1VHT9SS2_SPEXP1VHT10SS2_SPEXP1VHT11SS2_SPEXP1MCS16MCS17MCS18MCS19MCS20MCS21MCS22MCS23VHT8SS3VHT9SS3VHT10SS3VHT11SS3DSSS1_MULTI3DSSS2_MULTI3DSSS5_MULTI3DSSS11_MULTI3OFDM6_CDD3OFDM9_CDD3OFDM12_CDD3OFDM18_CDD3OFDM24_CDD3OFDM36_CDD3OFDM48_CDD3OFDM54_CDD3MCS0_CDD3MCS1_CDD3MCS2_CDD3MCS3_CDD3MCS4_CDD3MCS5_CDD3MCS6_CDD3MCS7_CDD3VHT8SS1_CDD3VHT9SS1_CDD3VHT10SS1_CDD3VHT11SS1_CDD3MCS0_STBC_SPEXP2MCS1_STBC_SPEXP2MCS2_STBC_SPEXP2MCS3_STBC_SPEXP2MCS4_STBC_SPEXP2MCS5_STBC_SPEXP2MCS6_STBC_SPEXP2MCS7_STBC_SPEXP2VHT8SS1_STBC_SPEXP2VHT9SS1_STBC_SPEXP2VHT10SS1_STBC_SPEXP2VHT11SS1_STBC_SPEXP2MCS8_SPEXP2MCS9_SPEXP2MCS10_SPEXP2MCS11_SPEXP2MCS12_SPEXP2MCS13_SPEXP2MCS14_SPEXP2MCS15_SPEXP2VHT8SS2_SPEXP2VHT9SS2_SPEXP2VHT10SS2_SPEXP2VHT11SS2_SPEXP2MCS16_SPEXP1MCS17_SPEXP1MCS18_SPEXP1MCS19_SPEXP1MCS20_SPEXP1MCS21_SPEXP1MCS22_SPEXP1MCS23_SPEXP1VHT8SS3_SPEXP1VHT9SS3_SPEXP1VHT10SS3_SPEXP1VHT11SS3_SPEXP1MCS24MCS25MCS26MCS27MCS28MCS29MCS30MCS31VHT8SS4VHT9SS4VHT10SS4VHT11SS4OFDM6_TXBF1OFDM9_TXBF1OFDM12_TXBF1OFDM18_TXBF1OFDM24_TXBF1OFDM36_TXBF1OFDM48_TXBF1OFDM54_TXBF1MCS0_TXBF1MCS1_TXBF1MCS2_TXBF1MCS3_TXBF1MCS4_TXBF1MCS5_TXBF1MCS6_TXBF1MCS7_TXBF1VHT8SS1_TXBF1VHT9SS1_TXBF1VHT10SS1_TXBF1VHT11SS1_TXBF1MCS8_TXBF0MCS9_TXBF0MCS10_TXBF0MCS11_TXBF0MCS12_TXBF0MCS13_TXBF0MCS14_TXBF0MCS15_TXBF0VHT8SS2_TXBF0VHT9SS2_TXBF0VHT10SS2_TXBF0VHT11SS2_TXBF0OFDM6_TXBF2OFDM9_TXBF2OFDM12_TXBF2OFDM18_TXBF2OFDM24_TXBF2OFDM36_TXBF2OFDM48_TXBF2OFDM54_TXBF2MCS0_TXBF2MCS1_TXBF2MCS2_TXBF2MCS3_TXBF2MCS4_TXBF2MCS5_TXBF2MCS6_TXBF2MCS7_TXBF2VHT8SS1_TXBF2VHT9SS1_TXBF2VHT10SS1_TXBF2VHT11SS1_TXBF2MCS8_TXBF1MCS9_TXBF1MCS10_TXBF1MCS11_TXBF1MCS12_TXBF1MCS13_TXBF1MCS14_TXBF1MCS15_TXBF1VHT8SS2_TXBF1VHT9SS2_TXBF1VHT10SS2_TXBF1VHT11SS2_TXBF1MCS16_TXBF0MCS17_TXBF0MCS18_TXBF0MCS19_TXBF0MCS20_TXBF0MCS21_TXBF0MCS22_TXBF0MCS23_TXBF0VHT8SS3_TXBF0VHT9SS3_TXBF0VHT10SS3_TXBF0VHT11SS3_TXBF0OFDM6_TXBF3OFDM9_TXBF3OFDM12_TXBF3OFDM18_TXBF3OFDM24_TXBF3OFDM36_TXBF3OFDM48_TXBF3OFDM54_TXBF3MCS0_TXBF3MCS1_TXBF3MCS2_TXBF3MCS3_TXBF3MCS4_TXBF3MCS5_TXBF3MCS6_TXBF3MCS7_TXBF3VHT8SS1_TXBF3VHT9SS1_TXBF3VHT10SS1_TXBF3VHT11SS1_TXBF3MCS8_TXBF2MCS9_TXBF2MCS10_TXBF2MCS11_TXBF2MCS12_TXBF2MCS13_TXBF2MCS14_TXBF2MCS15_TXBF2VHT8SS2_TXBF2VHT9SS2_TXBF2VHT10SS2_TXBF2VHT11SS2_TXBF2MCS16_TXBF1MCS17_TXBF1MCS18_TXBF1MCS19_TXBF1MCS20_TXBF1MCS21_TXBF1MCS22_TXBF1MCS23_TXBF1VHT8SS3_TXBF1VHT9SS3_TXBF1VHT10SS3_TXBF1VHT11SS3_TXBF1MCS24_TXBF0MCS25_TXBF0MCS26_TXBF0MCS27_TXBF0MCS28_TXBF0MCS29_TXBF0MCS30_TXBF0MCS31_TXBF0VHT8SS4_TXBF0VHT9SS4_TXBF0VHT10SS4_TXBF0VHT11SS4_TXBF0DSSSOFDMMCS0_7VHT8_9SS1VHT10_11SS1DSSS_MULTI1OFDM_CDD1MCS0_7_CDD1VHT8_9SS1_CDD1VHT10_11SS1_CDD1MCS0_7_STBCVHT8_9SS1_STBCVHTi10_11SS1_STBCMCS8_15VHT8_9SS2VHT10_11SS2DSSS_MULTI2OFDM_CDD2MCS0_7_CDD2VHT8_9SS1_CDD2VHT10_11SS1_CDD2MCS0_7_STBC_SPEXP1VHT8_9SS1_STBC_SPEXP1VHT10_11SS1_STBC_SPEXP1MCS8_15_SPEXP1VHT8_9SS2_SPEXP1VHT10_11SS2_SPEXP1MCS16_23VHT8_9SS3VHT10_11SS3DSSS_MULTI3OFDM_CDD3MCS0_7_CDD3VHT8_9SS1_CDD3VHT10_11SS1_CDD3MCS0_7_STBC_SPEXP2VHT8_9SS1_STBC_SPEXP2VHT10_11SS1_STBC_SPEXP2MCS8_15_SPEXP2VHT8_9SS2_SPEXP2VHT10_11SS2_SPEXP2MCS16_23_SPEXP1VHT8_9SS3_SPEXP1VHT10_11SS3_SPEXP1MCS24_31VHT8_9SS4VHT10_11SS4OFDM_TXBF1MCS0_7_TXBF1VHT8_9SS1_TXBF1VHT10_11SS1_TXBF1MCS8_15_TXBF0VHT8_9SS2_TXBF0VHT10_11SS2_TXBF0OFDM_TXBF2MCS0_7_TXBF2VHT8_9SS1_TXBF2VHT10_11SS1_TXBF2MCS8_15_TXBF1VHT8_9SS2_TXBF1VHT10_11SS2_TXBF1MCS16_23_TXBF0VHT8_9SS3_TXBF0VHT10_11SS3_TXBF0OFDM_TXBF3MCS0_7_TXBF3VHT8_9SS1_TXBF3VHT10_11SS1_TXBF3MCS8_15_TXBF2VHT8_9SS2_TXBF2VHT10_11SS2_TXBF2MCS16_23_TXBF1VHT8_9SS3_TXBF1VHT10_11SS3_TXBF1MCS24_31_TXBF0VHT8_9SS4_TXBF0VHT10_11SS4_TXBF0%s: MALLOC(%d) failed %s: Failed ppr_t:%p BW:%d TX_Chain:%d rateset:%p %s: Failed ppr_t:%p BW:%d mode:%d TX_Chain:%d rateset:%p %s: Failed ppr_t:%p BW:%d Nss:%d mode:%d TX_Chain:%d rateset:%p %s: Failed ppr_t:%p BW:%d TX_Chain:%d power:%d %s: Failed ppr_t:%p BW:%d mode:%d TX_Chain:%d power:%d %s: Failed ppr_t:%p BW:%d Nss:%d mode:%d TX_Chain:%d power:%d %d.%d.%d.%d0x%X>%s: %04x: ERR%d%d.%d%c%03xWEP1AES_CCMAES_OCB_MSDUAES_OCB_MPDUNALGUNDEFWAPIPMKBIPAES_GCMAES_CCM256AES_GCM256BIP_CMAC256BIP_GMACBIP_GMAC256bcm_pack_xtlv_entry: no space tlv_buf: requested:%d, available:%d %s %d: Invalid sbuflen %d z-len, skip unpackxtlv_unpack Error: found[type:%d,len:%d] != xpct[type:%d,len:%d] l%s%d%s%d%s%s%d/%s%d/80+80/%d-%dinvalid 0x%04x80+80wl_cntbuf_to_xtlv_format malloc fail!wlcntverXXt_to_wlcntwlct and src_max_idx need to be of uint16 instead of uint8 Try updating wl utility to the latest.wl_copy_wlccnt fail!wl_copy_macstat_ver11 fail!wl_copy_macstat_upto_ver10 fail!%s: missing " = " in long param "%s" %s: missing value after " = " in long param "%s" %s: only single char options, error on param "%s" %s: missing value parameter after "%s" patrim Incorrect version of RADAR_ARGS struct: expected %d; got %d version %d npulses %d ncontig %d min_pw %d max_pw %d thresh0 0x%x thresh1 0x%x blank 0x%x fmdemodcfg 0x%x npulses_lp %d min_pw_lp %d max_pw_lp %d min_fm_lp %d max_span_lp %d min_deltat %d max_deltat %d autocorr 0x%x st_level_time 0x%x t2_min %d fra_pulse_err %d npulses_fra %d npulses_stg2 %d npulses_stg3 %d percal_mask 0x%x quant %d min_burst_intv_lp %d max_burst_intv_lp %d nskip_rst_lp %d max_pw_tol %d feature_mask 0x%x %d %d %d %d %d 0x%x 0x%x 0x%x 0x%x %d %d %d %d %d %d %d 0x%x 0x%x %d %d %d %d %d 0x%x %d %d %d %d %d 0x%x %d %d CCK %d OFDM %d 0x%x(%d) Lost frame count %d RSSI %d Signal to noise ratio %d rx1mbps %d rx2mbps %d rx5mbps5 %d rx6mbps %d rx9mbps %d, rx11mbps %d rx12mbps %d rx18mbps %d rx24mbps %d rx36mbps %d rx48mbps %d rx54mbps %d rxmcs%d %d rxmcsother %d not supported on this chiprssi[%d] %d maxp2ga0Missing maxp2ga0maxp2ga1Missing maxp2ga1maxp5ga0Missing maxp5ga0maxp5ga1Missing maxp5ga1maxp5gla0Missing maxp5gla0maxp5gla1Missing maxp5gla1maxp5gha0Missing maxp5gha0maxp5gha1Missing maxp5gha1maxpowerwl_phy_maxpower: fail to setwl_phy_maxpower: fail to get maxpowermaxp2ga0=%x maxp2ga1=%x maxp5ga0=%x maxp5ga1=%x maxp5gla0=%x maxp5gla1=%x maxp5gha0=%x maxp5gha1=%x wl_phy_povars: fail to setphy %x band %x err %d cck2gpo=0x%x ofdm2gpo=0x%x ofdm5glpo=0x%x ofdm5gpo=0x%x ofdm5ghpo=0x%x %s=0x%x wl_phy_pavars: fail to setphy %x band %x chain %d err %d %s=force_vsdb_chansChans : %x %x unable to allocate Memory Set rifs mode advertisement error %d PHY DEBUG COMMAND error %d Set frameburst error %d Set rifs error %d Usage: %s antenna_index[0-3] nphy_rssiant nphy_rssiant ant%d = %d phymsglevelNeed to specify at least one parameter IOVAR works only for up to 3 cores. %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d %d IOVAR works only for 4 cores scenario. IOVAR works only for 2 cores scenario. rssi_cal_revpkteng_stoppkteng_starttxwithackasyncsyncrxwithackInvalid command name %s pktengfem2gwl_phy_fem: fail to set fem2gfem2g setfem5gwl_phy_fem: fail to set fem5gfem5g setwl_phy_fem: fail to get fem2gtssipos2g=0x%x extpagain2g=0x%x pdetrange2g=0x%x triso2g=0x%x antswctl2g=0x%x wl_phy_fem: fail to get fem5gtssipos5g=0x%x extpagain5g=0x%x pdetrange5g=0x%x triso5g=0x%x antswctl5g=0x%x rpcal2gcore3rpcal5gb0core3rpcal5gb1core3rpcal5gb2core3rpcal5gb3core3wl_phy_rpcalvars: fail to setwl_phy_rpcalvars: fail to found matching rpcalvar namewl_phy_rpcalvars: fail to getrpcal2g=0x%x rpcal5gb0=0x%x rpcal5gb1=0x%x rpcal5gb2=0x%x rpcal5gb3=0x%x rpcal2gcore3=0x%x rpcal5gb0core3=0x%x rpcal5gb1core3=0x%x rpcal5gb2core3=0x%x rpcal5gb3core3=0x%x txpwrindex for core{0...3}: %d %d %d %d HTPHY must specify 3 core txpwrindexNPHY must specify 2 core txpwrindexwl_rxiqest%s: could not parse "%s" as an int for gain-correction (0, 1, 2, 3, 4, 7, 8) %s: invalid gain-correction select %d (0,1,2,3,4,7,8) %s: could not parse "%s" as an int for lpf-hpc override select (0, 1) %s: invalid lpf-hpc override select %d (0,1) %s: could not parse "%s" as an int for dig-lpf override select (0, 1 or 2) %s: invalid dig-lpf override select %d (0,1,2) %s: could not parse "%s" as an int for resolution (0, 1) %s: invalid resolution select %d (0,1) %s: could not parse "%s" as an int for the sample count %s: sample count too large %d(10 <= x <= 16) %s: could not parse "%s" as an int for antenna (0, 1, 3) %s: invalid antenna select %d %s: could not parse "%s" as an int for extra INITgain %s: Valid extra INITgain = {0, 3, .., 21, 24} %s: could not parse "%s" as an int for init or clipLO mode %s: Valid options - 0(default gain), 1(init gain)or 4(clip LO gain). -%d.%ddBm %d.%ddBm %ddBm %ddBm %ddBm %ddBm %ddBm %ddBm %ddBm %ddBm %ddBm %ddBm %ddBm Interference override disabled.Interference override NONE, all mitigation disabled. (mode 0) Interference override mode = %d. Following ACI modes are enabled: bit-mask %d: Reciever Desense based on glitch count bit-mask %d: Limit pktgain based on hwaci (high pwr aci) bit-mask %d: Limit pktgain based on w2/nb (high pwr aci) bit-mask %d: Preemption is enabled bit-mask %d: HW ACI Detection + Mitigation bit-mask %d: Low Power Detect Preemption Interference override enabled. Non-wireless LAN Interference mitigation is enabled. (mode 1)Interference override enabled. Wireless LAN Interference mitigation is enabled. (mode 2)Interference override enabled. Interference mitigation is enabled and active. (mode 3)not active. (mode 3)active, not active, and noise reduction is enabled. (mode 4)Low Power Detect Preemption (bit 5) requires Preemption (bit3) to be enabled All interference mitigation is disabled. (mode 0) Mode = %d. Following ACI modes are enabled: Non-wireless LAN Interference mitigation is enabled. (mode 1)Wireless LAN Interference mitigation is enabled. (mode 2)Auto Wireless LAN Interference mitigation is enabled and tx %s bb/radio/ctl1 %d/%d/%d manualCannot get ACI argsaci_args.enter_aci_thresh = %d Glitch count to enter ACI scan mode: %d Glitch count to exit ACI mode: %d Usecs to spin between rssi samples : %d Interval (in seconds) for ACI scanning in presence of high glitch count: %d (NPHY) Glitch count to enter ACI scan mode: %d (NPHY) ADC power to enter ACI Mitigation mode: %d (NPHY) ADC power to exit ACI Mitigation mode: %d (NPHY) Number of tries per channel to compute power: %d (NPHY) Number of samples to use to compute power on a channel: %d (NPHY) # Undetects to wait before coming out of ACI Mitigation mode: %d (NPHY) bphy energy threshold for low aci pwr: %d (NPHY) bphy energy threshold for medium aci pwr: %d (NPHY) bphy energy threshold for high aci pwr: %d (NPHY) nphy_noise_noassoc_glitch_th_up: %d (NPHY) nphy_noise_noassoc_glitch_th_dn: %d (NPHY) nphy_noise_assoc_glitch_th_up: %d (NPHY) nphy_noise_assoc_glitch_th_dn: %d (NPHY) nphy_noise_assoc_aci_glitch_th_up: %d (NPHY) nphy_noise_assoc_aci_glitch_th_dn: %d (NPHY) nphy_noise_assoc_enter_th: %d (NPHY) nphy_noise_noassoc_enter_th: %d (NPHY) nphy_noise_assoc_rx_glitch_badplcp_enter_th: %d (NPHY) nphy_noise_noassoc_crsidx_incr: %d (NPHY) nphy_noise_assoc_crsidx_incr: %d (NPHY) nphy_noise_crsidx_decr: %d Cannot get ACI args for settingenterspinglitchadcpwr_enteradcpwr_exitrepeatsamplesundetect_szloacimdacihiacinphy_noise_noassoc_glitch_th_upnphy_noise_noassoc_glitch_th_dnnphy_noise_assoc_glitch_th_upnphy_noise_assoc_glitch_th_dnnphy_noise_assoc_aci_glitch_th_upnphy_noise_assoc_aci_glitch_th_dnnphy_noise_noassoc_enter_thnphy_noise_assoc_enter_thnphy_noise_assoc_rx_glitch_badplcp_enter_thnphy_noise_assoc_crsidx_incrnphy_noise_noassoc_crsidx_incrnphy_noise_crsidx_decrBad parameter specificationInvalid value for %s Need to specify a valueCannot set ACI argsLast B phy CCK est. power: %2d.%d dBm Last B phy OFDM est. power: %2d.%d dBm Last A phy est. power: %2d.%d dBm Expect SampleData Header type %d, receive type %d Header sync word mismatch (0x%08x) Failed write file-header to file %d sample_dataError reading back sample collected data Expect SampleData type %d, receive type %d Done retrieving sample data Wrote %d bytes sample_collect.dat-fcrscrs_deassertgood_fcsbad_fcsbad_plcpcrs_glitchgpio-k--agc--filter-yMax number of samples supported = %d 0x%x%x,0x%x%x ,Insufficient arguments NULLbw40bw80bw4080cckNULL, bw40NULL, bw80NULL, bw4080NULL, cckbw40, bw80NULL, bw40, bw80NULL, bw40, cckcalthermalpapdrxiqfcbsRestart driver. Driver must already be down.set phy debugging message bitvector type 'wl phymsglevel ?' for valuesGet the tssi value from radioTurn the tx path power on or off on 2050 radiosSet the transmit power for A band(0-63). -1 - default valueSet the transmit attenuation for B band. Args: bb radio txctl1. auto to revert to automatic control manual to supspend automatic controlGet/Set a phy register: offset [ value ] [ band ]Get/Set a radio register: offset [ value ] [ band/core ] HTPHY: Get a radio register: wl radioreg [ offset ] [ cr0/cr1/cr2 ] Set a radio register: wl radioreg [ offset ] [ value ] [ cr0/cr1/cr2/all ] ACPHY: Get a radio register: wl radioreg [ offset ] [ cr0/cr1/cr2/pll ] Set a radio register: wl radioreg [ offset ] [ value ] [ cr0/cr1/cr2/pll/all ]Get/Set various aci tuning parameters. Choices are: enter: CRS glitch trigger level to start detecting ACI exit: CRS glitch trigger level to exit ACI mode glitch Seconds interval between ACI scans when glitchcount is continuously high spin: Num microsecs to delay between rssi samples enter: (NPHY) CRS glitch trigger level to start detecting ACI adcpwr_enter: (NPHY) ADC power to enter ACI Mitigation mode adcpwr_exit: (NPHY) ADC power to exit ACI Mitigation mode repeat: (NPHY) Number of tries per channel to compute power samples: (NPHY) Number of samples to use to compute power on a channel undetect_sz: (NPHY) # Undetects to wait before coming out of ACI Mitigation mode loaci: (NPHY) bphy energy threshold for low aci pwr mdaci: (NPHY) bphy energy threshold for medium aci pwr hiaci: (NPHY) bphy energy threshold for hi aci pwr Usage: wl aciargs [enter x][exit x][spin x][glitch x]phy_afeoverrideg/set AFE overridepcieserdesregg/set SERDES registers: dev offset [val]Return tx power based on instant TSSI Start an EVM test on the given channel, or stop EVM test. Arg 1 is channel number 1-14, or "off" or 0 to stop the test. Arg 2 is optional rate (1, 2, 5.5 or 11)Get noise (moving average) right after tx in dBmManufacturing test: set frequency accuracy mode. freqacuracy syntax is: fqacurcy Arg is channel number 1-14, or 0 to stop the test.Manufacturing test: set carrier suppression mode. carriersuprs syntax is: crsuprs Arg is channel number 1-14, or 0 to stop the test.Manufacturing test: set longtraining mode. longtrain syntax is: longtrain Arg is A band channel number or 0 to stop the test.NON-ACPHY. Get/Set interference mitigation mode. Choices are: 0 = none 1 = non wlan 2 = wlan manual 3 = wlan automatic 4 = wlan automatic with noise reduction ACPHY. Get/Set interference mitigation mode. Bit-Mask: 0 = desense based on glitches 1 = limit pktgain based on hwaci (high pwr aci) 2 = limit pktgain based on w2/nb (high pwr aci) 3 = enable preemption 4 = enable HWACI based mitigation 5 = enable low power detect preemption (requires bit 3 - preemption - to be set too) So a value of 63 would enable all six interference_overrideNON-ACPHY. Get/Set interference mitigation override. Choices are: 0 = no interference mitigation 1 = non wlan 2 = wlan manual 3 = wlan automatic 4 = wlan automatic with noise reduction -1 = remove override, override disabled ACPHY. Get/Set interference mitigation mode. Bit-Mask: -1 = remove override, override disabled 0 = desense based on glitches 1 = limit pktgain based on hwaci (high pwr aci) 2 = limit pktgain based on w2/nb (high pwr aci) 3 = enable preemption 4 = enable HWACI based mitigation 5 = enable low power detect preemption (requires bit 3 - preemption - to be set too) So a value of 63 would enable all six phy_txpwrindexusage: (set) phy_txpwrindex core0_idx core1_idx core2_idx core3_idx (get) phy_txpwrindex, return format: core0_idx core1_idx core2_idx core3_idxSet/Get txpwrindexrssi_cal_freq_grp_2gusage: wl_rssi_cal_freq_grp_2g [chan_1_2,chan_3_4,...,chan_13_14] Each of the variables like - chan_1_2 is a byteUpper nibble of this byte is for chan1 and lower for chan2MSB of the nibble tells if the channel is used for calibration3 LSB's tell which group the channel falls inSet/get rssi calibration frequency groupingphy_rssi_gain_delta_2gb0usage: phy_rssi_gain_delta_2gb0 [val0 val1 ....] Number of arguments can be - 8 for single core (4345 and 4350) 9 by specifying core_num followed by 8 arguments (4345 and 4350) 16 for both cores (4350)Set/get rssi gain delta valuesphy_rssi_gain_delta_2gb1usage: phy_rssi_gain_delta_2gb1 [val0 val1 ....] Number of arguments can be - 8 for single core (4345 and 4350) 9 by specifying core_num followed by 8 arguments (4345 and 4350) 16 for both cores (4350)Set/get rssi gain delta valuesphy_rssi_gain_delta_2gb2usage: phy_rssi_gain_delta_2gb2 [val0 val1 ....] Number of arguments can be - 8 for single core (4345 and 4350) 9 by specifying core_num followed by 8 arguments (4345 and 4350) 16 for both cores (4350)Set/get rssi gain delta valuesphy_rssi_gain_delta_2gb3usage: phy_rssi_gain_delta_2gb3 [val0 val1 ....] Number of arguments can be - 8 for single core (4345 and 4350) 9 by specifying core_num followed by 8 arguments (4345 and 4350) 16 for both cores (4350)Set/get rssi gain delta valuesphy_rssi_gain_delta_2gb4usage: phy_rssi_gain_delta_2gb4 [val0 val1 ....] Number of arguments can be - 8 for single core (4345 and 4350) 9 by specifying core_num followed by 8 arguments (4345 and 4350) 16 for both cores (4350)Set/get rssi gain delta valuesphy_rssi_gain_delta_2gusage: phy_rssi_gain_delta_2g [val0 val1 ....] Set/get rssi gain delta valuesphy_rssi_gain_delta_5glusage: phy_rssi_gain_delta_5gl [val0 val1 ....] Set/get rssi gain delta valuesphy_rssi_gain_delta_5gmlusage: phy_rssi_gain_delta_5gml [val0 val1 ....] Set/get rssi gain delta valuesphy_rssi_gain_delta_5gmuusage: phy_rssi_gain_delta_5gmu [val0 val1 ....] Set/get rssi gain delta valuesphy_rssi_gain_delta_5ghusage: phy_rssi_gain_delta_5gh [val0 val1 ....] Set/get rssi gain delta valuesphy_rxgainerr_2gusage: phy_rxgainerr_2g [val0 val1 ....] Set/get rx gain delta valuesphy_rxgainerr_5glusage: phy_rxgainerr_5gl [val0 val1 ....] Set/get rx gain delta valuesphy_rxgainerr_5gmusage: phy_rxgainerr_5gml [val0 val1 ....] Set/get rx gain delta valuesphy_rxgainerr_5ghusage: phy_rxgainerr_5gmu [val0 val1 ....] Set/get rx gain delta valuesphy_rxgainerr_5guusage: phy_rxgainerr_5gh [val0 val1 ....] Set/get rx gain delta valuesphy_test_tssiwl phy_test_tssi valphy_test_tssi_offswl phy_test_tssi_offs valphy_rssiantwl phy_rssiant antindex(0-3)Get RSSI per antenna (only gives RSSI of current antenna for SISO PHY)phy_test_idletssiget idletssi for the given core; wl phy_test_idletssi corenumphy_setrptblpopulate the reciprocity compensation table based on SROM cal content usage: wl phy_setrptblphy_forceimpbfforce the beamformer into implicit TXBF mode and ready to construct steering matrix usage: wl phy_forceimpbfphy_forcesteerforce the beamformer to apply steering matrix when TXBF is turned on usage: wl phy_forcesteer 1/0phy_force_gainlevelForce rxgain level 0 : force to init gain 1 : force to clip hi gain 2 : force to clip md gain 3 : force to clip lo gain 4 : force to adc clip gain 5 : force to nb clip gain 6 : force to wb clip gain -1 : disable usage: wl phy_force_gainlevel phy_force_fdiqiEnable/disable FDIQI Cal/Comp 0 : disable 1 : enable usage: wl phy_force_fdiqi phy_btcoex_desenseEnable/disable btcoex desense 0 : disable 1 : mode 1 usage: wl phy_btcoex_desense lcnphy_papdepstblprint papd eps table; Usage: wl lcnphy_papdepstblphy_debug_cmdgeneral purpose command for phy debugging phy function call can be added to wlc_phy_cmn.c usage: wl phy_debug_cmd set/get the rifs status; usage: wl rifs <1/0> (On/Off)rifs_advertset/get the rifs mode advertisement status; usage: wl rifs_advert <-1/0> (Auto/Off)phy_rxiqestGet phy RX IQ noise in dBm: -s # of samples (2^n) -a antenna select, 0,1,2 or 3 -r resolution select, 0 (coarse) or 1 (fine) -f lpf hpc override select, 0 (hpc unchanged) or 1 (overridden to ltrn mode) -w dig lpf override select, 0 (lpf unchanged) or 1 (overridden to ltrn_lpf mode) or 2 (bypass) -g gain-correction select, 0 (disable), 1(enable full correction) 2 (enable temperature correction) or 3(verify rssi_gain_delta) -e extra INITgain in dB on top of default. Valid values = {0, 3, 6, .., 21, 24} -i gain mode select, 0 (default gain), 1 (init gain) or 4 (clip LO gain).phy_txiqccusage: phy_txiqcc [a b] Set/get the iqcc a, b valuesphy_txloccusage: phy_txlocc [di dq ei eq fi fq] Set/get locc di dq ei eq fi fq valuesphytableusage: wl phytable table_id offset width_of_table_element [table_element] Set/get table element of a table with the given ID at the given offset Note that table width supplied should be 8 or 16 or 32 table ID, table offset can not be negativeSet/get channels for forced vsdb mode usage: wl force_vsdb_chans chan1 chan2 Note: Give chan in the same format as chanspec: eg force_vsdb_chans 1l 48upavarsSet/get temp PA parameters usage: wl down wl pavars pa2gw0a0=0x1 pa2gw1a0=0x2 pa2gw2a0=0x3 ... wl pavars wl up override the PA parameters after driver attach(srom read), before diver up These override values will be propogated to HW when driver goes up PA parameters in one band range (2g, 5gl, 5g, 5gh) must all present if one of them is specified in the command, otherwise it will be filled with 0povarsSet/get temp power offset usage: wl down wl povars cck2gpo=0x1 ofdm2gpo=0x2 mcs2gpo=0x3 ... wl povars wl up override the power offset after driver attach(srom read), before diver up These override values will be propogated to HW when driver goes up power offsets in one band range (2g, 5gl, 5g, 5gh) must all present if one of them is specified in the command, otherwise it will be filled with 0 cck(2g only), ofdm, and mcs(0-7) for NPHY are supported rpcalvarsSet/get temp RPCAL parameters usage: wl down wl rpcalvars rpcal2g=0x1 wl rpcalvars wl up override the RPCAL parameters after driver attach(srom read), before diver up These override values will be propogated to HW when driver goes up Only the RPCAL parameter specified in the command is updated, the rest is untouchedfemSet temp fem2g/5g value usage: wl fem (tssipos2g=0x1 extpagain2g=0x2 pdetrange2g=0x1 triso2g=0x1 antswctl2g=0) (tssipos5g=0x1 extpagain5g=0x2 pdetrange5g=0x1 triso5g=0x1 antswctl5g=0)Set temp maxp2g(5g)a0(a1) value usage: wl maxpower maxp2ga0=0x1 maxp2ga1=0x2 maxp5ga0=0xff maxp5ga1=0xff maxp5gla0=0x3 maxp5gla1=0x4 maxp5gha0=0x5 maxp5gha1=0x6Optional parameters ACPHY/HTPHY/(NPHY with NREV >= 7) are: -f File name to dump the sample buffer (default "sample_collect.dat") -t Trigger condition (default now) now, good_fcs, bad_fcs, bad_plcp, crs, crs_glitch, crs_deassert -b PreTrigger duration in us (default 10) -a PostTrigger duration in us (default 10) -m Sample collect mode (default 1) SC_MODE_0_sd_adc 0 SC_MODE_1_sd_adc_5bits 1 SC_MODE_2_cic0 2 SC_MODE_3_cic1 3 SC_MODE_4s_rx_farrow_1core 4 SC_MODE_4m_rx_farrow 5 SC_MODE_5_iq_comp 6 SC_MODE_6_dc_filt 7 SC_MODE_7_rx_filt 8 SC_MODE_8_rssi 9 SC_MODE_9_rssi_all 10 SC_MODE_10_tx_farrow 11 SC_MODE_11_gpio 12 SC_MODE_12_gpio_trans 13 SC_MODE_14_spect_ana 14 SC_MODE_5s_iq_comp 15 SC_MODE_6s_dc_filt 16 SC_MODE_7s_rx_filt 17 HTPHY: 0=adc, 1..3=adc+rssi, 4=gpio NPHY: 1=Dual-Core adc[9:2], 2=Core0 adc[9:0], 3=Core1 adc[9:0], gpio=gpio -g GPIO mux select (default 0) use only for gpio mode -d Downsample enable (default 0) use only for HTPHY -e BeDeaf enable (default 0) -i Timeout in units of 10us. (ACPHY is in 10ms unit) (default 1000) Optional parameters (NPHY with NREV < 7) are: -f File name to dump the sample buffer (binary format, default "sample_collect.dat") -u Sample collect duration in us (default 60) -c Cores to do sample collect, only if BW=40MHz (default both) Optional parameters LCN40PHY are: -f File name to dump the sample buffer (default "sample_collect.dat") -t Trigger condition (default now) now -s Trigger State (default 0) -x Module_Sel1 (default 2) -y Module_Sel2 (default 6) -n Number of samples (Max 2048, default 2048) For (NREV < 7), the NPHY buffer returned has the format: In 20MHz [(uint16)num_bytes, ] In 40MHz [(uint16)num_bytes(core0), , (uint16)num_bytes(core1), ]start packet engine tx usage: wl pkteng_start [(async)|sync] [ipg] [len] [nframes] [src] start packet engine rx usage: wl pkteng_start [(async)|sync] [rxframes] [rxtimeout] sync: synchronous mode ipg: inter packet gap in us len: packet length nframes: number of frames; 0 indicates continuous tx test src: source mac address rxframes: number of receive frames (sync mode only) rxtimeout: maximum timout in msec (sync mode only)stop packet engine; usage: wl pkteng_stop pkteng_statspacket engine stats; usage: wl pkteng_statsphy_force_crsminAuto crsmin: phy_force_crsmin -1 Default crsmin value phy_force_crsmin 0 Set the crsmin value phy_force_crsmin core0_th core1_offset core2_offset Threshold values = 2.5 x NoisePwr_dBm + intercept where NoisePwr_dBm ~= -36/-33/-30dBm for 20/40/80MHz, respectively Intercept = 132/125/119 for 20/40/80MHz, respectivelyGet/Set Radar parameters in order as version, npulses, ncontig, min_pw, max_pw, thresh0, thresh1, blank, fmdemodcfg, npulses_lp, min_pw_lp, max_pw_lp, min_fm_lp, max_span_lp, min_deltat, max_deltat, autocorr, st_level_time, t2_min, fra_pulse_err, npulses_fra, npulses_stg2, npulses_stg3, percal_mask, quant, min_burst_intv_lp, max_burst_intv_lp, nskip_rst_lp, max_pw_tol, feature_maskGet/Set Radar parameters for 40Mhz channel in order as version, npulses, ncontig, min_pw, max_pw, thresh0, thresh1, blank, fmdemodcfg, npulses_lp, min_pw_lp, max_pw_lp, min_fm_lp, max_span_lp, min_deltat, max_deltat, autocorr, st_level_time, t2_min, fra_pulse_err, npulses_fra, npulses_stg2, npulses_stg3, percal_mask, quant, min_burst_intv_lp, max_burst_intv_lp, nskip_rst_lp, max_pw_tol, feature_maskradarthrsSet Radar threshold for both 20 & 40MHz & 80MHz BW: order as thresh0_20_lo, thresh1_20_lo, thresh0_40_lo, thresh1_40_lo thresh0_80_lo, thresh1_80_lo, thresh0_20_hi, thresh1_20_hi thresh0_40_hi, thresh1_40_hi, thresh0_80_hi, thresh1_80_hiGet PA trim optionmcs2gpo0 mcs2gpo1 mcs2gpo2 mcs2gpo3 mcs2gpo4 mcs2gpo5 mcs2gpo6 mcs2gpo7mcs5glpo0 mcs5glpo1 mcs5glpo2 mcs5glpo3 mcs5glpo4 mcs5glpo5 mcs5glpo6 mcs5glpo7mcs5gpo0 mcs5gpo1 mcs5gpo2 mcs5gpo3 mcs5gpo4 mcs5gpo5 mcs5gpo6 mcs5gpo7mcs5ghpo0 mcs5ghpo1 mcs5ghpo2 mcs5ghpo3 mcs5ghpo4 mcs5ghpo5 mcs5ghpo6 mcs5ghpo7pa2ga0pa2ga1pa2gccka1pa5ga0pa5ga1pa2ga2pa2ga3pa2g40a0pa2g40a1pa2g40a2pa2g40a3pa5ga2pa5ga3pa5g40a0pa5g40a1pa5g40a2pa5g40a3pa5g80a0pa5g80a1pa5g80a2pa5g80a3pa2gw0a0 pa2gw1a0 pa2gw2a0pa2gw0a1 pa2gw1a1 pa2gw2a1pa2gw0a2 pa2gw1a2 pa2gw2a2pa5glw0a0 pa5glw1a0 pa5glw2a0pa5glw0a1 pa5glw1a1 pa5glw2a1pa5glw0a2 pa5glw1a2 pa5glw2a2pa5gw0a0 pa5gw1a0 pa5gw2a0pa5gw0a1 pa5gw1a1 pa5gw2a1pa5gw0a2 pa5gw1a2 pa5gw2a2pa5ghw0a0 pa5ghw1a0 pa5ghw2a0pa5ghw0a1 pa5ghw1a1 pa5ghw2a1pa5ghw0a2 pa5ghw1a2 pa5ghw2a2pa5gw0a3 pa5gw1a3 pa5gw2a3pa5glw0a3 pa5glw1a3 pa5glw2a3pa5ghw0a3 pa5ghw1a3 pa5ghw2a32G5G%s channel monitor duration = %d RSSIcuno of entries in table: %d %s factor table low high factor%d %d %d Mode is required Mode can only be 0 or 1cck rssi-2g:%d, cck rssi-5g:ofdm rssi-2g:ofdm rssi-5g:phy_n 1x1 rssi-2g:phy_n 1x1 rssi-5g:phy_n 2x2 rssi-2g:phy_n 2x2 rssi-5g:phy_ac 1x1 rssi-2g:phy_ac 1x1 rssi-5g:phy_ac 2x2 rssi-2g:phy_ac 2x2 rssi-5g:ofdm11n11acWrong phy-type: only cck/ofdm/11n/11ac supportedcck not allowed on 5gWrong band-type: only '2g' and '5g' are supportedWrong number of streams: Only 1 to 4 supportedOnly 1 stream allowed for CCK/OFDMofdm rssi-%sg: 11N streams:%dx%d rssi-%sg: 11AC streams:%dx%d rssi-%sg: Insufficient params for mode 1period %u scans allowed per period %u extra argumentsTIMBC offset: %d, tsf_present: %d, fix_interval: %d, rate_override: %d Missing argumentMissing argumentextra argumentMissing argumentToo much args provided%s: error: reqmode missing %s: error: tbtt missing %s: error: tbtt out of range(%d) %s: error: dur missing %s: error: dur out of range(%d) %s URL len %d %s URL: %s URL string should be specified for URL length %d length is not matching to string Ignoring data bytes for length %d Keepalives_max_idle parameters -num_of_keepalives_per_bss_max_idle = %d mkeep_alive_index = %d max_interval = %d BSS Max Idle Period: %d wnm_tfsreq_addIncorrect args providedInput args not in rangeTIM BC current status: %d status_ap: %d interval: %d offset: %d high rate: %s low rate: %s Missing argumentToo many argumentsup %d type %d mask 0x%x (Eth: %cSA %s %cDA %s %ctype 0x%04x)(IPv4: %cver %d %csip %s %cdip %s %csp %d %cdp %d %cdscp 0x%x %cprot %d(IPv6: %cfl %d(type unsupported)DMS desc UserID %d: status:%d token:%d DMS ID:%d TCLAS proc:%d Registered STA: - %s TCLAS: - No tclas frame classifier parameter entrytclas idx %d: TCLAS Frame Classifier: %s not provided user prioritytypemasksrc mac ERROR: no valid src ether addr provideddst mac ERROR: no valid dst ether addr providedether typeip versionipv6 source ipincorrect ipv6 source ip formatipv6 dest ipincorrect ipv6 dest ip formatipv6 source portipv6 dest portipv6 dscpipv6 next headeripv6 flow labelipv4 source ipincorrect source ip formatipv4 dest ipincorrect dest ip formatipv4 source portipv4 dest portipv4 dscpipv4 protocolUnsupported frame classifier type 0x%2x 0x%x: %sWNM mask is a bitfield from the following set. Use + or - prefix to combine with current value: 0x%04x %s %s %s trigger = %d bad range, rssi should be less than 0bad range, cu should be less than 0%s %s weight = %d wnm_bsstrans_queryBSS-TransitionProxy-ARPBSS-Max-Idle-PeriodTIM-BroadcastTraffic-FilteringWNM-Sleep-ModeDirected-MulticastFlexible-MulticastNotificationset driver wnm feature mask type 'wl msglevel ?' for valueswnm_bsstqsend 11v BSS transition management query Usage: wl wnm_bsstq [ssid]tclas_addadd tclas frame classifier type entry Usage: wl tclas_add <...> type 0 eth2: type 1/4 ipv4: type 2 802.1Q: type 3 filter: type 4 ipv6: type 5 802.1D/Q: <802.1Q PCP> <802.1Q CFI> <802.1Q VID>tclas_deldelete tclas frame classifier type entry Usage: wl tclas_del [ []]tclas_listlist the added tclas frame classifier type entry Usage: wl tclas_listadd one tfs request element and send tfs request frame Usage: wl wnm_tfsreq_add tfs_id: a non-zero value (1 ~ 255) tfs_action_code bitfield: 1: delete after match, 2: notify tfs_subelem_id: TFS subelement (0 for none or 1 for previous tclas_add) send: 0: store element, 1: send all stored elementswnm_dms_setOptionally add pending DMS desc (after tclas_add) and optionally register all desc on AP side to enable the service (with send=1) Usage: wl wnm_dms_set [ []] send: 0: store descriptor, 1: send all stored descs/enable DMS on AP user_id: new ID to assign to the created desc (if TCLAS added) or existing ID to enable on AP (if no TCLAS added), 0 for all desc tc_pro: TCLAS processing element (if several TCLAS added)wnm_dms_statuslist all DMS descriptors and provide their internal and AP status Usage: wl wl_wnm_dms_statuswnm_dms_termDisable registered DMS des on AP side and optionally discard them Usage: wl wnm_dms_term [] del: Discard desc after disabling the service on AP side user_id: desc to disable/delete, 0 for all descwnm_service_termDisable service. Check specific wnm_XXX_term for more info Usage: wl wnm_service_term srv: 1 for DMS, 2 for FMS, 3 for TFSwnm_timbc_offsetget/set TIM broadcast offset by -32768 period > offset(us) > 32768 CAUTION!! Due to resource limitation, one radio can have only one set of TIMBC offset setting. MBSS need to share the same setting Usage: wl wnm_timbc_offset [ [ []]] offset: in unit of us. Transmit TIM frame in specific TBTT transmit time time tsf_present: can be omitted. If set to 1, timestamp field will present in TIM frame.If omitted, default setup to 1 fix_interval: can be omitted. If set with non-zero value, override STA request interval in TIM Broadcast request. If omitted, default setup to 0 rate_override: can be omitted. In unit of 500k, max setup to 108. If set, overrideoverride high rate used to transmit TIM broadcast high rate framewnm_timbc_setEnable/disable TIM Broadcast. Station will send appropriate request if AP suport TIMBC Usage: wl wnm_timbc_set [ [ []]] interval: Beacon interval requested for TIM frames, 0 to disable TIM BC flags: Bitfield with minimal requirements to keep the service enabled (check doc) min_rate: Minimal rate requirement, in Mbps, for TIM high or low rate frames max_rate: Maximal rate requirementwnm_timbc_statusRetrieve TIM Broadcast configuration set with current APwnm_maxidlesetup WNM BSS Max Idle Period interval and option Usage: wl wnm_maxidle