ELF(D40]4 (pZ[[NNS[S[TY[TY]TY](x TY[TY]TY]8QtdRtdTY[TY]TY]VVGNU@-0@-SD0@ 0<<0Ϋ @jP4 0 L0ЍN$EGNNp@-P`$@z $`z 0S$Lz $Dz 0 S$0z $(p@z $ "p OOSO[O@-`pPp0 @f  $7 0 0 ]pp@-`DPP@& 0 0봤]p@-`DPP@ 0 0T]p@-`DPP@ 0 0t] p@-`DP~P@ސ 0 0\딣]Xp@-`DPfP@Ɛ 0 0Dh4]dp@-`DPNP@ᮐ 0 0,P}Ԣ]4p@-`DP6P@ᖐ 0 08et]@-(@$0@0000 0],s@-`LP P@,0` 0 0 9̡]@-p`M P`@ 003/*/P00p00<00 040 00/`]^X^XxO-Md O@P `@(0p4PV hV C`Pp >(0' Rx00000000 0 Z V( 00000 0vp 0 WpP L00 00%KQ=QL>%߿Qx>%X>%>%QpQQQjQQQQh>%cPQF%\Q>%p>%Q`>%F%>%QUTF%F%DQ>%>%_QF%vQQF%Q@0< 4        Xo`Q%^@-`m0%o`p@-P<@<`<P PP@P PPp@8o`^X& Y&@-Ah!1 !00 #!($!l0  000 0$0,0<0@0L001!1 1111HHPDDLX<< 4\00$@D(1,!014181<1P1T!X1\1`1d100 0000T0`0x|d h0l0p0t00 00000 0000tp`(?'>'Њ&O9R&O9RԊ&4&W܊&T&&D&8&@&&U &,&RT&& 00 !0 t`K'^@-0HO't`LL L0 H 00!< 0"0X<000000 st`O'/PRO'>PR^y'p@-Ph@h`h@0(00,0 0P580(4P X  00C0[* `P09S 0$.00fs 1sp1S =1S 01R0 0S=0 0|1S=0|10S  1S`P L=P$ 0` \ XP PU$PP$P(PP(PPS]<P0Q\ ,$( |0,`X0 P0P0Ex10$000:X zw|4zdztzzzzzzz{0{l{x||||,y|||||||||||||}}}}}}}}}}~(~L~T~~(4<||;0ShŔ4;堁,{[1Spa㠁V ;`8N00/S *P 2S ;PUe0S0C0p1S z*@4,.pj@(01$00 P0ip e]0`*t00 #P# I0  # 0)0zt ^ t10000(00,0At100L lޒL0/(0, x$PH0CXP`, (L00HSphhX00DP CBP |8L H Vh8pG( ,pF0[S "RV 0"S0P L P❒L00pP0Hi't#!./  P0g0Ppxp0s xPP x PἌ p`71FGE0'0QUt10S, 1(01꤁XH))kCx!0  B`60 pPx10C 'R  $  Dx1 $ U0(PP!e00 .P$00~r0P U P   (r_0Z 0P0S 4$Bxq $px10$ 0C  x1D $  x!'40 BJ0G0 (0x1,0AS|00E0C0$001, R   ,   X"01, R    00C0CS!2t100S0 00t00000 S0X5 Y 0 Q1,s 01, R$ll  00SJD0` Q00 S 0 1 01,A  Y0001  } Y  01P0PPB`00PP;`ZD \ Sf11Lap׏F000fs 0/S* 02S0PU)0 S 0@D *>0{0p1S  L^._!_GGHG!HGAHG4G^HG!_!_lGsG^}GmG6oGJGG+JG/_oHGsHGHG._HGGHGHG._RIG.IGDqGBIGIGzIGIGKGJG̙G4JGZJG!_KGdI[OGGdJGwJGJGJGJGJGKG3KG7KG>KG._ FGG(0_S0`>C`ӱp1S x |F@0  .РZP!r R00#>C210S101t1p<`X 00c0L,p1Sv0JrS񟗒꬈08p̋xd(4@LX`lt Xd0<HTT``llxxx$dlt̐  (DPd (0LXĔ8ܗp@̗ 0x8#08S0 JLP唍0 S{ ግ0*.0K 00[偍.l3p1S S#u3/ 0Fl0X0AD0@K$ 0EA000/S*02P<P 0_ C<t!0 P05/ԝ 0 8L\L8Lx <08 @00<080@004L L t l @5tQ@0L00@0B>;Cp L pnLQ @O  H 0R @  @j@0LH L00@05t 0 5!gP UwC @R@0L L00t@0= L `01(61X0Lx0Sy GlQB `6t >p6t婏96LtQLLLF /8, <0C@0<00L @0`L0S LK7tD L@9 D/ `0\ 0 00S @@0L0 L00@07tjc^r*!= 8B> C<08 @00<080@00L  8L tLxv<t8!0S6 @@0L L00@09t5 Y{ 8B> C<08 @00<080@00L  p9L tLA?\0S @b@0L L00@09tL+H]ZmW T 4Q N K HHH:tfC @4@0LL00@0 :X tq @$@0LL00@0 :Y ta @@0LL00@0 ;Z tQk  < @@0L `L00@0t;tn BPZ-P  g- 0 !D%0S v0;t10>0 <P6 A 0`0S0a UM 0R0 030#0U Q 03S0,,ǂ M y 000Y`0i&,k0S,@M &P<!R  pr'8 tZt10b>hi7 t=ptQΊppW r=t10M>H z=t10D>H  =t8XY  >t.XP 017h0`vppF@P!qH DL00 V LP0PLTH0D0@05 L0PL 0 003/L'L.@, aD LL L0 0 0 X0\ @  ?L@ 000 L@0I@ncD LL L00, L LL@xe1P h%0dPPX5[T%0PP5峆 pwuGF!@HP 0D000W %L0@0LD0H0@0L000 0L PL0  003/L00L mLL=(4, 0t  0L ]LL-L ULL{L MLL 8EB> C@<0L8 @@00<0L 80L@ 0%, 0t0 .L #LL 8B> C<0L8 @@00<0L 80L@0 0 X0\ ]%0SRP#t01d@p1S @r@"@`j*>=$c00PPPA1s S#!51p1S  A*nq0 S M=0R U1 0 30J p0[0Lwu<r8p Lk@ LLa@_]pg L@LL;@ۍ$Ѝ._PGhTGKG$EGFGSKGKG._!_+JGdI[OKGGGKG^C-PPd1M`A0 00tL1KH!0DD1B t 0tQ`0aa1 01Bq匑 W ``?Yqq嘑 W ``^Yq`P40S 0; tQ 8$0t 0 30 6pЍ^._ LG$EGFGKG._ O0 - ///0/!/N//-  0/</`/ /V/a//[///]/\/ / / //////////D/9/8//~@-釄 NG@-郄 NG@-@P`p7/[0 0 Ѝ@-@P`p7/]0 GN Ѝ@-@P`p7/\0 T) Ѝ@-@P`p7/D0 ^) Ѝ@-@P`p7/90 + Ѝ@-@P`p7/80 ( ЍA-@ `Pp7/p 008/ 0  KЍG-@pP`8/0 0 :/ 0RЍ@-型 ЍA-@P`p8/0  `0z(Ѝ 0{A-`P@p0  03/ 0 03/0 ЍA-`pP@8/ 0`06/0 (ЍA-`pP@8/ 0`06/0 (ЍA-p`P@4/@ 0p07/@ 0 ᙄPၗ ЍAzx A-p`P@4/@ 0p07/@ 0 yPa ЍAZx A-p`P@4/@ 0p07/@ 0 YPA ЍA:x C-`p@P8/`0. 0 9/0  ЍA-`pP@8/ 0`06/0 ЍC-`p@P8/`0 0 9/0 Ą ЍA-`pP@8/ 0`06/0 ᩄЍC-`p@P8/`0徖 0 9/0 τ ЍA-`pP@8/ 0`06/0 ᴄЍC-`p@P8/`0冖 0 9/0 „ ЍA-`pP@8/ 0`06/0 ᧄЍA-`pP@8/ 0`06/0  7ЍA-`pP@8/ 0`06/0 6ЍA-`pP@8/ 0`06/0 6ЍA-`pP@8/ 0`06/0 6ЍA-`pP@8/ 0`06/0 &Ѝ@- 000Ӂ Ѝ@-@p@-@P`0(03/ ^ p@A-pP@0`(03/ @L s Anp@-@P`0(03/ 8 p@20p@-@(0P`3/ ( p@=A-pP@0`(03/ @ = A'A-pP@0`(03/ @ &00 ,8R `W `!gYNGp@-@P`0(03/  p@A-pP@0`(03/ @Ξ  AԞ%00 <c%00 9\%@- 0 ' Ѝ@- 0 ' Ѝ@- 0 ' Ѝ@- 0 ' Ѝp@-@PPpp@A-P`@P @W PP 0p@-P(0`@3/ @b ^  p@A-pP` 0@(03/ @H o k ?Agp@-@ P\Ppp@V@-@ `P@[p@-@PHPpp@B@-@LP@GOp@-@P2Ppp@D0@-@0%aG@-@<@-@P 003/0@-@0cG@-@ @-@H0000 H0@-@0`cG@-@ 0@-@ 0`dG@-@p@-@`VAAMpP@-M0@p0000`P000000p `PɊ  00 000l0 0D00p` P}40 0 30 jrЍ^8G0@-@0gbG0@-@0`eG@-@0@-@0 cG@-@0@-@0`lG@-@q0@-@0kG@-@a0@-@0`kG@-@Q0@-@0 fG@-@A0@-@0eG@-@10@-@0eG@-@!@-@tp0@-@0000000 00800,0 0 30 5j RЍ^G@-@P 003/@-@P 003/p@-@`VAApP0@-@0dG@-@@-@P 003/p@-@`VP ApP0@-@0hf bG0@-@0`bG@-@ 0@-@0 lG@-@ 0@-@0kG@-@ p0@-@0 kG@-@ `0@-@0jG@-@ P0@-@0jG@-@ @0@-@0iG@-@ 00@-@0 jG@-@  0@-@0`jG@-@ 0@-@0` iG@-@ 0@-@0`iG@-@ 0@-@0iG@-@ 0@-@00`hG@-@ 0@-@0hG@-@ 0@-@0hG@-@ 0@-@0gG@-@ 0@-@0gG@-@ 0@-@0 hG@-@ 0@-@0`gG@-@ p0@-@0 gG@-@ `0@-@0fG@-@ P0@-@0fG@-@ @0@-@0`fG@-@ 0@-@ (@-@P A@-@NN1NL^*uQ10* S1 ! O-M(1P@ 0 000P00P0 0P00P00HP0L0UHP DD`pHE  LPAA6DHPL00 0 30 gЍ^GOGO-00$M@ 㤇 0HP00000L0UHP DuD`pHE5  LPAADHPLW :00 0 30 gL /$Ѝ^GOG1O-@000 0P000U 0P0000HP0L0UHP D(D`pHE B >LPAADHPL (0 0 30 Yg v Ѝ^pHOG1O-@000 0P000 0P0000HP0L0UHP DD`pHE  LPAAMDHPL (0 0 30 g - Ѝ^GOGO-,M2  0$00  1P tA0PPP  P P0P孆 0`P00P0 0 P 0\1HP0D00L0UHP8!DzDHE: `p  LPAADp qHPLpA? =;9 753 1p0 $0 30 f(& $"  ,Ѝ^._GOGO-@PC 0P0HPL0U HPt DDpHE`  3 /LPAAD`HPLbGOG1O-P000@0P0 0P00HP0L0UHP DD`pHE  LPAAODHPL (0 0 30 f / Ѝ^ eGOG@-(M`1 @0$00 0  0S  00 0 0居 00 000 000 m hfd0 tD\ ZXV TRP MKI(0 $0 30 e(Ѝ^oH._@- M1@ 000[0 00 0S 0 0X 0000 0 tD:    $0 0 30 fe Ѝ^`eG._@- M1@ 0000 00 T 0S 0 0 0000 40 tD  G $0 0 30 e Ѝ^eG._@- M1@ 0000 00  0S 0 0 0000 }{0 tD sq omk hfd$0 0 30 d Ѝ^ fG._@-(M`1 @0$00w s0  0S  00 0 0n 00 000 000 * %#!0 tDH    (0 $0 30 pd(Ѝ^`fG._@-(M`1 @0$00 0  [ 0S  00 0 0 00 000 000  10 tD  > (0 $0 30 d(Ѝ^fG._@-(M`1 @0$00 0  0S  00 0 0尃 00 000 000 l gec0 tD[ YWU SQO LJH(0 $0 30 c(Ѝ^fG._@-(M`1 @0$00Z V0  0S  00 0 0Q 00 000 000  s0 tD+   (0 $0 30 Sc(Ѝ^ gG._@-(M`1 @0$00 0  > 0S  00 0 0 00 000 000  0 tD  ! (0 $0 30 b(Ѝ^`gG._@-(M`1 @0$00 0  0S  00 0 0哂 00 000 000 O JHF0 tDm> <:8 642 /-+(0 $0 30 b(Ѝ^PlH._@-(M`1 @0$00= 90  0S  00 0 04 00 000 000  V0 tD  c (0 $0 30 6b(Ѝ^`bG._@-(Md1 @0$00 0  ! 0S 00 0 0Ձ 0 @0 000 000  0 tD }{y wus pnl(0 $0 30 a(Ѝ^DG._@-(Md1 @0$00~ z0  0S 00 0 0u 0 @0 000 000 0 +)'0 tDN    (0 $0 30 va(Ѝ^ dG._@-(M1 @0$00 0  a 0S:  00 0 0 0@0 0 @010  7 0 @ 0  C   d0 tD 00 $0 30 a(Ѝ^ hG._@-(M1 @0$00 0  0S:  00 0 0姀 0@0 0 @010 c ^\Z 0 @ 0wQ OMK IGE  ?=d0 tDd 64200 $0 30 `(Ѝ^hG._@-(M1 @0$00B >0  0S:  00 0 09 0@0 0 @010  [ 0 @ 0   g  < d0 tD 00 $0 30 .`(Ѝ^iG._@-(M1 @0$00 0   0S:  00 0 0 0@0 0 @010  ~ 0 @ 0u sqo mki  cad0 tD ZXV00 $0 30 _(Ѝ^`jG._@-(M`1 @0$00f b0  0S  00 0 0] 00 000 000  0 tD7   (0 $0 30 __(Ѝ^jG._@-(M`1 @0$00 0  J 0S  00 0 0~ 00 000 000  0 tD  - (0 $0 30 _(Ѝ^\L._@-(M`1 @0$00 0  0S  00 0 0~ 00 000 000 [ VTR0 tDyJ HFD B@> ;97(0 $0 30 ^(Ѝ^jG._@-(M`1 @0$00I E0  0S  00 0 0@~ 00 000 000  b0 tD  o (0 $0 30 B^(Ѝ^L._@-(M`1 @0$00 0  - 0S  00 0 0} 00 000 000  0 tD   }{y(0 $0 30 ](Ѝ^ kG._@-(M`1 @0$00 0  0S  00 0 0} 00 000 000 > 9750 tD\- +)' %#! (0 $0 30 ](Ѝ^kG._@-(M`1 @0$00, (0  o 0S  00 0 0#} 00 000 000  E0 tD  R (0 $0 30 %](Ѝ^ lG._@-(M`1 @0$00 0   0S  00 0 0| 00 000 000  {yw0 tDo mki gec `^\(0 $0 30 \(Ѝ^L._1O-@000 0P000y| 0P0000HP0L0UHP DLD`pHE f bLPAADHPL (0 0 30 }\  Ѝ^LOGO-,M1  0$00& " 1P tA0PPP  P P0P| 0P00P0 0 P 0T1HP0L0UHP8!DD`pHE  LPAAWDHPL   p0 $0 30 \   ,Ѝ^._GOGO-M41@8P0 0000000{ 0 00000P0HPL0 UHP DvD`pHE6  LPAADHPL=;00 0 30 [20Ѝ^dGOG1O-@000 0P000V{ 0P0000HP0L0UHP D)D`pHE C ?LPAADHPL (0 0 30 Z[ w Ѝ^cGOGO-M81 0 001PPtA0P0{ 0P00HP0L0UHP DD`pHE  LPAAJDHPL 80 0 30 [ "Ѝ^._eGOG1O-@0000P0`000z 0P 0000HP0L0`UHP DD`pHEH  LPAADHPL O(0 0 30 Z F Ѝ^GOGO-M81 0 00b1PPtA0P0fz 0P00HP0L0UHP D;D`pHE U QLPAADHPL 80 0 30 hZ Ѝ^._`kGOGO-M81 0 00 1PPtA0P0z 0P00HP0L0UHP DD`pHE  LPAASDHPL 80 0 30 Z +Ѝ^._kGOGO-M81 0 001PPtA0P0y 0P00HP0L0UHP DD`pHEO  LPAADHPLVT R80 0 30 YIG EЍ^._`lGOG 1O-`000@0 `P0jy 0P00HP0L0`UHP D>D`pHE X TLPAADHPL (0 0 30 oY  Ѝ^GOGMO-,M@P`P 00$00y pHP0HL0UpHP DDHE`  p  LPAA_D` aHPL`$0 $0 30 $Y,ЍOЍ/^LOGO-$M0@000x 0HP0L0UHP DD`pHEo  LPAADHPL(0 0 30 X$Ѝ^GOGO-0@P`x 0P0D0HP 0L0`UHPx DlDpH-E`   LPAAD`HPL ЍGOGO-0@P`bx P0 00HP0L0`UHPx D6DpHE`  P LLPAAD`HPL ЍGOGO-M81 0 001PPtA0P0!x 0P00HP0L0UHP DD`pHE   LPAAdDHPL 80 0 30 #X <Ѝ^._DGOGO-M81 0 001PPtA0P0w 0P00HP0L0UHP DD`pHE`  LPAADHPLge c80 0 30 WZX VЍ^._GOG@-@NN1NL^*Q10* S1 ! O-@pw 0000000 00000@a1V a b눁pጡFP V00C0Z JA`AQQaQ   G._OGh07@-P @000&w H0 (0000,0 0 30 MW Ѝ0^G(0_O-@ w 000000@a1V a bp눁pጡFP V00C0Z JA`AQQaQ   G._OGO-@v 0` 000@0匑0 01 Y 䌑 b.눁pጡRIP `Y00C0Z JA`ASQQaQ   G._OG@-@NN1NL^*Q10* S1 ! 81O-0000000pv 1 A00嘑0001Y! eqaI P Y00C0V`FW` AFQQaQ D0 0 30 oV     Ѝ^G._OGO-P @"v 000000 0@ a1V a e|딁pᘡFP V00C0Z JX` AQQaQ   G._OG0$0/0- , 0/0 0/ 0 R/P/ 0 R/0SS/0P  R  Br R/Bo/P @-P//0P Q Q P @-P//P/ 00S 0/  P/ 00S 0/  `0-0\  Q Q !"R0(^p@-PPVp003/P pG-P-M`pHXЍ 00:/0$0/0$0/O-`-$Mp@X Y$Ѝ 0@0;/0$0/-/O-@40 08PppB^BRli q^́" U`GĠà|s00nR0c@<0SBP0 q0 H0bRP0c 0`WR- ЍU0 0C0P\\à0\|Q IX @dh c0S`0C&d B ApG P@c0C` B?&d qG@0 Q0@-|i  0Q 0 2#(/GGGp@-P@; opA-@T0`0S00C SP@DT 000C S0.S@@D$S T<pDP pT@DPDG\Op@-@` P[P0S <Pp(@PpppDGǜGp@-@P `PUEoppp@-@P0_S 0_S 000C S @ 000C SP$U.U 00C QS- _`EPoob`V 0_S 0_S 00C QS ZP V 0ES000C S 00C PsSbS0SpXU * 0S _S?0_S2Pp_P)P-P (P 0XS0DS RP BP PPpnSbS@0S_SUPTPp0@ P@p0 C_S R0S$S000C S@0S 0 C_S RΜGӜGҜG 0X1  Q 080S10RP/@-o(^Gp@-@` P0CQ   00 000 0S(  (  00 CB\  pP/a-`0@-X 000000Sʒ8 $0 0 30 ;S ЍЍ/^P0_<1@-$M000 0 R 1:!01g 0P  @P1 0 TT*@T 0`@p` 00S 00\0!" &"30 0!.1!00 0 30 R@`$Ѝ^G$EGG֜G@-@P0U 0||0g 0 P@ 0SQ0ϠR <yg 0  0Ѝ@* [G$EGG== > > > > >= 0 0R=@P<p`PU1* P+O  0RP PCP!0p @ S! p@!0 K! TW/(^GG- M\1@Xa000P[P P ,!$p(p P$PB 0 R@LPP 0S p:@@@TP pPY W Y* GP  D9hi740 0 30 G@D0w.S Ѝ^P0_^=ǜG!gYDGl0_Pp@-@p@@ P< PFp P \ |~ 0p@y깢GݢGp@-@P`6/ p@ 0 R @-@P  R`P TP DP 4{o/iKGGG@-$M1@Q0004`[` 45P !@p88p<`@`Q4.P@Ta4P0QS6 0US  >aP`0#AP  000C S@00BaBQ S 0SV y8@t0 0 30 F0 USllP4PT4P  @Z$Ѝ^P0_^=\O˺TP0S0_G(GiS00/@- jX,8 0@-M@(0,P0,1000 00 S 64 0x 0 0 305 }F;; 0x ;; 0x  0 PX0 LX@< P  < P   5 P 5 P0Ѝ0^1Gp@-P` o 0 R@@U p@? 01p@!> x 0@- W@o ? < P7 R@-n s? @ 0W 6 Rp@-n b? p@Pn )P  W 6 p0 W 0P/@-0oDG0P @-3P/oG@-P 00 S 0 R@-;0S:@-LMP1@0D00T41 D0 307LЍ$ `V P/PPp @ڏ  P0P r* P0S 40Sx`P8UT0 D0 30 mE PP 8LЍ@^lGG40 PRRJ?RR/P0_p@-P@P  0 P03#pppG-B 1M⨏P`@000Ȁ\ r" @DO\ 2L40 pᨏȀ V B P 0H?À‐I P  20 0 30 DЍ^0@-$MP@PEE"$Ѝ0p@-Mx0@ P@D000`@DyP00 0 30 D0 Ѝp^P/@-M@pP `WЍWP T  E=P  0@-R ^oO-M3@p00000000 P` 0 <S 0@ >R_0@ :E0V10  8 R  B_/PP  +P* E0p  00R pa[` WP "_]tqxa|as G R: 0'S70B  9# I 00002 0 30y D 9 444 t Lo` 0tqV*>`LL~0S dtddr  PP 0  |`||Y0100S 00U  R P.~0P 0Cs00  007Ѝ^\OP0_^=1_DGO-M7P 0|00$000 0$00.SPPP0_S<S @T 0 SNRS00@ S>P @D@P-10P  @0CR0XS{ @T@DP@@T@D|P@@T@DsP@@X `T00S00C S0D `@Vp=P p0S : Q0B PS _R 0 B RS $R  R_R0C00p@ S 1 0OS.000# 0j 0 @P p=0P0d4 (@  @Rp0V  0 40S0FSP@ F0R_S0 _R  BR _R000C S0S F0R _S0 ER000C S0V0 R"NS 0 _R0_SD U Y00K S =P 0=P U*0_S0Z_S@TX0I?o20S9 0S<PG @VH0bSnS 0S^00000D0V 0 B R FR _R  _R@0V 0B QsRbR0V@  _R@0FS00_Y0S 00_S0. @ p0J0@p0DapW r 1 |0 30; A@ @DOo<BP@T 0<S'<0 4>LO> dIdL4}Lz4xv0Su  47Ѝ^ΤGDGΜGuG(PGGxG0@-$M0@0000  $0P 00  p0 I 0PS 8,0 0 30 A.룾$Ѝ0^P0_@-@Q0(M0$00  00 Oo B40 $0 30 bA@ }(Ѝ^@-@h0 M 0000@,0 0 30 AA^ Ѝ^C-@TMP1` 0L00 `YV!00<0C?o2SRDP ;P @1 @0<S .P@ P!U p  s000@ p 4P 44@,0 L0 30 @{TЍ^N0S 0p@-S@P8(0 8(0$ 0p/pp[ZT)\P\p@-P@8PP P@ RLPp0S PBSp0_S0@ 0B Q_R 0_S@_S@PpΤG}Gp@-@P8opA-@p`P8 0AO-@1$M܁0008` pP0S0 _RX0aC0 C RP=@T tP? R @TP Y0[_S K P0<SPE0 0 30) @:P :@P @T@_S a0BUS@BR0_Sa0B0 B RS$Ѝ^}GG-M1@P000 -0 P 0 L5 0p0`$000V 80 0 30 ? 0@嬀H(T 7/P 00S R50@ 7벼Ѝ^\Oa`0R@-8M A 0400U0L0PO ` 00 O @8,0 40 30 j?8뇼8Ѝ^GG0@-M00003v P9h @Px T nv 0  0SLS 8c @8$0 0 30 9?Ѝ0^GͣGp@-@`  PTp@8  0p@q  p@-R0@P S pS 8 00pp@80p@-S@P p{8 00ps@-`PV^ L0 @0<0/,Se8Ѝp᧺Dx0A-`p@K32` PQA,@TP0S P P@a`G-` 1PpU@)&32i 0CS   \ (00(000L CQ 0 00,00, P `!0 0 00S  0 0 0Sa` 0@-%0S@7a`1C-C00%0S؃0 0` A` 0W`7500J75@Q޻0 R {5<Ѝ^EGGG6pRrGVGG0@-@03/@y<_O-$PE@QPEU Z  aP  }P  Ѝ  9 PJ` U L IPPY C PW Aa0`aP`OGp@-@!P 0SP B=  0 00p 0D 1 2 S !00B 0%  (^O-`ጲ P4L `n4l 0P0x0000>T 0 C LPX C0@$00T L3Qh0 1 30 ;`0 LR1L?4=벸L3Iߍ^a`ͤGO-dM`@ '0 \      0CSpL;0 PQ00S 0S 3101   Z PZ6p W 1  Q PP 0YU 0400CW! :0 RQ0 RU0 R\P 0Sd6 0 12SP XPP0!!00  b 0YZP 0CX*W 1 0Q 04P 0!1"2R!0  ; ! R`0   Q\U0!   QI0!0 0   Qp RP  pp W\( 0   $ ($ ( $ (R   aP0p0 0CSPPU`$`Fp0a0WXG 0 > 0S 2  1S !"R ! ( P BpW 1S    P1 QXQ 0 V5 0S P pW`L1 \0 30` 9PB 0 12S<0 0P'@U *0@_S0_S40,0,Z,P P'P  DI D PDsU  ,PP uP,eU` 0CV*Q0 ᆑvDT,RIŶ .3dЍ^(^ԤGG\OGΤG@-PMp@0`000e'0 P 0  /0 0 0 100 0 30 p9 1덶Ѝ\O^0@-@M 0 R  D0 0 30 P9P ! gЍ0^@-@04M`p 0,00.I T t0p 0ll0M JP0 0 ,0 30 94Ѝ^NM$EGGG@-`0P@0 00 *0P0` 0 `0 < 0 0 30 8Ѝp^@-@ P 00 1 2S  P(^@-P@ rP@P 0 R   P P 00S @@0P @- 0 R R  0@o/P0/@- 0 R0P0 QQ@@-@4 PPLGSG@-0P 00S %P`G 00S@-IP/p@-P@ 0 @0@D4# P 0p@-g0P &PiG@-00 00 00S@PPP %PP0 00L 00 0 00 00PH0 0 30 7D ERP ,Ѝ^iGG$EGGoGYUG@-PM`` V@" so P j @a ` 0` ` 0` -a 0S+a 0aa Ѝ` P i a 0S p@` !R0:_i !P@! 0 m A-@` 0So` p`3 n `P` 0 00(a 6n 0d` 0S@-P 0 R0P oG@-@ 0 04!@T $P訢GV WO-$M@p TkTP0`0H0S0H 0L0S0L 0P0S0P 000 0V0sL 0 0 S  P0!0L00H000 P30 0 00SB Po0XWɑ 0qP 0T0 0 0R"0H0SL0S 0x0cRL0P0SP0 $ЍP 0 P0 0L0 0H000 vP`P% 00 0 0X 00 /  0!.P0 0L00H000 KPZ000`p@-`0 M@ 00000P  0h -P U0P0  @o 0j 0 0 30 ]6 Ѝp^vGRO- 400 :H01_ / @ Ѝ0 @40.H4`0m Pm p_ j7_ e2 00S 00S  & 0DSBm 0`T 0TJ 00T0-m T  0Pp"rZ`U pP 0Ppg @^ `^ $ GG*)SGp@-P@^ U p@? pS@-@@2/  DI@0_ 0S ^ P ` 00pWF PW P 0  ЍO 0pP 00/  0!. 0 P Ѝ00P 00  00  ?00 1>0 0W@ 0/  0!. 0 Pp@O-41$M0`000HpA[@ ⺵P g_eQAA֮VW0 0 30& 3 0 PS X!@P@T\ 0 <P j @ D@D 09Q$Ѝ^P0_^=\O1_O-`p{P@ 0 T0 0  R) K0P 0Ϡ 0Ό 0P Ѝ_P 8G 0S0  ЍO0C0@갦G@-PP 0 Rʘ0( 00G 0 P HP@ Ѝ0@0P 000  0 T@pG$EGGڦG A-P0=S-01S`0@ @_pPiG P 0=S00S 0=S00@TP AP0_&GI- M0p0 0 0/@P ` P000M @ 0 0 30 ~2K^p@-@P 00SPP P4@P p@@p@YG@-@P (PP@YG@-@P 0@0$P < @P b 00S 0@Z蚻L@-@P P P T P @E 00S , P : 0臽L`Gp@-@T P+U 00S\P 00Spp@-@PP o@-@P 0 R0p  @-0 @04/Z PxF OG@@-@P 00S< wP o lP`GL@-@PT+P  00 0 00 0000GP p@-PQ0 P@p 0 S' 0 Q  R0S|P^P 0 0P@ @8P T (1PHPp蕢G0P @-s 00S :P/P 0 RR O-@$MPp 0WT000 T L TP dT $Ѝ1 0180,#1  012S% 00S#0S+X00 0 RP H 00SQP0 !@0 Y 0 R0 R0C; ` 0CV:p0@s03#BZ 0X  0 P a 0Q 0P0T R0 R    000Cs0S 23 0 S0S 0 0:# bY  000 0P 0 P  PP 0P P 00Co0S PPP0SFoP Sx b Rs]@`pkG(^P@-@ 0 R@ P 0@O@@O0 0 R p@-P 0@0S`0P  @U/ RPTUp 0PE+@SU 0 R@PE@s@-@P 0`T0PD 0/ 0?  P"@ Ѝp@a @-@P 00S P P@qPp@-M1P`000U`D @kUP` s 0@0S MD ` 0@V 00 0 0P 00SL0 0 30 {/< 0E J?  8 PЍp^GGܧGp@- M<1 000BX P@P /`P D 0 0Smf @P0 T0a @0 0 30% >/X P 0 00@? @k( X P 0 R 00 N8 W(9 Ѝp^G`Gp@- M0 000W P@P PW 1` 0@0Sh 8 @aX 0ba P \0X 00@3? @(,0 0 30 .( Ѝp^GLp@-`0P@T 0 R p8P R0op^GXSp@-P@P 00 P?00 1>@p@-@P 00SP\P 0 R  R  0 0Q@ P@G@-@P 00 P 0@T@w 0O-P`-` M@ @T@򊀊刁Z Ѝ  0 0 <P O f O[pE U:v @ 050崠6 #( 0CXE 0 R((   B A ^   000 0 0 0 p `ql# @-@P 00 0@0S S WP@q'GO-p2$MPQ@000 RP``  0@ RR@Pz 000CSy`@ 0 V{ 0  0 PW\Q0 0Y" +PB  P 00 l1 0 30T v-P 0  P`P 00 0HX 00㓘)P P  0 {P P lA W WPW`,A V B$Ѝ^G@G GG 0@-KPvGp@-@Q/ 0P T*0 0P# 0_SFP Pp 000 0 @0S0 0P 85P Pp .PppV WGbG@-@0 @p@-@P 00SP pP 00U_P 0 05# 0 Rp@@-@P 00 @@0@-M0@ 0000P  }0S 00S ?A P!" R 5A  g0P   ` 0<0 0 30 i, !" R Ѝ0^{G(^GO-`3MP000000p00JW]0@S\PP3 LP@3<0P ,304W  PP0S@ 30S@ @ 40S2"02@ U\t|@  @@ @"0t@ Pl@ 0\"1 2 S H@ U42 X1 "0.@ K 0@ 8$(,000!`X\`dh00lptx| 00 P<00@800400L@%8$/0SP@L PO0 h7P#L#(<0 0 30 w+P#L|#됨Ѝ^GGG'G/G0`jGG(G$EGGGEGeG(^GG8-MGA-PD1HM@0D00Zp000TpGo`r00L< PP @&?o2P0S0S ? 7< 0S? x , 00, p0,00 D0 30 +,&HЍ^!gYSݪGGA-@0HMP0D00)Zp004 pG0o,@0U"0`40 0@rX00 0pz~|00 D0 30 *sqHЍ^!gYA-@0HMP0D00YpU00pG40o,@,0`@0 r0400 0p=A?00 D0 30 *64멧HЍ^!gYG-MpP8@H2`000Y VS Z OS Y% TT! 0DSشششش      X9T7T!T,  EC0DS DPk0 d$ 6P 2oP HP D UP Q P ` 0 P 0180 0 30 )Ѝ^A-`0M@P00008 i0 Q1 @00Z 0 0 30 )Ѝ^GO-  @@:pG (Gqr! 0CCT :0 p 0(0000 0  00;/(0@ `$@3I 0` D @ P0 003/(",0 40 30 P)("m<Ѝ^GpLG@O-$MpP 0$30000P` F@T FR9 R2 RNP0SlcDP@P  V Q @# 0FSD S= S?P *P%P @DPP"PP @V KVV@P@ P@AP@P@P@l= Uѥ0CS0 A1 ?!L0S  P H00 000eP41l `@= Ay00 0 0 30 v($Ѝ^GkGGp@-` M@ 0 40P T 00 0@@DOoB 0 0 30 H( Ѝp^ @0@-AM1 P @000.8 0400; 800,@C0XtR@ 0,0  BR@z# @⸿,e T  ⮿,[ &!_ 0 0 30 'Aߍ0^NO-@P3\M0T002k"02< 0`V2l"02  RPP `PV0p00P 0S  p0@2 T0 30~ 'E_ 0 pLS7 0 P$ 0 _R*0 00USA  0 P0 0 P !  !!! 0`0 0P.R0< <$< $P  0!$< <$<$PPphPp$<$V\Ѝ^YG$EG0GGjGoGGGGG@-M1`000L 0@0S@lrP 00 p 00 pS 0P4  0 00 S  iP 0 S0 0 @000d0 0 30 &xP 0S 0 00B!?!Ѝ^̫GK-M1`0 0 0E@P@@P 000M 0 pᣁ|PPE` >눑@Px:h0 0 30 &a 0@0S @ @*K$ $KO@K^iGҫGGO-M@PIO {P DO ЍO@O XPЍO9O U6O p1O P ,O  00 " Ѝ"O #PO `VUppO ЍO^K]  VЍOO kO gp   `FN +] @ '] @ ?  ?H PN WP ]  ] N 0 [  X00B!?!@-@P @P@@-@P@@-\ @N 00SO# @N PPf: [ `O 0` 00`i~N PPyN P tN P0mN e |0  0bR\ `!@Ѝp@P/ ?N qPP p@p@-@3N KP @P8: )N 0@" "N TP@yOGA-p`@N a 0 RP(0PP$  A_ 00S t9  0Z @P M 00S M PM 3UzG@-P|3-MM0,10n P@.I P PE0`   0  0` 0  "2Q  ?&  hC`V@ V8OV `FVt@003/0X",0  Q ¡끢0(?9 뚢꘢0, ⮜0+10S P0 C 0, c 0 0@l 0P 0 0 0 PU.t\ <pP\1X!0TT1#9 ?M `V0GPM 0 i000P`Q$A - P0 C o0   ѡu (0 ,1 30 "$Mߍ^ӟVGGGG@RGGŬGGGτYGzRIG$EGGGcK[G}MA-@`PP B@T, HP( 0 R@ 0GpW 0`F 06& U A@T 00 @Ae̫GA-@`pL  00SV! @L PP @P  A= AZ @-Q @p  `Ï0 ~ `P 0p 0 0  " 0 0 0 @߯,pL[ʴ00C0 0@ 0 0 00S 0 R O 000JSA-`rF 0 RR  @ pt@P:  oP5KP ᴧ%R' P(  0  T 0@ S P:P0@pPF @P 0P wP  0AP Q k*GvGGMG@-@"F 00ST @F P @@O- DM2@`0(0 0F F P@E P PE P @F P1 oF 0X0C?o20S\ 00S SWE ppq~00M SF 04 08 S & @408 E `PE `a P00<0 2 `0` E D @ wS <0000` 0 $K 804 OeV PE `_S  K E * PD0 (0 30 rE P `F?00  K^GRA-P`@ 0 d.@pYE -P .+@pHE @DE 0 0S 1 :E P @VOoB ?N 00S0Q\ @R R  OoBGG-` p0(03/NP 0@(0 4/D @PX`+TD @%P Q@NP YUWU31,"G@G] 0 4/@ZU h0  @Tv@D P @ZU pD  00Sk @D P @D X0ES2"1,"P_ YU XU  0U PP% P @v"`P 0 R `?N *P ?M $@ D ?) R P  R P P 00S lP@YU ZU XUiu 0GM ^ 00 SY \P @ZU p 2P ,P 0X0ESL0P 1,"oP YU XU *g G GGJIAGsGG-@P`p7/C 2T-pP  P 0p;/ 0SF QA S D 0@04/C ?U <(7 @C 0p RU u$ Gf PQ 0G pP GVSP 0@[G ꐯGGO-,M@`tC  0@ Rpp 0 R PPvP 00SJP/L  ,L JC ,pW]@C p Q  00 "` 00?0  0\ 0/ 00zG C `P 0p0$ 00 0ʿ 0S2$H01/0 0 RG v 0P0Sc,ЍO B P  1$ _ 00 0  0 ? 0 0/ 0$0$G B P    : 0  pG  ?0y/0 0 G U 0 RR 00S4,ЍO 00S 00SP,ЍP  ,ЍO B 0S oB KK P|B p?P  +`T P 6K  P` bXSA-Pp 0. W`*@<P 0 p07/ 0PUA 0 R%P 00S 00SpP0 },AD IPA P 7GGvGA-Pp`@4/Wh0@(03/&PV0(03/%PAA-P@`6/`T$A p0P 0 @P  0P05/ .eA @A.   ASO- 4M3p0(0 0 0@0f0PH0  @P_- PP4P & 0`@0M0PS  ӸXи PwUC 0p00 0`H0PVS`  00 ?` P @00H0S 0!P0 0S2PϠ00!?^ :!000@02 (0 30 C` 0 Y 0  9# 00 S 1!01, # 0 0 R% 00SREp00 0V 0`HX 008#H L HL  0`P 0P P 0< K@0 @0KWP 7 $ #KQP@@0K4 K @ GP '  #KQP 0` 0C 0o K^ G̫G^M$EGGOGGO-p5,M0$00H`F Fa@T $0hP  0 0 P05/@P 0CCU :g@ & l9, '랔 00;/0PP &L@ 00S F@ 00S8N =@ 0000 6@  1@ 00S@ 0S @p 0P0S2P 0 R c 00S S S 0SS0CS`pppxW @ 0BP? + S + WP' 0H  0 0CC10 -|W P t0 00A mP+ X + W  WP}+ m GW PLl+ ?  0p RP*0PP&  % 0 R N+ CKP  l 0@ 0 # 0 P0 0@PpV @ 0 $0 30 l,Ѝ^GpLGG#GGܰGGzGO-\M@&P T -M `*M PlM `hM Pp'? 00S!? 0nP ? 0? 0? OPd ? 00S @Z @> 00S$ > cP** > 00St? 0S> /P 4 T0 30 ( "> 00 00S >  00S> U0ZY 4 T0 30  0 \ЍO 0 P0 L0 P ȯ 0` 0 0 0?P 0 0 0Pp 0   R"   0p0 P0P  C 0@ C 0@ şe@ 0 00[0(0S 0S * @@D c@P@D^ 00PS` 00P`L 0 $ R0l&% `03 j hZh U0"> D/ `Ɵ/ P> ŏa 0p 0  0 0 o 0   0 Q P0p  C 0@ C 0}@@ 0 0s0 0{0S (0S ) @`@D@P@D 0 0 C  @ \Z 0 T0 30\Ѝ^OGfGGO-14M0,00@p= wP gpu> PT = Pf@P8 V= ` P  `00 $ ( _4 ( $@0U $   0 00 0`P @ 4/ 00S@ 0 0@0@ @! `P`F?D) ,0 ,0 30 V s4Ѝ^GGO-@DM`<Pp7/pP l$0hP U 0 _84 <0 30 '= = 0 S0@04/U@ = 0S < P< U 6`3 0P0S 00S@< ` 00S 00S P P( 0 S00R00 0Q$ SQ  R$0 0PQ 0P  0 00 0RP P 0P 0   \ *0S 2"01X( P1!01j< 00S 1!01^< 0P1p!0l1 00`M< 00! R0:H1(!0$10 (Pv PE `"0Q4P  @0 <0 30DЍO  0  I 0* rI   طP < 0 <0 30DЍ^UGpLGGJGG$EG,GGaGGGGG-P1@(`,p000< P;  00S   0kE M; p0  {p@W 0ᫎP 0 Ul0 0 30 0 09/ ,G U 'G ۏЍ^UGpLO-M8p` 0C10C00SЍ 0`AP僁@P0 0T0  0 { @PO-Mp8`L ZAP  @@1@ C0c 0 R01 B !0  0p`Ѝ0A00 W P^'@ U @X@@EA ^@ ࠱  LҶ E AЍO @ W@PO-Mp@@DP@`_THL 80 R Q\ 0& 0[0 0`o<` 80ЍOЍkGO-M`L0 0 P0H0T000@04/H @P 0`06/H Pp0` 0 T000R  0S \s& @0 00*W0ЍX0 0 0@P꒳GG-pP1M`8PP000v: J`@P 0 @04/H ,  ? ?i0 0 30' tV! 0:0P `@H: @0 0@0@ PD& < ,!P (& 00Ѝ^GpLGGGA-@-PpT0`0Y 00 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`0, 00 0S  pp 00$P$@0 0 p 00p00p0 G-@ MpP`E VFWpH`p2 W pG 0EPES Ѝb E btP oP   hP  bP   `XPH  PPJV :pG PAP  A-P@pBW `GF"/o b  V lW@@Xp@XP X @X` X``}Pp@O-P3|Mc@p0t00PPPX0 [ p0 ẠP P`U04Q !0P !d0 0 P PPp0 㑐Ģ`V0I 0CQ*AnJ0(P0T0U)MPU0S` 0 12 S;39P r!0@ /@ 7P(08 < ,0,0@0DR1$08080X  0CZ*J<1 t0 30G 0`V8M 0 00,P& 0  0$ ˫P 0$ [P U(P  !0@ @W PP0 S`pr|Ѝ^G(^4Xa`G@-Qt0(M@0$00T0 $0 30 8<0 ℟⻟⸟K(Ѝ^GA-@00 00S>P T U PxpV  -\0 0 30 LF J = @ Ѝ^+GKaGC-`0$MP000@X0 0 30 pP M 0 x B@ >$Ѝ^A-P0M@`0p000 P`   0 0 30 Ѝ^A-P0M@`0p000 P`  뗋 0 0 30 nЍ^O-4D-ĔLM0D00MtH dPT娴娤H dptp|`PPTtH 㬐⸀p`P嘰圠HH Jq aQఄ䠄޲HS GG   /G///0@-|03/ p////'/)/0 0/;/0(0/_/W/ /#//^/G/-///pG/gG/G/kG///\G/// R@o/ ↶ v0@-0 0 M! GTGjG@-@P *@-@D@-@>- PP%A-@Pp儹0 T`06/A Gp@-P@0ST 40SDopp0p@-P(0`@3/ @> > p@p@-@P`0(03/ > p@?p@-@P`0(03/ > p@?@-@  0 Ѝ0@-@0䦦G@-@㻇 @-@ 0P@ @" ! 0! 0  >P0_ 0" n"0@-$M0@000 0O P/ Dm V,0 0 30 Mˆ$Ѝ0^GA-pP` 0@(03/ @> r n Aip@-@ P`P[Pp@Up@-@ ]P YP @TA-pP` 0@(03/ @= 7 = ?A=R R R000/lG0/R R R000/LG0/p@-@H0`0VP ApP 003/G@-@І00 0 12S S0 Co/(^0@-@0nG@-@㰆Q/㪆p@-@QpPU jឆp@蚆0@-S@  3/    /0@-S 0 00t ЍG$EGGG@- 0 R R R0 0 00Z  Ѝ GTGG 0 /p@-@P0P R0U p@_p 0  /p@-@0P0 00,0H0d0000 PCp R =/C^@-@pP` 0  0& Ѝ 0/@-@0R((E CR @NGhGp@-PQ0@0  ᭫ ᚺp0@-$Mx0P 000@00_@P 0@<@T@Ⱔ 0 0 30 $Ѝ0^@- M\0 000ok @◤,0 0 30 ⎤ Ѝ^@-@P Aࡅ@-@0@-M0000P[P%P" @P0P0P~) 0 P 0Rd` T@#40 0 30 $볆Ѝ0^2_G2_D6^0@-@0G@-@F0@-@0G@-@ 40@-@0G@-@$0@-@0G@-@ T0p@-@0ҝ`VP ApP 003/G@-@0@-@0䲝Ⱍ bG@-@ P0p@-@0D00䞝`VP AЄpP␝|GDG@-@„0@-@0䀝♣G@-@ 㰄0@-@0nG@-@ 㠄0@-@0^`cG@-@ 㐄0@-@0NLcG@-@~0@-@ 0<G@-@n0@-@0,bG@-@^0@-@0bG@-@N@-@P ADp@-@PU  8p0@-@(1G@-@&C- $M@Sp  P$ f`P  $ P `@@@ 0!%$@`0 0 30 -J80 0 300 $ЍC&p$Ѝ^GqA-p@r0@QP000a ' pUp U  Fh FG@-@P 003/@-@P 003/@-@P Aः  /@-@P A R/  m0S/p@-@P600p R/  W@-@hL0O-KMXQ  H3UPqT0$10 ,3(#0$$3P P0`T4@4P8P$P0(PT ,P0PP20$04040Y㙃0 0P0S* U 0S T0 QQiP0PY2$0,0,0[,1$0,0,0[HT1 $1 30h 20 S 0S T0 6JPPP0Y, 0n0S T0 'PkPP0Y, 0 ZG POPP 0S T0 TKߍ^DG$EGGGa`0S00/A-pQ0P!CAWB00P*pW@!@1@*T` T@!e& `0 Q P AZ```@0\G0S00/@-@T@; 0R@-@  B 0  B @-@P A#@-@P A@-@T՚ @ O-Ѐ@IDB~tgpPAT0!03@p&*T` >3T@!% `U Ġ IPPY Ὺ PX Aف`bP`>COG 0\ - O-`0F1spAS@!@3@p$*TP 2T@!% P 00Y  B S0CX` A`QPB0 0 OG@-Q00000|0x 0tt0j  000 S 00,0 0 30  Ѝ^G$EGjGvG@-M3 @000%p 00᜘2 >ᯘ2 4k2 *2 - 0 PU h2td"0`2` PP2u<"082 -`G"0"}Z`t!0p႘1 f}`ᗙ!0Y1t1 O'P1 EB(1  0` ! 5 0, 0H Q 0h 00Q 0ih 00R\0jH 0x0w 0 0 30 Ѝ^tLGGiKG$EGGjGGL1GG,G 0U0@q0 n U    P0BC1U:0!0000 = L0 $0 30 y0 P + v}(Ѝ^98 FG@-@ P ` 0R t pp P0  `0$00 0S Ѝp H0P]`>S GG@-@\0(M 0$00l0 @0@D`(0Oo $0 30B #(Ѝ^O-p\2,M0$000!R' R02,"0((2  `!$0P0 00   0 Q00 P_ (0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍO^G$EGGG98A-(MP1 B0$0008aRBQ000i> 0U0@q0 ) U   ĚP0BC1U:0!0000{  wL0 $0 30 40 P  eH|(Ѝ^98 FG$0@-@ 0䭓⫓⩓G0@-@0G@-@z0@-@000GG@-@z@-@zd0@-@0000S  @ 40 0 30 0  Ѝ^)H-JJ0@-0 0  G$EGGGP/$0z0P/( S @-SbhOh$w 8qP/$0rz0P/( S @-SMh:h$b 8q0s@-PQ00000 @`P 00 ፙ0 0$0 0 30 q ThЍp^^EGp@-PP`d)@P(* P0 0@  @ 0 $0Q)p(2_p@-@P!<0C1PpR/Q\p@-8)00p@-P<`@@P T @T 㔙 @p(2_p@-@Pp0`Vd0`PUpT ( 0R``P@00a`0`A-`Pl06h 0dd0 Pp` @RH0@DAUP u PP Ѝ8G$EG"GGO-TM3@P0L00 @0PD0@ PDD0@ PDDh0@ PDDpYD` P400  DD0S PU@ @0PX @T W pW V [       t d T  D$ 4( $, 0 4 ۲ ֲ Ѳ` ̲V Ų`DDQ !0H7  0#᣾# <4 P1880( 0@00 p0000@ 00D$0 0H`(0$0L,0(000,040008040<0PX0 L0 30 !d0!0 0|xtTЍ^GGG;G^GGKNUGG/Y8MGGGGs HRGKNOVGa`GgGDGO-[Md40d10MH4pP@R/0SP _  0N0 5 0`(,q,Qij5 R o%   0  " Q R T, P   5  5 3  P z5 % 00 ttZ?081K n5 r3 4(i5 m3 8$Qb5 3 @D41SQ0S T5  P5 Q3 0 r % 8 㼱@5 e3 HL8Q85 ]3 0 / L.5 S3 PT@P'5 +3 41XSW 1<@5 HQ`5 93 `D @5 3 l! $0 P< R/ᐠ 0R? 00 d1 305  0 q 0S  0w_X_P 0X,00h4 2 ,4 s2 > 0Z?081HWL0 [ߍ^a`G^(2_L`G G-G1GG VK-M0@0 0 000  M P s0 S\0 0 30 |6a0p` t& PK^H-M0@00 00p0  M$40S P`0 gs a0P@\0 0 30 @?& w 0. M4 4K4 p2 K^a`@-$MP3000' P8 &0PS&0@ S 00SS  0S\  ! 2  000 0SB  0` R;pP7 00S3 00 `P- 50S) 00S$ p*0S d ! 0p0S0ppGp0SK1!01v 2W00?0t  ᕳ Q0 00!0" r0 0  `V !0  c 00S &000!d01 00 S S 0 @d080 0 30 ]$Ѝ^=GrGG$EG"GGG@-@G%T!0C 1T@-MP2% p@W`` ROP Ѝ7@-0%AU Ѝ01S  3/ROO-@-`7\MP0T00P 87 T0 30  \ЍOS U` `V  1 ` P U Ц wV P P0PEQVPP p<7<0 E  P0PEQ<lH$&<fv0<<0 0$0] <Y$W$<<0 0$0L <H$F P PpR $  pUP1!0C1S:'"R?RT5FP%0LL5< 0D<<0 0$0 <$ P $<<0 0$0 <$$<<0 0$0 <$$|<<0 0$0 <ߓ$ݓH$@<<0 0$0 <Γ$̓ $<<0 0$0 <⽓$⻓ R?W%R_U|3cx#0tt3 VV  4 xP  00 0 0@#   0?  4 0  00 0  P  Jv P ?" 1S  s P  H? 8t !,? j 8<0 M"0 040 A!01! !000 0 b 0S  0 0 0Px 0ShQd1 8P PW Z pP 00C1WK1 0 T0 30U\Ѝp<$ * ^GaGAY!gYOB)MGoG$EG"G5GGoOGG^VG/YGhMG0`FMGGGXE_GQ[Op@- MH2@000~ PP  2 0 30  Ѝp@X T 0S&g @P 1 0 30 Ѝp@& "y0R D2" ⃒l1 0 30 Ѝpyt"`. PZU@ 0 !0C1S* q 0ER/C$1S d R r P V 9j )x x :x@x@g00 0 300 Ѝp@=^GGG GgGGGA- M2@000} T 0S d"x2 030 \ ЍAGV"pp. P` P 2 0 30 ЍA U@ 0!0C1S* R?PEE$௸!u i 0S< c ` ] @Q tX (,04  P0 P0AHR/S%J 0S 0D (B  ? 8<0  @5 T% R?@D!0S L} Pg  040  @!|0|1X 0 0 30j4 ЍA ^G GGGG)G4GBGbR[OXGkGXE_GMGGG$QA-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0WA-P0M@`0p000P`kiYsf 0 0 30 0Ѝ^A-P0M@`0p000P`pA?/s< 0 0 30 Ѝ^@--T24MPr0,00@4b020R0,2 `(0$2$0000000S  P@ 000 Q3 0!004 @ 0 s0$00Q|1 `0t1(0p1$0000000S P@ 00 0 %+0S S 0 00 @ 0 c0$00 0 00BP0 ,0 30 w0S Pr4Ѝ^P]`GdT]`LG>S GD^`e10GaGC_P}OGR R R000/G0/Q/Tq@-@QP $Ap(@p 0R  0R0@o//O-`0@FA0T@_AT ! 3P@p(*T T@!R R/ ᦙZ  ᜏ`FR V  ᗙX ApR?㓴+@cOG 0CHC1@LP*@-^Q10* S1 !/ /988@-@P App@-@ P 0 00S  3/ 0 000pq@-@p@-@`V0$0CC1p$P98O-MP`   p F@<0 080  $ 0`X 0CC1$0G#P0Ѝ8rT0vMrnqOG98p@-P0`@000k[qpO-P` UpF@   t$ p0`T0CC1k$0G#P0qT m^ur)qOG98@-@\0(M 0$000 @0@DV(0Oo $0 30B (Ѝ^O-p\2,M0$000!R' R02,"0((2  `!$0P0 00   0 Q00 P_ m0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 U,ЍO^G$EGGG98A-(MP1 B0$0008aRBQ000d]> 0U0@q0  U   㐎P0BC1U:0!0000q D mL0 $0 30 0 P 2 [p(Ѝ^98 FGp@-@ဪPpAyP`V i0P:dz@ P00R0@0T* 0C_R _RyP0 R pp_R_P0.  0 <2_DGA-PM`0@0000 pP p0WmS 00S `0 _R00h0 0 30 y@LS P @0pp 0p. Ѝ^\OjJRC-@P 0 RX Pkp`gVW p` VW 0@ 0 R RQP 0p`Dx P 0< Ѝ̧ 0 D0 ЍC Q 3oo  ЍC p pGjJGA-0M  HpPQ  1R0,0000 [\`@}00 0 0e0 5c9=?0S*[znݐP pk,0 ,0 30 ~ 0Ѝ^^EGGJrUG-`Px10 00h1 d!0`1`e 0XL18!041@ ( Rppm PP 0 0 30  ЍGE_ \0`00LS0 3 0US0 P0 0 30ЍP0 @N80 @G^YG$EGGGaIoGGGGO-p94M`X@\0,00cPB`P>`YZ 00S0US ЦP 0 @8) 9 ,0 30K4ЍS 00S ᴦ 0 0V0W0S'*`P3 0P R BQ+Lț P{7 ,0300+ `ؗ 0  j7 ,0 30 R Pj 0`l<7 ,0 30T4ЍOZ %밪P   '0~ lG 6 ,0 30 4ЍO`P 4 q ᒪP ᠪ`00 0  86 ,030T4ЍO < 5 ,0 30 4ЍO[ %0W5 ,0 30 k0p0ᴥ 밵 0SL5 ,0 30 U V x  000  0  00  QP !   00 pp`P d4 ,0 30X0 4ЍO;`P 4 ,0 30h7 `&PPYP. P Q  W.Y GP0  `0  ~P3P# ,0 30D3 4ЍO[ YsP hQ W2 ,0 30D <D  ,0 30 ,0 30 Wp2 ,0 30 0SD2 ,0 30 00 (2  00V1 ,0 301 `\X4ЍO L 0  0 0  0G`  p0S 00 S  Y 0S p   Wژᔑ` 눡`   0 0 000 W 00S l0 ,0 30 K   q 00 S  0p`U^GXE_GjJ!gYNIVΞGGGG-GmP?GFGkGcKWD_}Q}M@RVG]GYGG;GGGհGGGGGG.GG:S0VND_cKJGSPG؟GO-4M@P0pX0 0X20,00㥼P @4P T$"z 2 ,0 30O4Ѝŵ`P_ ̻]Y `T + 0 0 0  Rb 00S  0` X! ,8@ , 0WpG0 0000V P0 ,0 30% )X  0   j 0Qbl\սXX X  H 4 4ЍO ^nGXE_vG̫G@RG!gYGGO-LMP$0|00L4p@0D00$0R 0`Va$p` PPP 0 00x00t0 `$0pS3 D0 30 x0P 000 ѥ @3@R 43g 000 ` 0 R `V2 `R 00SݺP` 00Yx000 |2; 0  0 0 000VS0,0,0 ӤP4$ 0  00@0t00 0\ ,00SSQSS OSR  ,0RS0 SS! OS  ,00,0"_St 0  00000t0 P0 ,08 ფP #@ & ,00 vP ,0TS,08 kP @ # d0 ` 0 00t00CL LЍ^JrUG!gYGGGGGsNGGGG)G:SO- 000  000 0 @000" (  0h  @\ R  R  " , , @p SP% 0 R! ^ ^ ^   ^ 410!0,1(1$!0 1  R ӥ  å q0 0bRQ  !^ @,0K0 00,0P @,K # 0 0,0dЍ^@R[OjJG$MXE_mGG$EGG GTGGPA-@pP`0P T"T4Aw ( Ar 0 Al G5UGO-DM@ 0h00P2l0<00pȴ 0S_(2 <0 30? 0 S=*V C `? 0 PJ'0 0 $0$ `(  000 0PS.V ` 0 US#,1C <0 30,DЍO V  0 W"0 `o000p ` P 0 S Z  0J0 0Z*0 30 -0S <0 30}DЍ^G@R)XXE_GSI@R@-P@p`@ 0 0'0' Ѝ@ )X@-P1,M@@`0$00P  d@x 1 $0 30<,Ѝ 0 QU갷ضطط0t pR*Q\4  0 @ud00$030 0d0,Ѝ@/P0 $0 30,Ѝ@C T0 $0 30L,Ѝ@ @& J4@  " ^4`OjGGGD_-P@-DM1@P0<00p, x 0` R 0S 0 4P$xP$  0 ᳯ 0 <0 300 %0C00  0 ឯ   00S  0+0 X000 0e ,0 <0 30DЍ DЍ@ ^cK!gY V4`GO-?]Mp@0l10` PֶP  P 00S`pP  00S ? /0? tp  " 0L P0 دYP _" p ὿P P 00CSꌻ(((((((((0S_ 00 00S W 0 0 0 u :q 0  E 둯P F !RFX= l1 30O QX PF`Q) de# oPu 0 R 0 0Bs0RS P`p`V`V 0a Q ( P e`ᳳMp8 00 ᇮ   0A  0 - ᥠP  :  X 0  P $ 0! `pY d`h k}  0WV l0>00 Po N& ^ F0S hp 0  :S t:S/L1V?P10T1X1h1 H ∇p-4 ₇p'  |p!  vp1 pp+ jp% .pp0 ejp +P!#T1S* W}PS`ጱ C00R<9 #ڄP1N 0 P1 P10-0C?o2P!  0P1 Sf  ^P| o00 04P 0S |  h  'P&P 0sSS@  0SF/፴P 1 S10 00  !  R R R0L0 Br R 0 <# ..@T~ PC   ް 0pW6+&06_ 006\&0X6T 0 z0`S PU 0S0 PP0 0 0 0000  ᶷ 0400S2 0C 0 08 0, F/$0: γP0 1 S000C(0$0, 0 R0$0 0P00僐(0U* 0U: 0U S,( S   0 0$4 04,0!0 000m 0Pp0( 0S00`C0VC Fύ`pŏ0710SSP,0!0 0400C`  뷴0<0 뱴!<QX  <    뢴!` !@0 0D0 0<04 0Pp Fύ07103 0 00F? v !00 0_ t U0S U  \ N .  0 0$ x20 00F? Y `p(0U*D1 8 f0 0 _: 00S W pP . /P p`9 0pPA  0 P P P  L P  0 bPT0T 0 c c0P'S^DlI]ߍ^tG G$EG[GGXbRcK!gY V}QxGD_1S*NVVG5WGGGGQG G[O}MGEGGUGJ@R4`XE_GIpG GGD0@-@0000003/ 0 0 30 Ѝ^I@-P@`pᴲP$ U 0 00r 00S 0 0|0@ 0 R ľL@ 0@V@W ЍU   k@j G$EGGGG0p@-P 0@ R0 000CSPp  0 0eP 0 0yP0 0Sp<Pp3 p@-P0M@000  @Pp  00 P D0 0 30 00 P @Ѝ^/Gp@-@P`P 3 @ U@Vp 0 01# p@-PPPL@ @ 0 R@ᥫP*Pp@# pp@-@PP P p0p@-@PQU  R ~0 0 000p P P 0G- M`@@P0DXHLp000  O~ZT 0 Y 0 W H  5~0 0 30  Ѝ^bGiG@-  @P 0SЍ Cr RS0 00 SS00R0S 1G-M000 000CS40 00 #pPAP 0  P  `@ 00TX0 0 30 IP`@P`Ѝ^G$EGGrGLPzs@-Px0@P`000 ? ` 㬽@ ,0U@V 0 30 Ѝp^@-4M0@ `pP0,00Q 0 P  00 0 00( %  00R 00 ( 0R0 P0000 ,0 ,0 30  _4Ѝ^1S4`C-4M P0@p`0,00 0 P 0000(00` 00R 00 ( 0R0`0000奬 ,0 ,0 30 Xᜬ u_4Ѝ^1SO-M`0S@P0\#U0$S  430#0,,3 $> $T 00000C|X00Y00U 000001| pᵩP $0 P @Hb 0St0$ 0T ?  ^ | X[  00 0 Y 0    U4 ? ,>L0D00H0L0 0 S 0S+ XP$  \9\D\a|D@T `, 0t  @ ttO|DM|,K|0 0 30) ,0  D8|,6|^ Cr R 0 $00P@Sl T 00,0 Ѝ^|G$EGGGGG,OO-LM`@0p0 0t0x0|0倰020D00 000CS2|"0x2x @0P6NP< (0 0$0( P$ 0CY $`P1 D0 30 0 |00倰t00xpLЍOpP 00Ud1`!0L17P 0WB0S 0 05#pᛖ  0, ,,{ZV 0 0 00S 0 0[ 0 05#@u 0p,@ ,,f{,0 D0 30LЍppP^G$EGGG9GTjJ/GO-DM$1P0<0000 0T0S 0 <0 301  \$, `p 0S 0p  pp@$(p,p# {]\0( 1R@R@ $EyOoB {T `DЍ^-$MX0 00000  0 LP 0 0 30 @$Ѝ^-$MX0 00000 0  LP 0 0 30 %$Ѝ^p@-PX`M@ HL0 P@ z']Ѝp0@-@ MP0L00000 00@z ]Ѝ@-P@1\M@0T00  L0P  p 00S 0Cs0S Q-  `qVP   0 T0 30 P $0SsS <<0 H <Kz<Hz\ \Ѝ^NG!gYHTG@\:/@- @N@@^T TA"1\: @-@ T  000/ 00@-@"0@ "00 0 0 /0 S:P S//0 @-@ 4/Ѝ @- GG @- GG }@- GG @- NGGP7@-0 00 P P 0 0@ 0CU6v 00S(  (  00 CB\  Ѝ0G$EGGG@- 0  |s Ѝ@-@ 1 `0 0000ls P PPR0CPUu 00PS(  (  00 CBP 0   00000 Bs  0R L0H 0DD0e 0 0 30 Ѝp^lGG$EGGGA-`1@ 0 00pDr P. p`r PP P0CSu  \(00(000L CP 0 00P0p` 0 30 X ЍA-r 0 0 30Ѝ^G-M8P`Y1^!01 @pvu  0 pgr PL1k8!041 0 U :P0 r P pmr P pCr pP0^ 000 r X p0vu  P: `r  Z0 0 30 Ѝ^0-J$EG%GGW@-@0P`0SЍp0P0 E1/P`//00/ /@- 0 0 Ѝ/7@-@ 0CSt 0P0S(  (  00 CBP@ <0  ,0 0P0q  Ѝ0PG@  < GA-d`d0 RppW PD0P$@Ue P(00L P @^8Ga`;G@-@P< P0 0R@6 ^;GP/$0 Y0P/( S @-SFF$ 8qA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0A-P0M@`0p000P`HZ 0 0 30 Ѝ^@-HMx1x!0D0004 d!80@ \!(0< T!,0 00 0R@1@A$0  P$00(  40 6.   (  4 0$00(40 (00000000 00000000H0 D0 30  0S 8(4YHЍ^H10P]`&OD^`>S GG C_hC_GGG^@GP@-@!@3;mP Q@-@!@3P nP )mQPp@-@PP@&pPp @- @-@P@t FMiJ00S/0 i o`LGP/$0W0P/( S @-SEE$ 8qP/$0W0P/( S @-SEE$ 8q0@-0000Sڈ00S|@0S p00D0S `000 T 0 0>(0 0 30  5XЍ^o`D2_,`d^uG00S/ o`G00S/ o`G00S/ o`G00S/ o`G00S/ o`G00S/ o`GD00S @-3/000S@ 00S/D2_o`G00S/ o`G00S/ o`G00S/ o`G00S/ o`.GD00S @-3/000S@ 00S/D2_o`DG00S/ o`OG00S/} o`gG00S/u o`tG00S/m o`G00S/e o`G0@-00000S|@ 0S p00D0S `000 T5 0 0g(0 0 30  ^XЍ^o`D2_,`d^G00S/ o`G00S/ o`G,00S/@-@ @ o`G[O00S/ o`G00S/ o`G00S/ o`G00S/ o`%G00S/ o`.G 00S/@-a @k o`8G000S/@-@ Z@ o`HG[O,00S/@-@ J@ o`cG[O00S/ o`sG00S/ o`G00S/ o`G00S/ o`G00S/ o`G00S/ o`G00S/ o`G00S/ o`G00S/z o`G00S/r o`/G00S/j o`?G00S/b o`MG,00S/@-@X @S o`^G[O00S/J o`lGO-M(1(q0000S>@` [-PP. 0 0CV00F⃡00 0儰0pSŸ# 0X p+&  0 p  P0H C0 0 0  0@$`2(0 0 30 PЍ^o`j`xGGxRSG@-@ Q @ o`G00S/ݿ o`G00S/տ o`G00S/Ϳ o`G00S/ſ o`G00S/彿 o`G00S/嵿 o`G00S/孿 o`+G00S/奿 o`BG00S/坿 o`XG00S/啿 o`rG00S/卿 o`G00S/兿 o`G00S/} o`G000S/@-@r @m o`G[O00S/c o`G00S/[ o`G00S/S o`G00S/K o`G 0 /D2_A-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0A-P0M@`0p000`P`ZU 0 0 30 Ѝ^A-P0M@`0p000jP`dU 0 0 30 ZЍ^2@-0M0,00!00000no!00000u^_tl!00000\eXAMN  A414!001 (0(1R$0000000 0  P 00  0 b  Z    o0$00T0 ,0 30 0S DT0Ѝ^G^`^`^`t^`P]`>S GGR R R000/G0/R R R000/G0/0@-S@ S S= -=p@-@  P0P 000p  0CHC1@LP*@-AQ10* S1 !/ /988@-@P A*S 0CHC1@LP*@-AQ10* S1 !/ /988@-@P ASp@-@ P \0 00S  3/ 0 000pSCT@-@KLp@-@`V0$0CC1p$P98p@-@ P (0 00S  3/ 0 000pT@-@p@-@`V0$0CC1p$P98O-MP`  J p F@<0 080  $ 0`X 0CC1$0G#P0ЍTT~~XTSOG98O-MP`  2 pj F@<0 080  $ 0`X 0CC1J$0G#P0ЍLTTx 0U0@q0  U   _pP0BC1U:0!0000 o L0 $0 30 0 P ] Q(Ѝ^98 FGp@-`0M@P0000 00 0S 000 P0 ` 0$00h0 0 30Ѝp H0 0S $0 0 30 Ѝp@f^P]`>S GG@-@\0(M 0$00V0 @0@D|(0Oo $0 30B c(Ѝ^O-p\2,M0$000!R' R02,"0((2  `!$0P0 00   0 Q00 P_ 0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍO^G$EGGG98A-(MP1 B0$0008aRBQ000=> 0U0@q0 i U   oP0BC1U:0!0000 6 L0 $0 30 t0 P $ P(Ѝ^98 FG@-\w p@-Md0@000 Xr0 0Q0 0 30 CЍ^7@-@Q`0D\ 0XX0 PGjTflP al0S@ Ѝ0pG$EGYG,G@- G/////////P3#/R03#//////////p@-@lPlPiUl00 pjP0 , jPiUjGYGp@-@QP  oP3fPp@KfffUp@~ffUp@ffUp@fgUp@ggP g00S p G/////0/^ 0P/T2_MS@- @P810PUPP800,PP薒@P P X T Ѝp@Ѝ/ԓT0S X ` Pd0 \= S X ` Pd0 - a`.`G0 ST4S V 3 t@P@`00ďX0\00S0 P P 0 p 07/>0pp SG=?0 SC= S@ %?T5V)*6)W0060u 0` X0\ @@8Tt  8Rp@WPVT %ZY` R `3`#R 0`3`"`&0P@@0PD0H000 @0@004 {P ;PV@0@00D040H0800H0D0@0-@00000 40p800`0(00,`@ 04/Ap T 0][GD@0@0@0;Wr0 P 05/p_ @_?` P2 RS DP@ %P~ 00@0D\ U t?A  0 P05/@0 00 0: STP0 03/1 PJ 3  t@00(0 >;$0 S T5T@:cE 0@(@0,03P0 P 05/0p`pP0(0>;, SH w  =>0 ST5 T@:c&E U00++60# 00U&(0, (03T <? SH `P : S= S T {P 5T%?@9:&UP9P VP0k/8 R $4 S  ᜌP@Q S  P PP0 @04/0O*S0 S 0P(SA: S  ZpCV`pTp p0  @0pWT V``p5S %5>S  ` ``Pp? kUB D 0d0p@8TY0 Ss 0Q  p 0 @04/0R?0Q  p 0 @0 06G U Q 0`(` r x0&SQ j< S Q$1@P>0PZ ET  0P(P0w000S0@2 d0 30 V0 @ 04/o 2P  0U00 Rp@VI0@p00D000000  P 05/P<` SPpT ;$$@0 1X00\0oX\1PU5 0 VXoP TX@c@0@00D040H0800H0D0@09H0 @0PD0H00`06/@ `$00`P40T,$< R R+DP@0Q0PP0PR0@'TFT|  P T<0C S(?(?(?(???0@0@<<<\@^xG:G$EGGGPGT6S$2  R0 4@ 0SQ h TٮQp _ p T4t0pJ@DT>>>>>>?>>>>?>? ?0 c`0 01/i`` `G`@`````FJ````<Snl T6Si F TQ`  ` T .0!``F0 @04/%B9B SET dPV TcV0 @0;$DP0Q00P40&0 03/ @@yU} 0  1/PTT` %VX@ R`@3@#R 0@3@"@$0P@0@D0H0!lЍ@-@P AB@-@N1L^*41Q10* S1 ! O-@0Z   PJ`0U  a IPPY ~a PW AB`aP`OGS (Q  </P ZZ81S00H*G-pT0@` 03/0PP0"  5/pPGP3SSPP%0 >09/ XPP0P 5/ >S P0P< S $0PPG /@-MrP `1 p0`@P 0P ` P0 ` P0 ` P0 ` xP0 ` `P0 ` HP0 ` 0P0 ` P0 `{ P0 `t P0 `m P0 `f 0 00`^ P0 `W 0 00`O pP0 `H ЍGiKGhUT P PuSSkUShkUrkU|SSSSWH G#GHRGA-@ā`@p 0`P" 0   0 x 0 d 0 P 0 < 0 ( 0  0  0  0  0  0  0  0  0 t0 p0 00`000 ЍGR1GEGHG[OKGNGQGTGWG&HZG]GaGeGiGmGqGGiKkTL: S //0@S8 P5HHIHII II(I+G S R x0&S @o//>+0 R %  ->  R  Q/  P/k(P #$ R/R/ O R P/ PR* R R 3%RS? /0(S Q/G-`rP QQ@t@ p@Y W W W TCY  T0T@#P0@PUPp@-M;`000V[ p P0p@ c 000P pZ h00 pP0p P D00 P0pG $00 P0p> 00 P0p5 00 P0p, 00 P0p# 00 P0p 00 P0p d00 P0p D00 P0p $00 P0p : 0000p Y00 0Pp 9 0000p 00 P0p V3XOPT4X0PY00@`D0P `@ ,00 P0` 00 P0` 00 P0` 00 P0` 00 P0` 00 P0` l00! P0`w L00" P0`n ,00# P0`e 00$ P0`\ 00% P0`S 00& P0`J 00' P0`A 00( P0`8 l00) P0`/ L00* P0`& ,00+ P0` 00, P0` 00- P0` 00. P0` 00/ P0` 000 P0` l001 P0` L002 P0` ,003 P0` 004 P0` 005 P0` 006 P0` 007 P0` 008 P0` 49 d0000` 4: @0 004500  @U  0 M  0 E  0  P9   2   +   x$ p  LT00@`T0P `L <00 P0`C 00 P0`: 00 P0`1 00 P0`( 00 P0` 00 P0` |00! P0` \00" P0` <00# P0` 00$ P0` 00% P0` 00& P0` 00' P0` 00( P0` |00) P0` Ha pTR0P* `pP 80`+  0`,  0`-  0`.  0`/  Q P> 0 0 30 (Ѝ^TGGGhUT P PuSSkUShkUrkU|SSSSWHGiK G#GHR,G1GGREGHG[OKGNGQGTGWG&HZG]GaGeGiGmGqGuGyG}GGGGGGGGGGGGGGkTLGGGGGGGGQSqSG G GGGGG!G%G)G-G1G5G:G?GDGIGNGPHSGYG_GeGkGqGwGG-M3000E| ]X X X EL3 0 30  < sP ` j p0`@P 0P `  P0`` P0 ` P0 ` P0 ` xP0 ` `P0 ` HP0 ` 0P0 ` P0 ` P0 ` P0 ` 1 00` P0 ` 1 00` 0  lP0 y PP0 r 4P0 k P0 d P0 ] P0 V P0 O P0 `H 0P `A 0t Ѝ^TGiKGGhUT P PuSSkUShkUrkU|SSSSWH G#GHR!gYGG-R :ϠQ Q#3H-$AXM`100 060Ps `0Kh0 H0d0  h0K\ L#@00" 0p弊@BM` 0 GP0S  : :T0 0 30 qZZEPI;013/K^^0`07@-P0000s$ 0 P00@#, #( S$ R0 00 Rd 0000S0004S 0 0 30 & Ѝ0^(^0``2_GG@-P@-P(0P/\ Q0`2_p@-@`KpuU 00S 0! 03/pWUY 0 0R@ < 3/P0 <h# 0 >[ #0  03/0 0 30 Ѝ^^s@-@PJP`t00H h04/ 0S T0A/P0H0P4/Ѝp0S ,0t (0P0H HHH HHH HMO-M@`\PJ P00P0@0)!H0S}$6Q  0000$0400  (S,   SpSrSp 080p?@ABCFGHI}J{KywMuNsOqPoQmkSiUgVeWcXaY_Z][[\Y]W^U_S`QaOcMdKfIgGhEiCAT?=o;r9s7t5u3v1w/x-y+m)|'}%~#! }{ywusqomkigeca_][YWUSQOMKIGECA?=; 9753A1/-+B) ' % #C! FG }   ~  !  !"#I%E'J)*+K-./123M567N9;O=>?QRIJKSP&P PU&Pap 巓 ec|2_Hp@- M0P000{D@&`  N@ J@0 0/0  @@E 0R * @00 0 0 30 N Ѝp^ #0B0B QS00[RP/@-߬Pp@-@0 MP 000@ 0S`3:$ S`3`# R V   xx v V 000 0   0,0 0 30  Ѝp^+`HH5HHH0@-M0@0P   ,00  +Ѝ0O-LMX1pP@0D00# +@ 0#+` P%ܰ \ ^0 @`` PPPT 0  @$s 0s  0s '  0 (  s 0 D0 30 LЍ^O-LMp0 p@0D00;+`OP00 r P00Q@ 0 @r   0[ (  zs 0 D0 30 FLЍ^G-Pb,#C *@ 0 )@ XT 00 00GpC-@P؁#C` *0 )(0 QP 0 00 0pCZZC-M1p000>@`%P# y P@w0E E`000 0SV `w@EOoB7~CU00pS@10 C)0 _0 5) ` @ 0  *)Pp$PP40 0 30 X @Ѝ^H$EGQH?H@-@  * @!+::C0@:@p@-P@`%0p 0p@:hO-M@`pP@ ( (1@0 1S001*10SB 0 0 Pp0* 0夽 0 00  O*0 %)00@ 0@<9 `0 00 @ 0003/8-@ Ѝ H+`̕HH5HlO-@(2M$ 000`)P-UwUnPj  $l) .0S  !0E 0S ! 0=  0PU p1l!0hh1 Pp 0i또 ᜠ Z007.P) `+`0P00  \\`\Py 0`\P 0000h0 0 30 0Sp  HH 0S P \P ,Ѝ^+` HD H5HW H H$EGQH H Hi H@- 0X0 000A^   ^ ^000 03/L0 0 30 P00000000Ѝ^rA-pP`R00S 0`  03/@V00S  @T0@-M0P@ 0 00003/0E PX Q Q Q  L0 0 30 000000Ѝ0^A-P`p@vV00S  @TVX0` 0A/ 0  㩦8|@-4M0@`0,004PP   0 ,0 30( LApdA `0  N `W  0 00000000 0z 5Q r+4Ѝ^^O- 4M 3@0(0 00[SBP`T 0P0  P0pPT,Sp J 00M0@P P ` 0rƕ1 T0 PP T0 8 p 0 T 0 HK#0CS0-SpfH0 ]R 00b00yWi ? 010D @K@0D  @0 D0 , 80 0 40 00`< 0,0,` 0H10,KB4KB8KB r<0P<` ,0 0` 0KB,KB4KB8KB@KBDKB+,0PP00< 0,K,P wB0KuB<0puU 00S 0! 03/pWUY 0 0R@ < 3/P0 < 0 N &0  03/0 0 30 Ѝ^^s@-@P>P`H00H <04/ 0S(0A/$0P04/ЍpHX HHHh H 0  ѣī0C R :P R/!P00S/!0/3 P* 4S Sp S88/4s0 /4,s0 /p 0c/6P 0 S / @o//0\/ R 0 0S( 0S/ Q Q Q 00/0000/t0/0 "c/0///&00S 0 0 0/@P/030 0 0 0/0p@-P@=0S eP00S@PCp^ @R 0@- 0/x H H/H @R 0@- 00/x H H/H@-@=0S P@-@(p@-P`,B@=0T00S 0S@ET01pv=0S 0S/0SUp01p/H!gY@-@QX0T 0PP0嬿 AT0DS@T( 0㞿 Ѝ H$EG H H Hp@-P@0 0p@mM@- 0{#G#p@-P@FL LopA-`t1@(0 00a=p 0@aPU, !0 sQP$PU! t PPP5P0P+ d0! !0 X t0 0 30 m0 #\0QP0 #<000Ѝ^T H H& H5 H O-p-kM`@10H01L01$04010<40<<j? 0B@@T0ꋟS? 0(0,0H0VL00*<0 "p@- Z/x|t1p!P3t@9@PT8 x^| j?2B?C x0|  JX*0 SA0xO`@@t@N|PPd00 0  P]>* YTTj?xPA|OR0 0t1p!@lB_E Z1j/R2 B?C,P j?TCPj?P0@ 01 !JBH Y  ZT3j/R2 B?CP j?P0B_E 0P@  ( < SJ1j/R2B?C+P 1j/2B?CP @j?PBj?j?PB_E1!BODs 4_E Ha HT^P# $ @ j?P@ ƒj?PB_EB_L F S $ 0A j?B ƒBODBL+ YTT0A|Oxd0 0p!t1`@@h Y&$2PAj|0 B0 `0d 1!&P|j?RB_E 0 &::I:  2 YT4j/2 B?CQ1j/2 B?CHP& Y  Y1Pl ?0 SS00  YTj/x B@$ Yt0 40!TDj? B0BDPk<0 @! YpP$:;: S!T5T@:cU E5 0&+"?& 0 U 00Pm\30SK 0 0ᩃ A/0 Ss 8  2@0j? 2B?CP0s @ (Sl; Sn 00j? 2B?C0@)Sj? 2 B?C7 2hj?0B?C 1PpPU7 h` j?2B?C 0 gpW*  j? h0BI`pP %6h80 2@0j? UTBI`0d0 t 0P 8 8R0j/2 B?CWx0 0P0h&PT8 j?p`2B?C&&x`j?RB_E  0 '  @0j?0BCh0P 2h80j?  BI%F`0d0 t 0P /x0 0P0h&uPj?BBODh@ 0  X 80j?0BC&WPj?RB_E 0 &<80> S 8 8R 0P)S < SP N @ P8R$ < S% ;0 S, {0u %;0 @UT2j?RP`B0 01!DP@ 8R0j/2 B?CyP S LUd j?Pp@bK"u0%R@\@0@ 01!0!S /0u %;0 @UTpj?RP`B0B_E"S Ud j?Pp@bK"u0%R@\@@t0@BoF+OR @u0%K@ UT :@"SUj?u 0B@F;t@00%", 0_:T ;%ĠPj?R ƒB_EBL0_Ss X``0d0 40 V%V j?R0BE_9R ` 1pd ?`0 `p40 `Vp%j? 0BA40 Pb(jPb7,0 } (0, 0$0bS< 1 30\ > @@P $ 0 0X1$ @P0c00`0  @>vP0 0$ $  0 01x1P $00"R@T" 2D0j? 00BITP D 0Xj/ 0d01h!%V`rj YGT4j/R2 B?C5,kߍ@-@P @!gY%H6M0Ht07@-0000000aS H0 0 30 dP@U  ᶛP Ѝ0^0W @-P0M@`0 000 堲 SD x p\5@ )P/o0"A )P 0d 0 0 30  Ѝ^[SA-`D1MPp0009P1!01I PE40S ER 0030 v0ЍAUڰ0 004 P@0AA1 @C =x  })P0@ 000 0 30Ѝ^H$EGRH HH[S@-`0p@ 0000|  C x P4/o"q!v) g q)0 0 30  Ѝ^[SA-pT1MP000`9P,1S(!0$1$ PEj40S ER 0030 0ЍAU0\ 00v4 P@0AA @ZC w P (0 @0 0)0 0 30Ѝ^H$EGH HH[SI@-(Mp0@0$000000$0$P $ (!BF 0 $0 30 (Ѝ^@-(M0@0$0005 CR000S0$0$P $ (!F 0 $0 30 h(Ѝ^@-HM0@0D000*  RSSS:S 0 0S Q000000$0$P $ (!E P $,!E 0 D0 30 #HЍ^P/+3G-p$` P F@ EU 0  P @p@-Pm3D0@S0 އDDp|^Hp@-@P `孃  Tᨃ  Dᣃ  4ឃ  $ᙃ  p@ HHH$H)Hp@-@P,PP88 4၃ % { p@.HDHZHLp@-@P7`30V00S 0SAl0`p30S 0S/`VXv3aP :PEU` 00 S20S 2H0`S; ᳇Plpt  l lxT ll4 kk kk0ކ kk4 k 0 @  ! HPH`2L0`SA oPkp㻆d kkx㲆D kk㩆$ kk㠆 kk0㗆 kk4㎆ k 0 @   LPL`P0ES V20Sk`Dp@ Uk`=U{k`8Uvkh`3sk`0{HGQSqS GiStHHaHtH @-@{  H@-@2M!*\0,200S 9 Q6 00Q$0U'$0#΍P: $ $  0;$0#>!$$P $ (!)D P  ,,! D1 ,2 30u p: 01l|,1D Qx ,0 s !B p0$0\0 00U1##>0pL"#>1qp` !+UQ60Q  U  R  R $ 9 B RQ ,0!0/00CU "4 08000R{Q6U!:0:0 0ߍ^ C-@1MM 0,100$ Svs`$[ ,VG0Uq U0 U 00Cp0Xlp0 0 $0 $ .1$$1`$! $0VX$.1$$0 $ .1 $!$P $ (!PC P > l,!GC00 ,1 30 `pMߍ^@-@01TM 0L000$ Shv* S6 $ S 00$000$0W  $ P 1D`$P $ (!C P ,,!Cl0 L0 30 USP + 0B0,0000 0TЍ^A-`1M0,100@UU$ &0t@ T$.1$$P l$ (!B P l,!B6@΍1$!0 U t@+T 0l ! PQS@@P00"QP0pS ~+P03/@, 0 ,1 30 Нލ^H0@-@PMM1 0,10%40 ' 0Sl@PPPhhPPDP uPC+0U) Q 0!Bl1R! 0 00$0$P $ (!2B P l,!)B0 ,1 30. xP0  !P P0uPU 0$! $P1$00$0 x u~ Mߍ0^H0@-@1TMP0L005SUT0 P SP P$0$P z$ (!A P ,,!Ax0 L0 30 S  uP*0,001000 0US*0,000TЍ0^0@-@PTM0 0L00  P0 P$0$P 6$ (!A P z ,,!AP0 L0 30 Ӝ USm*0,001000 0TЍ0^@-\MP@Pd1p 0T00 M4 d @3`V I*T E*V0 V00 4000800 0$P $ (!:A P ( 4,!1A0 T0 30   TD@0$0 0 T$RS  $B@@@0 0!\Ѝ^C-lMT4Pp0d000Q S+R3 RC  BR$ S6$h!7ShS $$ h0 0$ $0$P $ (!D@3 d0 30 (PS6 $ h $  P S S8$h!$0S*R"R $ *S #" S6$0S0(00 0$0$P ?$ $(!@ P ,!Shr R' y) u)V0 0 0  0 AR03 g e1S!01z ӂ C O) ") G)X( X3 X0DT 0 d D3402A 2)0 AR03 - +0 00T0O 0 d T340R1Q@T   ) 0.0?O d D24d>1<@0D00 00H S 0 32W $`SlЍ^'HTH H >S X005C :C5S @0"R 4044 0SS/// Рp@-P0 M@000- 00` 0gP0 0 30% 0  >S 2tt SS h0h 0S   0 0T0:T0 lP Ѝp^/p0s/7@-P@C-U U U ,0(0$0 0 Ѝ040000 0 0| HT HAH@-@0- 6P )-THQ0L S @ S 4 S ( @o//2PPPP-4M\- 0 S0 !$0(0,0000 0P  1 4ЍH Hl0@- @d6P T6P D6P 0 0,  0@^kGSHH H4_P0p@-@PD`6P00@p@@T 0 ^@0H4_H H0@-0 0 MH$EG H6H@-Mh0 @000'P00S 0@ 0088o 0 0 30 Ѝ^+`zHH5HC-P` 됐@,T) 0@`p$ \W0C @`0 ]0p@d00S X 0TT1 0 0/00   ЍW @T`+`HH5HH-M0@Pp00 000M`5 P`'P P, a0 0 30 K^O-@\4AM`M֪0 40֛&TVVx  '0YVc PR& PU?HXゑfXؕ \# 00S $0A. 0t $0$P $ (!= P ,!=03 4 30 8 PR0 XUHPX Pf RP 0  \ PU _\0RP U ハ\ 0 R  PQ%   R B /o"! PXQ XU U X  U X 00 QKY0S PU0$0AUX0 U0 U0 6P0 U0 U 0$0V6 &i$``0:`U00 SAލЍ^/H@-(M0@0$000*S1320 Q00$0  $$ (!< 0 $0 30 K(Ѝ^A-M1@ 0,10 0{V370 U  4oD1 ,1 30J *RhUr  %X60Wl 0C! PP/ `000㨀1$0X 0$a!$ $0P l,!<$P =$ (!<㨀P00"ލ^pH-M0@P00 0\9 00 M0`Pᝧ K0 P Q !0 p@0 0 30 !d0!0Kp^SH40p@-@0PS  0 @p+`HH5H40p@-@0PS  0 @p+`"H?H5H@-0 fPp V#@+bT@DPdx R l ll@ͤ 0pp?010F<0@0p0 ЍVP%@@`*bT@F+`NH{H5HF<07@-@0PS 0 夤 @ Ѝ0+`HH5Hs@-@H0`P0S  0( ((卤 `0P0Ѝp+`H H5H<07@-@0PS 0 u @ Ѝ0+`%HVH5Hp@-` Pឺ@㛺0H00pO-`-}M@pP(2000,24042,0x4010)(> 0b@@cT, P0 0$000U400Y*(0 ,003@PN?Jύ vzP8.2 b?C8P T8TF>B>0 0|1 !U"wzP8.2 b?CP T8TF>`B>2*R<18!PbODOP 0$ 0 P$`Yu 00F?U 0 N8 TF>BbOD @0D P "Pb8T: @ND > 2b?C @0D P Z*P`O1R ?30P 0? RQ 00P0 Q0S^z > 0S7T8@"4`00 0,1(! T8.2 b?CrP Fύ$ -K LMm-PP4_E HjHT^-@ STNO8D`0@ 0 q? 9S !(0St <18!P5 :S"(P(N8 LTF>B@D 70SO @D<18!P4SY@+4D0@ 0!-P 7 STF8@[:@ND S>2b?C @0D P @P 0$ 0D 2S:PP2"0STH>B 00bOD 2"0S J2@TP PY$`P@  1 @1 0c0c0H0 PP 0"@Tt30S  05p #0L P3 1 30 ߔP$(3(R@t@D<18!P}ߍP/$00P/( S @-SiV$~ 8qG-p`ML2@P000P:V"S M0  SI L h L  L h L   d h   L h  & Vh$"V0 0 0 "r 0Q00CW  0 00 0V  "  "X0 0 0 0 S0 p0 0 30/ L&0V  !0SS00 0CW    p 0 01 p000$0  !V !0 SS000CЍ^Q  S"@-b 0Q0 @  P08p@-@Pn&T` 0S f&@opb 00  p@-(Mp0@0$000S40000$0s$ 0(!ᩒ 0 $0 30 ̓(Ѝ^@-@ 0"0 00": Q  0 0 30 Ѝ@>0S 0 0 30Ѝ@: ?0SR600R($0 /$ 0(!e0 0 30Ѝ^G-@3(M0$00%0P`S S,P P R 4 6S 0 P03/T3 $0 30 `  (t #ʠP#$K Q7 S 0%P  P PQ P:0 PZ00  !  : ; 0  $0$P j$ (!7 S6S000$0妶$ 0(!ܑ QSV S    @^:$^R8#à^ d1Y`!0\\1奧 ^ ^ ^p Sh Lo#  FoᨂLo     V \ R V  P  P P  ^Z000$0|:0;00$0t(Ѝ^H'HT HH0 @-(Ml0 @0$0000 0$0$ 0(!E 0 $0 30 h(Ѝ^@-(Ml0 @0$000S4 0$0$ 0(!% 0 $0 30 H(Ѝ^0@-(M0$000S&R S8@00 00$0  ɵ$ 0(!0 $0 30 !(Ѝ^O-p`9tMP 0l00@[`P 890S Rm   /s U!>S0$0S  0S 8(08實 Q2\! $ p\XpQ, SR $ R!Q& U,  0  $ ^Q- $ R *㡚Sk ESU S` \0S$0S2`sQ H0 $ S0PLPP00S6,00+R $0S 0S3 w1 $P $ ,(!06 P&  ,!L'6Q0  4  ,C XU $S S0,0Q6000$0Q6R `A0,00R R0,0000$$Q6,00RQ6,0Q8R RS&RL ,{SRQ,0$0R0 Q0,5 1d13/PP45 l0 30F U$51aXՍPX%zd0Sw㥫`ջ%"U/ V[#[V``Y``V$P &$ ,(!|5 P j L,!s5U6V,00000$0U04$0UX  0T   0r  L0P, $[V0$YP , 0L0 Y0L00 Y0L0T00X 0 r0100A,P $0X00 00T `0 S\@^ WX%  p:%%&8pGorv   0L00$0$P $ (!$  `/X1qH Uxj Q00 V    R"02 fD" 1h!01-0  q  00C $,p0 0$0妳$ 0(,!܎ P L,!4Xke g0RSU0P00$0L倳$ 0(L!ᶎp0 S x00S 8S`pu037U2WS`oU8UL00PT0$gtЍ^b`H%H$EGH H/H'HT@H!0@-P  RR0 H"L S00S0#"#2S;0J 2    0QS0 00 # 0QᐃR 0B.  S,Ѝ^4_0Rp@-P R @@0P0S 0 0,,| p@p@+`HH5HA-Pt ` ~ BR X 0TTa P0 0@@0A?0@$0@0+`HH5HFR@-(0b 0 0 Ѝ@@D0P@0S 00,, `2  0 Ѝ@+`+H5HH@-P@PzP ` 0 0  Q0 0`0 `ЍpO-p@Mt Q됐P HPڸ1Y!01E U 0`㜱cPᐡU|V< 0 1L  0 zЍ0(8  PEX  &0 0e0S 0 妒 0`H0S 0 ᚒ 05 00  CH00S H0 ᄒ `P R0GH$EG HH+`HH[H5HHA-@P p ` !   00p` Ѝ@-``@ P  0!`  ЍpO-P@M0Sp`p`0 0 0R0!  0 0 00"  0 00 0S p `ЍA-@PR p ` 0S!  y!  q0"  g0  ]0 00p`RЍ@-PM@0p0`  ?0 00p`4ЍG-P@p`   `V `pЍ@-@P0 0?`R? ` `  ЍpG-P@p`   `V 00pЍ0O-`,M@S! {  S!R``S!0␀RpPPS70$0 { X - RY $0S tC d1`!0\\1D X10S LH1H0D@!0  414!4Ґ ?0'0S5U PEP5U   00000  d0 0/0pX0 00 P,ЍS!R   HsH$EG HH+`HH5HOHHHHC-@1Mcp0!QPS V+0-0(0o VPe` A ?0 P00R㈀00 000000Ѝ+`HH5HAQ?  Q \ R R T"0 QR 0 P  R R  R R  10 SR  P 0Q00S 0劍 @000S  A/!S  R  P X P  33UDSHHgHHHHHHH-H+`?HVH5H6H/G-P`@iP ЍG00S 0F 8000V( p` p `000 00ЍcH+`oHH5HI@-`P@P Ѝp@00S x 0tt 80pU(_0 000000Ѝp H+`oHH5HIO--?\MpP"@ᐰ0T0000 pܐ8PPv`0  1 0040Ư 0 0(o} 0  0pPS .0p塌 00P_  0%ppR 4R RV0 S 0 J3@㥓L S?U2S<:W  P  Yp! H 0v H0S -Y=0 -K 0?08000000=H 0V \-0P D-g@ 卓 0CS00-XP0(/X(Y $/00S ,0 p :0 1U0⥢-0 0 "ᔀ 0*,0 :iY 2 ?PX<2T,08 Lp0  00. Ћ P0p0;B 71 P0p0;52 SR9W0SX0p+y0S <\+\ 訋 |p  p  `    B ` ;눀0Pp0:*0C7^ ''6W'W3SR UR+6e%#%&  8[ ,:0 l` kk? 0 ` iU90S R9 )X90)` `< F<0 0 100000R0000``X9X0 l? k?k0`D)0 7 U"00C?o2120) <Ws0S (0p pP 4, +00  b8 T0 30K00 ?0 \ЍO`(00 SS3S0<( S00(0( 'ƠP#M PU Pr\;Q0'0WpS 'X+00-00寊 PX pg% `   uP`  N? 0` pF0P00000070AQ00'H0 0D\&0= Q00&8Q0  R  W$'4 R  Q   00 0"R0`& 000S D&0@pG P0p0\5 T0 30\Ѝ&0%&%5RjjjjjllllllmPodopo mP %08 S9 0UtQS_ `%0\P  ` } y  h ` ? 0` P0p0080`5唀W 3祃0CS0qS x$0tΉ F< 0 8 0:0? 00| 1 q0XW 0S #0嬉 3\PP T0 30p0  ;| z w0upUS #0Pp勉 tzph bU4 % zs  AS 4U ((Pեp  PQ0010s <0S 0 1%!0> 1@000000S x"Xt2 0!h"h\< F<0= u00R 4"4 P- P \ uPfP00| 1k>W:0pxS p!0 0\wp90:>=:PP3  pk`  PP4S ^+`HH5HHH2H HFKHD!H H^HHHR$EGH,GHHH\IH? T5K$ HH H( H{ H2 H^ H H-!H%!H:!H H H HI H H H!H H.H!H#H"H0"H!H!H!H!H!H"HM"HU"Hz"H"H=U]#H SHH"H"H"H"H #HM##HSHHe#H{#H/#H#H#H$H $H !H$H-$H3$H7$H;$H?$HbHHHH-HH6HC$HH$HM$HU$H$Hc$H!H$H$H^$HSH$H$H4N %H%H%H%H-%H2%H6%H?%H/H&HM%HH^%H%H%HK  PN V4 00 0) 04&40S# P $0poS0 ̳ p 0  S 1S 0 p  [* 0S `V ThPᑲ`P $3 <0 30 p+@2 R 0  0 p0 C.2 RP4 &0r 抠p0  2 < f+ 0v`  0#2< ( ,"(2 R Z0 ZZ6 0p6S0 6 SP60 2*":P*0Z ( m6AS} P8Sy0 `6Sq* n@#"pOQPBs 14040 0 0 P@+"P04040 0@"@P0E 0N0P@0@P@ 0P  00P 0@@P8DЍ^(H(H_0HC-p0M@0 00y`0 00S  SP 0f P 0  0h0 0 30 #oЍ^^O- \M0@ pX0 0@\0 50(0 0BL = 0 R=h  0.P 0@` 20S0`50S  ` 0,J 0,%,,B| @0 080 0HT0 P L0S0i1 C cCA8B10S 8Cd  ? d0 0!D0c{ 80@ 880080 H0 ` 0CH0 @ 0 ,K} ,Ks ,KC  @<@l,K L ,0 10S <0  0D01{ ,K<0P0<0 0 @TopPH0 P0匠4P0 `H00H0 qY@0 eH0@`TD00D0  K^4_(H(HT(H )HSO-P2,M`@0$00900Sq  0Pk  QPe  0 0 @ P):P !Q!10T [ pp#*[F 0T 2`P<0 0  0p PO0W)p 00 0pP  pߧP X 00 04 Z{V @Tʯ @_0 $0 30& m `Fp0 P  ````᧧![* 0pP,Ѝ^O-PP5dM0\00 xe@Pd 0@4@8@@P (0 p#0C0 T P 02d4 \0 308 lp @P0<0@0D0 (< #0C0 3 P<d@ W 000 0;0l0I@$C1QA * 0A$Y ` `Y@100000@40 0C1R000 q00P03/0`0P03/0@!0P 0 000000000 0T0 00A$0e 4S^ T`0A$[_<0`0 @00C VV0 @0P03/4@SD 4Px+ Pq 1ppXP 0Hr(00,0 Rp0!P Z:0 0 FP03/ `@ |W [1Z:3 #0CZ ( `p@`p`@40, 00 SP  P @ 008 CBP 4 0 10Cs `FqYO00$0 H00L0 0P0 0.0\ H0M40<0P03/ <0I` 80I 40IIH 5<b0b dЍ^4_)H()Hh3HA-P0M@`0p000HhP`Bhh``q ~` 0 0 30 HkЍ^O-M4M$ 0|40+$0h0d $X0p x$\0l p$`0 H0d4R`DP0  PpPpX004d0 Gh^  $wx X0d 000$00cX쳟1cdP1`# $c3#0?PF3#01>PFg 0b I@T. |- 03[)dD3D#D0|0DEd@0 |4 30 "jXLbdM_= dݍЍ^P,10P]`3)HD^`>S GG4_%HhC_<)HT C_[)H)Hr)HY7_)H)H)Hi)H)H)H*H-*H^K*HO*H.+HL+H^@0HX2cKi+Hw+H^00H@+H+H+H^|3H(+H,H;,H^xC_tC_q,H,H,H0BC-?MP`p\ B#  F/\@ 2,0 @0Lp`? UÀ 2 Q *0H?@ ႂ0L X 1 2p`Ѝ0@-$MP@PEE"$Ѝ0@- `P @ <0V0:Ѝp@P/@-M@pP `WЍ P0 *T  EP0@-S 0 00} ЍN.H$EG6H#.H0@-S@ S ,0( 0$$0} d01Ѝ.H$EG.Hx.H@- @p@-`@T P 0E%T 5P A  0D p@-@QP @ @-Q@ l-LQAb$ R O-Ѐ@IDB~tPAT0!03@p&*T` >3T@!ᇈ `U Z IPPY U  PX Ao `bP`>COGO-Ѐ@IDB~tPAT0!03@p&*T` >3T@!L `U  IPPY   PX A4 `bP`>COG@- @ЍO-@$M`P0E SCVpH`p2 iW pG 0EPES$Ѝ2 pE X 0"* Z * X0*0p \ :0H P :W:`F P X*  Z *pP/p@-@PA`E"/o b  U \{UpPap@q@-@P A O-@Q  `0dB0H0C C1HT A 0Q 0 0$" Ѝ\* TP! P1P&*Up UP! e p0  R 00S P AP @ 0t$pu'@pP      00ꫪ \Gp@-@Q`pV P A(  p@$  P~/@-(M00$00㤍0复x @ BUd 00 0 0 5~ (0 $0 30 2g O (Ѝ^7_s4H@p@-`@PὊ P00H0@ R p7_p@-PM0@0L0000S! F  wE 0 03/p`P0  03/l0 0 0` 0 03/00(0 L0 30 f0PЍp@5^ `t4H4H7_00@-@0S 0 .t 00 `4H4H4H/A-tPt`pp2l@T0S@ 00000S 0, ,, t 03/7_,`,` `5H)5H4H @-@0S 00S0P 00Ѝ0S QP0 007{ 7_5H$EG5HF5Hp@-`@P P00H0@ R  p7_00@-@0S 0 s 00 `5H5H4H00@-@0S 0 s 00 `5H5H4HP/`0@- @T0S <00S 0, ,,s 03/@7_ `6H86H4H @-@ 0S 0 0S0P 00Ѝ0S QP0j 00z 7_5H$EG5HS6Hp@-P@0P  0@opP/0s@-@P000J 0 B 0  B 00S ` P ` 0\\s > 0 0 30 eЍp^|8`6HXp`6H7_6H6H6H@- @0S  7_6HO- ́M@1P0(0 000M`00MP⥑Pp0@S D!0@@Pr W 0G /R Wቡ#0 S !r 0 (0 300 Kep B P0S 0Pr R@T  D0/S T0S X 0@@r  0 B/Q K7_^6H7H6H.7Hb7HF7Hp@-@0 0P 03/ pd_G-MP0p8000   0S ` v@U r@@ !0U@P b@0@0p 0 0 30 d Ѝ^G-p0M000` p e Y P6E@0 p 0 0 30 d Ѝ^@- 0Pp@- R(Ay $@: Bt PPp7H7_7H @J 7H C0S :S/S 5J 3J 8H7H .J `8H *J 8H &J 8HP/$0# 0P/( S @-S$ 8qP/$0 0P/( S @-S$ 8q0/s@-`/oV0" 000R x0F@0SP  00 " 0 00 0 30 dЍp^^EG0p@-@PQU  R 0 0 000p P P 00 @-\  @\@ 00 00p@-PD`z@P  ㄃ 00@ 0 jp7_@-$1- A8M0400 0S 0 40 30 c8Ѝ@I 0 PS s @0$0X 0@I h0 40 308Ѝr @0$0X  0@^7_9HhD_C9Ho9H@-P0DMp@0<00`r9HP 0p  C,0 CX 8p勗 0< 8w 000 <0 30 -cDЍ^hD_9H9H0/^@-[0@S`0\ \ 0S  400 0 0S  00,T@-@0 R 4 00    0 >Ѝ7_hC_.:H6H7_s@-@P) `kPU$  E0 S S  PPUЍpP P  P p P \pw 0< 0S @0< 0880nw  YoP2QR_sY#O:H>;H$EG(;H:H80@- R(0   = Ѝ7_ C_T;H6H7_@-<0 R 00 0 0=Ѝ7_C_;H6H8_G-Ppq`l1$0 00 XY P$ `5 1 0 30@ QbY@PT(ᛂ 0P 0 ^U0S @~P 0||@o @P VT 0S 4 0$$@wo Ѝ7_^m0 L/ L wE@0Ѝ^H=H=H*)SD>HO-tMt3p`0l00@1P TUT1 $Ty #$iy S$`0S D0<00@0D00Sq "Q2000"m 0S0刢匲 0 0SQ  )(\0T0`0X0T\0 0P"@Dl X05c9=?0S *$T. <* $m T $T T<oT <`  y  0P 0 0S  d1dRd 000P!l 0S p0S@ 0S ᕓP.D0 !`l 0P@0 +U @< o$ 0 l0 30 !_ናPP0 0||0s  05/T , tЍ^{T7_8TY?H?H6H@HG9@Ha`L$EG(;Ho@H0@-`000PC D  P \R0 0 30 ^pbPh@@PT00S 0, ,,&l 8R Ѝ^@H7_@H@H6H46O-M000 60S0 0P@,a@P(}`@ @P 0   \ P(nP@@0@ CL0 CS(@@ l\X@s H5 0 30K t^(00005I` p0SY K[ 8D8DB G@ 0p0S 0 R[ 񟗃\hr L Xr Z0 @r mᗒ0P00S @0 ^0 ᚒPT  1$0S" 30S sPQ$ @Q0 02H B8300H#HHPk 0S(gmBP@0@ CL0 CS(@X @0"mr 0 0$00#pP  pR!S GCHCH\DHDH^DHOGH[EHgFHFH^7_FH6H]GH!gYxGHMH$HHHH MH$IHKHKH t_`C_8LHLH MHTMHxC_tC_NHUNH}NHR R R000/tOH0/p@-@`VP A pPGM@-@P @-@Q @ @-@P 0S/0@-@0"M@@-@* @-@P Aa O-Ѐ@IDAtPAT0!03@p%*T` 2T@!Dy `0U0  IPPY  PX A- `aP`BOGO-`0FC1sAS@!@3@p#*TP 2T@! y P0 0000Y  B S0CX` A `QPB000OGA-@`PpP  P0 0P 0P 0 0 0P 0p@-@`P5/P`p00Q/A-@`pPU P U  EkP 0CHC1@LP*@-Q10* S1 !/ /988@-@P Ai p@-@ P P0 00S  3/ 0 000pM @-@PMp@-@`V0$0CC1p$P98O-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !P  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p pPpK pGP X:I0 P0p  0P/A-pPA0@`E!/o b @U @P UP AO-MP`   pZ F@<0 080+  $ 0`X 0CC1:$0G#P0Ѝr T ,j OG98p@-P0`@000TL pO-P` pF@   $ 0`T0CC1$0G#P0- T % B c OG98@-@\0(M 0$000 @0@D(0Oo $0 30B )W(Ѝ^O-p\2,M0$000!R' R02,"0((2k  `!$0P0 00   0 Q00 P_ m0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 V,ЍO^G$EGGNH98A-(MP1 B0$0008aRBQ000> 0U0@q0 /v U   P0BC1U:0!0000 L0 $0 30 :V0 P N (Ѝ^98 FGO- 4M`0@H @0 080 |20(0 0!00K`pD0 00M0 0,Qp$2 (0 30 V0S!0 .0 sPD ᭻0 0PT<0  <0 ᘸP80@ ` p!d0 0 @Y*7pY0dL0  (1$!0  1j <0 S07pPD qH  0<*P& T *@00 @0 V0L01 80pDH0 RH0 IY*<0H 0<0 @0P V0 `@0 H0 0C K^OHOH$EGOHOHG-@pP!0@T PEU$` @) @# 0@P/$0 0P/( S @-S޾$u 8qP/$0 0P/( S @-Sܾɾ$t 8qO-Q4M`1Xp`dhl@p0,00 p1l!0h1hi 0\1H!0D1|0S814 d  Wn PP@ @ 0p@ 0 ,0 30% T0V ->0 00u>XY@ ? =@T?@@0i 4Ѝ^PH$EGPHOHPH0`PH@-pP`.@R 0 00 000+ Ѝ@-p@P`@  0 00 000 ЍA-P`p@ P p0 Ѝ{0 0pq07/C-LMP@,10D00gw  0$: U U U/|w 0 D030 LT 0/ LЍC : Pk 0S  0/ h 9 00 @0v 49 0 D0 30LЍ^PHHdI[O0@-4RM01:}.R0R0:%0"}>0 S *S 0@P`p,%0(BP@qЍ04R0*3R 0@P`p 0@P`pd d d d @pd d  0P`d d d ($0$ $0$0$0 $0$0#0#0#0#0#0#0`#0#0#0#0#0{#0w#0s#0o#0k|#0xg"0lch#0d_`#0\[X#0TWP#0LSH#0DO@#0<K8#04G0#0,C(#0$? #0;#07#0 3#0/#0+"0'"0#"0"0"0"0!0!0 "0"0"0"0"0!0|"0xt"0pl"0hd"0`\"0XT"0PL"0HD"0@<"084"00,"0($"0 "0"0p 0!gY,OZRHVHPHPHQHQH)QHDQHNQHjQHrQHQHQHQHQHQHQHQHQHRH RH RH)RHS GG R/ vG@-@Q@ @-@ P ` 0R t pp D] P0  `0$00 0S QPЍp H0MP]`>S GG0$0/0- , 0/0 0/ 0 0 00/cd@- 0\@ :R ^  0 0 00@-@ ^P*0@\^ 0 0 0R0T 0( 0000p@- 00SS d @PPpx[Hp@-@ P Q0 00S Hd 0`00S 0000p[H40p@-P@  0 R@ Q+031' 0 0S S *S@!p!!x!!!!! 00pp@ c  c "<[H[H[HG-`P $ p` 0\yc @ p pT,c 00 @\H[H)\HA-@Py p`P  ,40  .  00_L00 y Pec o\H@-PM@`pP (0000Ѝ P(0  00000*M@-PM@`pP (0000ЍP(0 0 0\H Q@-@?0@ b?(@- Md0@00000 00! b W0 0 30 9N Ѝ^ Q@-@? @ b? @-@PD K@b 0 0 00 Sb 0S00\H[H\H0 @- @0Td@@ 0p@-P!Bp@p@i@-P`@p[P0 0|0|b 0 00S d0P 0L00 F0000 Ѝ]]H$EG]H[Hy]H 0/ P/0S@o/p@-@P {00pp@-M2`@P000t"00 01"P 2 0 30 M0 Ѝp@/20C S񟗎'4((`(x(0)(((($(T))) ;00C!0  & 0!b !0  & 0!  0BHa  0S Q 00 003/ 0 0 30Ѝp 0 03/&0   QB!0 %!d0!0 0L0H 00@0a 00B$^(^]H[H]H]HN^HT^Hu^H@-` M@    0 00S 00 000 0000x0 0 30Ѝ p 0 7 R 00030 LЍ@0^A-M41@ 0000=@S01pj 0`PPEU PU)0 0 30- }L 0 %P 0  0S0S S PEB0!4  b 005#P 0Ѝ^$Mp@-@8`PV 0 0 R`s`P`40 0S S& S V 8 ? /) 40p 000CSpp@yV 0!  V O-M@p@ 0=@S02 P0``F V` V  Q * P0 P 0 00SЍH~` 00 `X aW2V'rP 0P 0P0B00 0S!k` 0(0 S# ( U240 0- p1 #P GEN0 S +  PX*[ 0!0 103/ 00K 00 00 0 00`Fb 0 0 0 ' 00  ?00 1> 07Pk`K$M^H^H[HkHcd@-P0M0 00`p3 @pW0x03/X_  i0S @,0 0 30 JЍ^^H^HA-P0Mp`@000@0   PU  ;0S {@,_ 0 0 30 JЍ^^Hp@-P@ 0 0Bs0RSLs_ 0S S 00ps  _Hp@-P@ 0SSp p@SC00C-p@`P a 0P00CS ( h3_ O0S @(_ 0 gP 0 Ѝ-_HS_Hv_HC-@0`(p 0P3/0P  08/`h 0 00#s  Ѝ 409/X g  0`0SD #S ` ^ ",_H_HG-` 1@M@Pp0<00 0 [    0 H!   ,0 ,7  00000 <0 30 I@Ѝ^A-P0 M@000 0p` `V0 03/Pk^  0@04/@r 00Sh PX@ ? 0 0$0` 0 30 I Ѝ^`HD`H`H`HA-pt0 MP000@ 0` *0 0 0 30 jI Ѝ^@-Pp``@0p!, ` 00 ЍA-Pp@`0 08/P"r 0 AA-`Pp@0(03/,P ] 0 P0q 00]  t 0`0 0PP  -Y 40  .ЍAP (] Ѝ`HkHpL]aH$EG[H`HoaHO-p` @0SSP0 PE=00@S0 10U0  P#,S- $]  0 00P 0P jP 0 0S|  Ѝ 00 000 X`] T]] PE0  P 0  O] $MEbHbH[H^HaHaHaH@-@0M`P(p 0 00_00 N 000 00SW0r p0 0 30 hHЍ^s@-P@`0S0000ЍpA-`@pP0 08/%q 00 00Sk00Ѝp@-P`@ 0S =0\ 0 00SpV= `p^HG-PT10Mp@`0,00 0p Z  !   p0 E  `!   0  !  `    0    pl 000 ,0 30 G0Ѝ^C-P14Mp@`0,00 0pL  V p0 ? I 0 e !A  ` O  K 0 U  C p" 000 ,0 30 sG4Ѝ^@-b@00P0 GUD0 0@0  Ѝ@HU 0 00 #\ mbH$Q`bHMbH[H@- H@H0H @D"@0 < @8!40 0 @,!ЍC_bHV&OcHVdHdH$VdHL1C-0000 00S:0 00S4@` p P hP pcP P t@f 0pFp gp GW +i [+b80 0 30 F@ * Ѝ^C-8A'L@ᘾ  0 0 30 B$Ѝ^p@-@10M`Q0,0000P0/S0V0l Pq0 0 V  @5/ 0 00 \0V S 0 00>W :떿 0 $00$b$ 90 0(00(S(( 0 ,0 30 NB0Ѝp^iHUiH$EG[HiHC-Z Ѝt@ @-P`p@4/@$j 0S i  0P05/VP + P `0 - @ Ѝ Ѝ@N A-`pP@8/ 0`06/0 WЍW{  0*U@-@5 @-@/ @-@) 0p@-@(0P3/ p@r0p@-@(0P`3/ r p@sA-@ P`p7/+ P  00A/ 000p@-P(0`@3/ @r r p@rQ0@-@0 aG@-@̻ @-@ P P Aྻ $0@-@ 0|zxG@-@㪻 0@-@0h`cG@-@ 㚻 0@-@0XbG@-@㊻ 0@-@0HFcG@-@x p@-@PU  @l p@-Q@ `?@-@P AZ O-Ѐ@IDAt峩PAT0!03@p%*T` 2T@!=_ `0U0  IPPY   PX A& `aP`BOG0@-@0 bG0@-@0lH@-@  0@-@0kH@-@  0@-@0PlH@-@  0@-@0kH@-@ ֺ 0@-@0kH@-@ ƺ @-@ 㾺 00Q/уQ @-@ bRp@-8S @`P ` PpqH0@-Q <}S @@0 @R0 2g"02qE < 0E000S Zs$ 0Q$00 $ <W $P<HIE <@8 <5 @ 0S `$@PH(@u,@媚@$X u "< 000 408000mk_U )P V@$,@  (@$$X@P P(008P`00 0\`00``d````00#0` 4`8` 00(@ `00P*T0-(9 80 T0 30 00 (,NLXЍ^RHH$EGHHH FG8-MHH:_@-@P A༫ 0@-@02HH@-@㪫 @-@P 003/O-Ѐ@IDAtPAT0!03@p%*T` 2T@!O `0U0 W IPPY R PX Al `aP`BOG-  00CS  0 S Q R//L0 P 0/0 S Q R//:_p@-P@ EopP/dG-@0P0 000ᄐ,B |iW0\0 0 30 @ ,w T 00040800S$00Z4\z> <@` PpW 'Pp`V@00  CB00S<PpA 04$2  v 4`80V004` 0k040 PF 00Up0 a 0PP CR W PY 8 At 00pq4P8p<Px7P :xP0 v P@EA 0 v P} S GGԨH5R@-@P Ah 0@-@0,DH@-@V @-@Q@K @-@P 003/@-@P p@-@`VP A. pP @-@NN1NL^*ၔQ10* S1 ! O-P 0J1 SkAS@!@3@p*T` T@!I ` PY UX A 0@d&`@sP  jP ꫪUUUOG0Qp@-P P@S A@D@DP apG-PQ0@ p BpCBUGp `p  BRwA W PQ`P\Gp@-PJI @9Jၥ ֦ pp@-@P\ \0Q` V V V0 p@0 LHMHHHH@-@D0Q<  \0, (\$ЍTHGiH_HqHyH0p@-@PQU  R ? 0 0 000p P P 00@-P1-TM0L00㽯@P @ $0S lMU# U8 UP0g,!0( ?P 0Y 00 L0 30. )P0G 0P 09 0P00h 0LP 0"4 0TЍ0^PHӟGHHHHHHp@-P01- M000GP@`M 0Q ?V 0VP P0` 0B0PX0 t$0 0 30 ( Ѝp^GGĠHHHӟVG00@-$M0000S @PcP0 C  0\GH0 0 30 `(8$Ѝ0@L0 0 30$Ѝ0^HH[O 0@o/0;_7@-40H @P 0 $ , 0 (  | |@t 0pp@h 0dd@\ X Ѝ0@R 0;_<_XH4\PȶtH%HHFHHdHGA-PH1pD0 00㈨`ᤘ 0{]@T BP < :P 5P 0P0 Ù8/PU 0 03/0 03/U 0S PH0 0 30 'Ѝ^iH{HHĈHHHHHH@-P00 00 r1 0 0 30 'Ѝ#% ^@-LMP1@`0D0000000(103/0S' 0S$ l ,,, PppPUPU p0 P00 d0 D0 30 E'Q" @᭭fP: 8  U LЍ^<_@-h00 00  00 00u0 0 30 'Ѝ^O- A\M@PK1`lpK0(0 00d0 `0 \0 10ბ1 %@0 XK`XKdKXKJLd `0l 0Cp!1h0 0@0 <0  `3dK5,1 (0 30C &p .p Q2 _% @@K0 0Md< L&0l LK<@04/LKdK}LK릤 @ Q~ 0S z 뗤 떤 dK뵣 ꑤ KdH^a`m۶C-Q2/ %P ' ?DP P0 C ]8 0@0 L0 30 TЍ0^PQH VHӟGH0@-TM0P0L00~@0 $0S >$P  ?KP P0 C 8 0@0 L0 30 TЍ0^P]H VHӟGH0@-$M0P000900S @PP0 C h0 H0 0 30 <$Ѝ0@0 0 30$Ѝ0^Hx`HHIOO-`0DM,2p(P@h0<00 R-T$ T豟X>p( 0P 0@  C,0 C  |8@X1 <0 30N U0S000W 8<V UQ HY 0S@ 0Q 0 W 8< VUP H Y  R_ @D[ql0s dS 0X0 TL H  DGDЍx;_^p`ŚHךH!gYD_ HH)HHH6MfhHH0@-@1lM40d00/ 0Sx0\S! 0S x t1 d0 30V x X< R1S< F(#,P0P C$0 C 0P0P 0S#BuP #(P0 C$0 C 0x!0P0 R 0S@\x0lЍ0^!H0HBHD_THhD_\HqHOJ@-@P 0S S S8 4 l0 - ,$@^ꁛHHЋHH)HH@-@`P 0S S S\ @B S0S<<q4n 0 S$ieH˛HH)HH.HC-LM@$1P0D00VT 0 00, $P) 8p@0<`W`Ï, 0Up ,0P0 $P 0 C $ ` 0$ P$'0 D0 30 LЍ^5K$EGЋH9H}HHP[O0@-@1-M000=P. $0S xTL$0 0 30 T Ѝp^GGӟVCIGGHHއHp@-P01- M000㴙P@t770S"GP Pテ0`] 0 01$a0O0  t?kl \?cT$0 0 30  Ѝp^GGӟVCIGGH՝HއHp@-P01- M000ZP@70SP P )0` 0 01$a00  t?l \? T$0 0 30  Ѝp^GGӟVCIGGܝH՝HއHp@-(MD1P0$000@S 0S 1!0  1?' 6x 0S S( S,P^XU0 $0 30 ]sP 㰅P 0` C ` 0 +`P 4 ' (Ѝp^H$EGЋHHEH[OӟV#Hp@-h1P-`(M0$00㡘 0@S 81h4!0010& V 0S 1k!01D60S P P\ 0`6 0 01$a 0( 0  h?D`$0 $0 30 (Ѝp^H$EGHЋHtHHHӟVCIGG@R@-P-|1,M0$008@QX1T!0PP1y& #PSRp 5P P0` 0t 01$a00 f0W/  | p0D0 $0 30 r  @ 0,Ѝ^=H$EGЋHHӟVCIGGXHsHA-PP`@pLO0`00 PPPQP@@     ! /C-$Mh1hQ00050P 0<0003/P0 @pT 00CSp`'@  BR0P0 0 30+   BR0S<0@ 0 ؃!1/P`V 0S8 0<0#  "0 000$Ѝ^x;_ p@-0   @QS\PT p0S0 0!Sb(4444TtTTt00000000(0SC 0S000SSࠡ0`V3 S@ 0`V+ C@/o0"0S000S00S0 00S0 P0P8 [4'% 0S0 p% 00ꄟHЋHHG-M1@a000pT0 0 301 BP$ 0 S# !S% S0؃0S   7ҍP 0 Qd0` 0\\0$ !cu@003/0 0Ѝ^X^1`ɟHߟHBHH$EGЋHH<00S/P R R/0x;_P/0S /P/o/A-@ `$pP[aP0VPTUO-DM`t0 0"2H0<00L0hp0ClpC1O R:V F0188< <0RP L$0CCV:<2 <0 30  8< #W " 3 "R0` `Q0 R#$ #R : R 0R0* [G(0SD 0SA ,0 T00 p|P4 x|0@W,* P&*P @D0@!G01 01?\00@0@D0S0@   Q * R*0 00#  ѳ`}  $0 ȳ, 0"  $0DЍx;_^/Ha`נH$EGЋHbHG-0@ pP#P Ѝ@X 008`<@t IyoᩒPY W0:`OW@:O-0pᴰLPH`Z@ 0S00S )0S  0P 0S)0S PH執P H-Px;_p`A-pH0P`AX 0@P x;_O-$M̡H0p@ 010000000T>3PHQ[F ` 0iP P 6.  @;0S @PU 0S0S&0S '0S%0S 0 0 0P .  `븱 0S|0S  P3P P0 0 30 -븡00  E $Ѝx;_^@-@(PЍ0 #-P 400SHP HzPp`@-@\ ЍP0 # P 400SHȶP HVPp`A-pL0`@ P80R  0AS1P ^GEIC-M^D1@!0<1<x" `@ R$1!0 1 0 pCWLppX W2XЍCLP\0CS&#0 0000#P 0RP @@0@o S 8<<08Q\^ЍꍡH$EGLHЋHHMSM 0 0Ѝ/P 0C-1|M`P0t00  0pPhp0!0@ S Y*0@!8%0, <S` 0 00d 0 00!  0 0,pH00101010 100$1 0S (sK0{O#,7P(xKU0)0,0 t0 30 (lK |Ѝ^H$EGЋHHMs@-`P@P T0 0T S40J0 0,,0! @DTX0Ѝp@Ѝ/vH$EGЋHHp0G-sL`HP\V@0 00CSW300P%0S#ISP%x;_a`P@-tM@<0@P C0p 0`    80 040000#T  @t@V000tЍa`P@-@  T P ,P Q <_<_\=_=_0@-tMP1@ 0l0000P  jPPh  !!)0S  R0S 00 0UP :PP 0000 h0 l0 30   JN!P  J J$ tЍ0^Hp@-P0iS0fS`@P  @vp@s@-@P!10CCT:Ѝpa10C1S I!1BAT:p0Dl 0h0h RSPD030 080B@DQ  @x;_XH$EGH5HHiH/0s/@-@z{0 0 00 a`A-P@`pT(0S@ 0|P A-pP0P`@T 0S @ 0P x;_ p@-rP@ ,] R Wp@SR7H[Op@-@PJp@@Hp@-@P?p@KHp@-@P4p@WH 0p@-SP@ S SX T /P L` W. 40 p@;O#HЋHbHpHiH 0p@-SP@ 0CSLH oD S< (p@;O~HЋHiHHbHp@-@\P x0 p@oꗤH 0p@-S@Pp Sh S\\ L V Rp(p@ { 륤HH SHHHЋHp@-@\P `d 0 p@3äH 0p@-S@P0S\ p 0Sx R H~p@S0S   D8 ֤HmOHݤHޤHHЋHG-`  $pPp0@0S !뀠<0  @0SG=_=_C-|0`(p@T Ѝ 0S @PU %0S P 0P x;_8 -H0L S Q Qx;_A-D42S 042H tc孮3H S<2U3@23D23H23l23p23t2嚮3H lqU1 taQ呮3H 23232323232323H 12p32l32h32s`3H Ug3P3$3L303H3<3g@3H 1031,31(31[ 3H \33`3 3d33h33l33p32t32x3232323A2H 4C020202020202020-2H Cy1212412812<12@12D12H12H C:2t2 2l2H t3\23X23P2H LC3@23<2382442 4024,24$2H 842<42@42P4 2T42\42`41H  4141414141414ѭ1H -414141414141414彭1 u 51(e8514UL515x;_^pdp%Hd3H,2XS ZȝkPDV0U`1\\8<PS0,2L4$,<[|DP(\0?_Hl0 x@0TR\L1w0&A-`M1P @0\000p0`1 P 00$0 P0pPP   0S= 00$Sfo 000C S2 1 \0 30; lXp P Ѐ0p`V 0 2(+  (=PP (ʝ 0P gr`N P@)o Pk 0UvQ `Ѝ^@_)Hx;_O-`-pDM"p0(0t0,020<00000S !P+C0P00P0P 0S 0 $0(0P,0H2 <0 30  0@0,S"Sxe L 0@ @ZL ˩P Q@0@{00 08+Sg!8Y0AG  ᲩP0@00 h ᩩP 40#R8l !00$ ᖩ P40#PRX S PR 40  Q Q m 0Si P@ᄅ 0 0{ Z 0CP 1XR o 8pl SDЍ^SHKHO.HGHm۶M@-LM`@Pp` 0<0$10D000S p `00Pl00'4ph0 00 G00S000S000 0<@O @\F@x0l0$0 D0 30 LЍ@Ѝ/^M@-DMX@Pi 080<00` c 8 8@840 <0 30 8 DЍ@Ѝ/^Pp@-pM@<0` CP     툱p0@D 0PP800T@40000# P  BP  pЍpa`^@- Ѝ@>_O- ⌁,M∑10(0 0|1p$`Wd1 (0 30P @0S= S@PK ( Z@0S2 !0- G 0 @0M 0 S 0DK0< DK\|DK0SX0   `!d0!0 0 K@_p`^a`XH@>_x;_O- _O- ܑ_I-━,Mp10 0 0j@ RG 0R@8PK` T08P@9 @0@D!08 p@00 1000ᄧ0 ,@0M `0S 0<K04 <K\<KL00H0 0 30 !d01 @ p@K@_^{H@>_@0@-@0hdbCp`C JhEI@-@J㄀ @-MM,1@p`0,10P 1@p0   @ @@@@@ @$@B*@,@0@@@D@H@`@d@h@P V0APAAA A$A` 0Q0P@P PUP 0 ,1 30 kMߍ^hEI@-,MP@00$000PX/0` R  %Cn @0LpHPWC`0 $0 30 =(00 R 0S (0S @,Ѝ0`^Hx;_P/@-@BP@. Q/@-@B00G-0`(p0000@T0 0 30. 0S @ 0S0S 0SǟP U 0S#@V * R0*  B봠P B Ѝ^x;_0s@-P000`@T\0 0 30 0U` ` pB@ lB΀ Ѝp^O-,M2PR0$000Ԅ8p<`WYP P P  vP 0@ C  0 aY @䡟i!0!DH00C1S"MBW qډ倁P눑ԉ|!0P<`8@V*6B$1 $0 30B I뿉40T0P 0 C r 0   ꨉ ꣉@U PP 0 C U 0/ꌉꇉ PA( ,Ѝ^a`HӟVW#HkYY8H[O"PޥHp@-@PTUDp0S S S 0S 0 03/Pp@  ppKHЋH0@-$M0P000@@'0S ?P  t0P1$Q0 C T0  0 0 30 $Ѝ0^GGG[OCIG0@- 00CSSSSSSS$zHH٦H HBH0@-P1$M000ވ 0@S S SM @ ? ? :  1PP0 C rp0  የ(0 0 30 + ႨH $Ѝ0^HHOHuH§H}H#HЋHTLOP0@-P$1$M000㉈ 0@0CSxUUUU @9 ?Z  P PP0 C t0  2(0 0 30  )~ $Ѝ0^HHOHHuH-H}H#HЋHTLOPp@-`@P@ 00p@-`3-TM0L00!0@S@3#03a P%,? 0S G 0CS y@,3 L0 30  S0PS YPP t0p 0 HZ" @O,0 h0, pX?,q`PP t0` v0 *! q@,0 _0, @PP ut0p O\0 D! J@4,0 8 0, ,P Dt0` 0   @0 h0, \< ?, } TЍ^=H$EGЋHVHӟVVMH]GHHgI[O@- @X00000: R8^ } 0 0 30 Ѝ^H<@-@ 0 0 30 Ѝ^@-h00 00  00 000 0 30 iЍ^MO- @M 3T K`p0(0 00%Kl0 < KT0KV$K<0K!P K-Kl K K'P. 尀X0PR\`R P 0   KN\KlK>2 (0 30 ,00#V00U00S 0S K& 0R| xP`[   0K0 렀 ᐠPU 10S K_0K p\KQ|0K lP \P0K C+ K00K   ?0U\PQ\P0Q\0 fK59\`#0 0M<0K K10 00 KKK>XK>lK>|  KOЍ/^HH:HC^D_v#MzRhD_!&Lz7RH,O[Os@-P `@|@Q>Ѝp>U@-D0 0 0040Ѝ0 0 0 30 CЍ^(.@-D0 0 0040Ѝ0 0 0 30 ,Ѝ^8. 0M0000Ѝ S@-0H   ,  0 0 30 Ѝ^H. 0M0000Ѝ S 0 Q S />^`0S/>^`0S/>^`0@-@T Q AQRS@dR$ SHS84@> $@x;_HBHjHH^`ĩH0Ps@-000*@ P`PtN 0S\H 5   U 40 0 30 ~Ѝp^ H!H=H[Op@-`@PH>Vp p@^`rHA-`P0 0 S0PUoP 00CS@pTW d">P 0S%0S  00R P %pR@x;_^`0O-PLpH`㴠崰X Ѝ@$00R%0S 0 CSR R0CS#DP %0(0 =Wp%  x;_^`Hp@-PP@pT@p`K> @y @0@-@0tyxwd=`U\90(> EI@-@y  0@-@0^xEI@-@y @0@-@0KIm<53EI@-@ky @0@-@0oP $Fό0EI8-M@-@Oy @0p@-@0PU  ?y pEI@-@4y @-p0 0 0000000 0000 0 0=0 0 30 KЍ^A-PM\`HLPT2"0||2 @p<<8/<<~W0S1 xQ. 400 0X0080 H0S L0S0<8pt0S 1!01 [004pSt0W800X00 xxp00 0S T1R p  XpX00T=0 0 30) Q!z 0S0S R W 00S %0S000S0SH;z 00~ z T<y Ѝ^@H$EGЋHުHOH?_@-`0 0 00000000 0<0 0 30 vЍ^O-LM@`40D00 Pt4p$0l4l# pW\4H$0P4TD4($004 0S R RSwyPs 0S( y+nPl 0ᝡPd00{PP P  P|s|3 0tt0 p$ h0o \3R1 % P0 00\0S  P 0Q0R P P Y0 ( 5 ((:000S  0SD0Sx20V S z>0 00CSs0000n? P oP(0 C  (0 0, / 4 ( (0000SPU @:(P(,P, ,;6:P(pP:Q x P p):  B  R 0S#\y P0 $P0 0؀(0,P0 00(0S(pW,9Zy 00<0 D0 30 S,9Ny v4LЍ^H$EGfHЋHHHtK,`,`ӟVҫHثH <_x;_:HiH0@-M00 00PPk@TL0 0 30 "PP k;9@Ѝ0^ V0`p@-@P,yp@:^`p@-`xM1P000m 0,S 0@"S1P8P+0P1Q %R 0S l0 P@X1dT!0PP1 L @P JP $w X !at $w  0P0000 0B0h P00 000tx Pp| x w :(0 0 30 :Ѝp^H^EIHEIx;_HǬHH$EGЋHXHެHGEIHHAHCI(0@-@T 0S^@x;_0p@-P00UpU@ :P s:Pp0@-@p1H?_oHHHβHG-p`(MX2@V0$001tt`pP X @-31 $0 30s P`БU '0S &0S  "'p`PP~P`tH 00 !0  0 _ 00S (~ Kp 0q 00BtP2 t00؃P N 0  9 +00S V Q{q  R00Stu q q `V`pV  0p`(Ѝ^H^` HGO-LMP0 300D00t04`(0S SV 00l3 D0 30 `PLЍO0S5V+ 80@ᓦ# `,0,0V73 #0300pt `WZV t pWf0TSOo?oB2T 3x2 D0 30LЍQ 0 Q% R0  R 05t0pS ؁<0 ᦻ  0<@ @@@(0S p 00c0@08`hX  u 0SpV t o &Y '0S h`Z XV hQ P& P &0&0'0'0`Vpo`8<8< Q\r%% Qn&& Qj'' Qf@0ZQmp 'p ^&HLj9h(j9^`@-LMX1p@0D00@1`0000 0$0(00p\ ,#0S ,d 8PR p00S   0 0C 1 0$080C1<0 , <0 D0 30 3, Lo LЍ^a`m۶@-@x0S$0 00 Ѝ@ꇳH$EGЋHfHO-lM(8@0d00<P 0S 0S> o`cPb 0]`Pr@7m00qP00 em00`09 pP0 P0PS4000000^ 44Py4L4P40`4x0t0PS pet0 P00040P00; 44PV4)ZP l65Sb003/P0 0Z@H Vr PS 0( 04080<0400,00S 5R 0(S B((0* 0O0'000qpa408 R 0$0p5l%0hh5 F( Z 40(0P(( "j P 0 S0Sm 0S 4/0S) P0@0p4 d0 30 ', 0(P 000CS  (0  P( `( , R``VPPV U  10Ÿ 0S 0C?o2$ p0S(p  0< 0 ,00 0 V 0uP0PcRP00B1@0D( 0,s5S] 4`8 V 3 #03 P& 0S@[ 뎿 P ZX< 5 `X00PV0p`U90SIE[ 000CS 5$Sf  $p P  P  0S  0S003/5F PT 0S 0ViP 0CSpP *PP 003/0  o  ` 0 `S 0P5S  0S 0000 @0WlЍOk4./m 0.4.0 d0 30lЍ^x;_H <_H$EGЋHHH%HHʴHHOHA-0@p00000000PUx0 0 30  0PS P`V #SR ` 0y.l Ѝ^x;_ 1G-P0@Pp   P` PpPPP P P$PR*P,P0P@PDPHP`PdPhP P  QQQQ Q$Qp0%P0V2 `-  . . ϯͯl hEI 0@-0C S$  .  @0!HЋHCIp@-PJ% @J k ul p@-/00 0./d 0 SH0 $0 30  R 0 P@ *(Ѝ^x;_a`C-,M0 P0$00 0`00 /` `. @0Td0 $0 30  0R pW`  ` ,Ѝ^Hx;_G- M 2`@000tPᨻ!P P1puþ`00  0Wp Փ0S $ R00 0 CRS V  PP I,1 0 309 U0S  R& R '0S  . Px00p W.P i0 @–p|. ,>j Ѝ^-%Hx;_ U@0@- 000  k0 0 30  Ѝ^O-|M5p0t00Ppns@` 500Z \\0 ]CYU X R 9/P R X@  Ϡ\R  Q R [qp@q R  W` p40S00, ́ [ \F V K\@ i MDD<\\0 0D02\. D, V 8D\\00 D0\ D V #D\\0 0D0\ D V `DwX\t\0 0D0\ D 0S" V  WD ]\Z\0 0 D0ٹ Q\N\0 0D0͹\Ɇ Ddž V D<|\9\0 0(D0ḹ\ⴆ DⲆ ιV 1pWչVFY<U 0S3N3YUX 9/Pp0S X 0/RS /vP 0S0S ' 0R( 0 t0 30- Q 00S#,Z όP\I DF s2P|Ѝ^x;_iHOyH-PKG}HZHUHPHӟGHHHw`߶Hp@-@qPH dPT 0S$Ἳp@ ᶻH(Hp@-H @KPqUpT 0Sp@堻 p@蜻 FHWH@- 3@j @--@d 0 Q /,   ,@-@l0 0 00\00000,P40 0 30 0S Ѝ^x;_0@-@PD1MP000D @Q }P 1w !01 PUT T 0S0UPP 0S  @0 0 30 |00 000, @T\0S Q@Ѝ0^H$EGЋHuHHx;_ַHHp@- M@10000P 0SJ P ` @Q  CP"000S  8, P0 0 30 l CeP  zPUP   Ѝp^/HRݪGx;_@-@l0 0 00\00000+P40 0 30 00S Ѝ^x;_@-M0C0 0000`0S P  0p%,@TT0 0 30  P 000Sp(+Ѝ^CIA-P|`p +XL0 0 30  0S 0P Ѝ^A-P|`p +XL0 0 30  0S 0P Ѝ^C-M`p + YL0 0 30  @T 0pP Ѝ^  Q  /+O-@x2-M0|00~ P l0d0dcd6 0Qd 0C SCc   SX(d nf V pP y00C1%P80PV%P 0 0 0S 6(d׃ @1 |0 30G &0(0 p0W (8pp@ +0 PG0aP(`  (8 $PL0 A 80`b&P`Ѝ^pHHm۶OG0p@-@T P@+@p p@+0@-LM0@0D000 0$0(0sPP6 -  40,0,,0  0C  ~ ,A 40 D0 30 ,6 e LЍ0^@- M0 @0000   k"  g} (0 0 30 a~e Ѝ^C-M1@P000PC`V>cP9 @c؃`  0H@ `X``X@8`@0``0?o0 0 304  >$`4cP P#pV c`c  !0 W T˃P 0[SP  8d V Ѝ^HθHxw0C-@`0000 0D 0Hq\*80\,W%+8Y8PXP80 0 30  T d  Ѝ^m۶ѸHQ/A-@ P0`H0CVF Pn+P ADc PPP00000CVX+ 00BR+0p@-P0@ !!0 ,00S,044,00000@@L0L0pO-@-MP800, <0<0000l0p0t0x0_P`(0S $0S #(000p0@005P 0 $S0,<S$0 000S0 uy P #|)|`倀 X pX  0S  P 0000P0S&0S '0S0``0VpP 0 00 0R[ 0S X0XX'X0Sp(0 `0@@@`@'@`0Qd d `x&c  P 0000Q0S 'XP/ $: :R*#X(X`\pX(`(0W)W000 0S9T0S00 P 0000Q 0S 0$0 0SX95SF?(0 (0hP 0000Q00S~ x Av4XLo D0,SDDB D0"S  D| DD0"S | c, D0,S S X DD D`dhD 0S` PT0d0 H0C$ C1 0400+S QH 嗮0 +SHLdh L0QLT00dT `UH0LD0 ,R0D0cP0P0T'P'T0`L07|ͥL0L0 &L 0S? LG`%|⻥Qc c T P 0000Q 0S@  &W P  x0S P 0000Q0S&0S '0S 0| |0P 0S 0,`#0 e R50S HP EP T5 0S Hώ60003/7 0S0( H ẏ`p&`-&,,p P 0l0`0p|gx%l0S 0 P 0003/P 00l0|[%l`V pp Wa t0@`0x P %#f 0S3#03 0vWWS#0+P 0%0$#0|P 0t`S+8 VT00< 00 830 0, 0 R  , 000 {V V# , #\ 0 > `x$2 0 30|  0 X0(00R> R; 0S 0S2!012 3/P"D0S1dV0D00003/PT D0SP 0p*0p(00D0o(P0D0 R 0S 0S1 00 3/PP 0U  oQsa lb Qka lb ~ aЍ^CI^GEIx;_HiHjH Hp`bHH^GH$EGЋHH^`z7RNJqHH.HaH8NHHںHHqHC-dM|1@(P0\00$p0*p0'$`!(!0 000<40080'H'0pT00 00CS0 00CS*0S 0 00v <>"` *0S 0 00i ;"(0 (0*0*0$0$0p@5(*p$`/("0 \0 30 dЍ^ѻH$EGЋHHHQ/A-@ `0PH0CUU uUM M4 ` v'P A+_ ```000`00CU^' 00BX'A-@-PpT0`0\00 0S  pp 00$P$@0 0 p 00p00p0P'A-@-PpT0`0/00 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0*'A-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`000 0S  pp 00$P$@0 0 p 00p00p0x O-ML<p000L0H0<0P0HP@008P0L0H0UdċWdWC PG;E!/o b &/`VP P`P=$`P(0S\P 5S 0 0S 0S;P 0 0S0R 05Svhŕ@UCڼ*@PZ%jW6L00H0> 00< P@` R/ SD:@PP@V00 0 LSH`aP P$P(P,PX0SV00040D0\%P)% p R(Y R / 8 P P(0S PU 4p␫`cPuPr9PaK48 ] dPVdPPLWU( #@P (0S $0S 0I"NTP D00 040PP Pu PP08S@1 0 30H S0D`H00L0^!HPU 0S(1(100#S#vDPP`@pT0W0 VᨻP (0S0!(p@DGPxV:{V7=~Ѝx;_^Hx$EGЋHYH,HnHHHؼHx<_p`H V0` H3H{^y^^`A-p0P`@Tl 0SP @ 0 BPA@x;_HH0@-@P0$M000墭@00P00000 ЍLPD 0 0 0 30 $Ѝ0^H@_H<0@-@T@ 00CS@x;_O-dMğpW4\7p0S  R RF+@000T PP 00S 00S{ `003/0Sk Z@3k<#0838a PU(3m#03H8RP 1\8\8RP 0s 4  SX 4sXP P㨰[ 0S E P P[Y: "ꚫP  Xq $0S 0C$0000000S"0S 0S00@p fP  Q E[ \ dP!U\ \ 0 000S(00C(0S00000 0, S00 0S HzP0D03/QP 00CS@PUT' y,0 \0 30 00dЍ^H$EG!HЋHtK_H^`HlO@-`Q Z [ @[ A-`h@(1pP 0000 ៾ `W@ O+8 ,0,0H0H00000`01118&`10\ 0X0X0P00CP,0 0 30 w Z Ѝ^^MA-(M`@Pp  0@܀ 0$00300 00 0P Ft0 $0 30 EX 0R 0S S  0 rp(ЍAЍ/x;_^a`A-@p尀cVЍX 0R 0S0 SPL00|0S L0H 0DD0 T@|@0 |0S|P@`x;_a`H$EGЋH¾H0@-,M0 @ 0$003P0*0 00 0PT0 $0 30 X 0R 0S0  ,Ѝ0^x;_a`P/ 0 0@-MP x 0P@00#r\ 0 0 30 Ѝ0^@>_M@-_A-`MXpP@ptP0000dP0`   0 0 30 #Ѝ^8-M@-$<@JЍ@>_p@-`,P@Tp 0S` `@x;_p@-`,P@Tp 0S` `@x;_A-P`ᖶU@ P0CP0 00CSd0dpu ? Uȹ<VAdp►0^x;_H^`O-pX1M@000 T0 Pw @ w1 @0000S g 0 `k렰`[ l  [W  q 0 ᘠ00p  @ nD0 0 30 t ;W bX Ѝ^!gYEIH8@_ 0 B/o" 0 B/o"O-lM`0@PD0H1< 0d00 0C!1U:1 d0 30f 8  @ XTpvnl!0L@8 000 0%"P0\  ` < T < 0 00X 400000,00(0D0$00 000000\ 00@0P000 pmkPi P\L \@\PL AXVPTLH6W \lЍ^m۶CIO-MP8<| 0 S@PDL H 0JS H2DD"0@@2n yQ TP p `2 `F`daP0\0L0PpX0Lpt`0thp0\0x`l`l0X04ph00`p000\p,00Xp(0<0 $00` 000000000 '8d=  djd@lX\`ᰚ TLPHD0 |0 30 @  dKX\`T⏚LPHDGW TpЍ^mH$EGЋHHm۶J@-$M$1@ 000C 0P`S`F0oo 0 b 0pP P @ ^u20 @0000B@ 40 0 30 V $Ѝ^!gYݪGxEI?_A-0MP000`p @ #u0 0 @0t 0@  40 0 30  V Ѝ^CI V@-P`@0VppS00 x0PP U PL V ,0  Ѝ0 !gYݪG`?_?_HO-M`P@0|8D< 000 pW THz` HX0F p D P0R:80CP0P0S Q Q PR*0 S SpP0R* Q Q PR* Q Q0CPS P {! p HP0CP0@PR# D00 봐00 &0h  0D DT*\00  SR p \P`0FḷP Wp `p" 9 p000000D Y*0Z J S S T00 03/P @Jl0 0 @DTz P X [ 04T X 0X0L0X0P00S,080 s 8Xt ,0\00S! LV \V0024 W0 0Dx \ !5p p XQ { \400P `P FRt3zP000 `P` 0Pdd0(0P00P00S  00`(0 mpkS 0SXPP0 @]V0 LPP% BV@-V3 00000'P800 ,@P T$0 000e$0<0S S  @,Ls 2W0`@ 2 ῸT002倰0 JX00T0v 00(000S 3 D2 \  0  P0 3/0 0] W 0000V 0C \f800,0000`t`0p`tKP H!0U0|P|@S Y !4 @0`0 @fi`l\Tq `0 0 30 G\Tq ^T N`QЍ^VKHHH!HRHSqH>_EI <_a`>_4`H0`8-M V0 0 0 @-(M0 @0$000 0p0  000!D0S 0S0 00 $0 30 (Ѝ^;_@0p@-P@Tp|P 0SPk@x;_@0p@-P@TpiP 0SPX@x;_0 0 Oa`O-M<0 6(0000̰5\0[`0d0h0@05@0`Ȑ,05%05Z hTpP 0S@40 X3/`pd W @XjL5 0 30K |Zp WV 0D0H00So `P00@00T <08;8d0l`0000X 0p80804pW  (Pt0l00 p0t0!P8p 40 !{l  p X^jJS p TDPHH X8@T D0$ P00 D0 H0 0 @ S(0 0< 0T0 P `4/8VT 0S < 00#U00S `0p0000W ؁TP ၞ0 0T 0LlL^Pk 8pUT Gk DfTS HD 8S dTPPEЍ^x;_CH$EGЋHHGHnHHa`Hm۶@-P0DM 4`0<004 80ppA8@?0,0 $ (0A 4   80`0B8V(0 <0 30 8M R DЍ^4`x;_  P! 0*S @- @Q :@A\OoB :AoQ @\00C S@HP 0 *S -@Q \ :0Q0S :Ao \00C S00׺+H m jp@-MH2@000<0S (" "0dXM X000 0S @0S !004  0a$ ,0C/ 0%(0 0 0 00000 00@ 4PPD +PPX1T!0PP1 C0S $R"R#R(  $ dX X 0@  0P$L00 @P8Ta8<\P00%*4e40 0 30 <M4ZQ Ѝp^PHMH4`x;_L$EGЋHHH HS@-@M0@ 4480<000 40S ,R R040 8+P 0,0 t$ (0 @ 4   80080 <0 30 @Ѝ^4`βH@_x;_0@-LM01@P4P0D00080 sP u P  4<+ 04@ @<8⬸<ޓ@@8⤸@֓0,0 $ (0A 4   8008(0 D0 30 Z8ⷓwP LЍ0^vgU4`?_<_x;_@-@M0@ 4480<000 rt0,0 $ Cρ(0 @ 4   800t8∓(0 <0 30 "8?P @Ѝ^4`x;_0@-DM0P 4480<000 =8@;0,0 $ (0A 4   800=8Q(0 <0 30 8HP DЍ0^4`x;_@-@P1v!00 0S6 |P S 0SP g0 |0S|0|0|@0S 0 R  0S  R  T_A-@aV PPW` AC-`-3EM\0 10"#0\` ;L`P0P DL@FL0@ hv00l h0R<B \00S $; X@p@ QkBPN밐 NP0t0x0|000]DPA 08:<>@}N0 uNN0P00Ⰰ  0d dt  p00d10000VfVJP0  dkdtd8`P 0P  tx|x 10| St 00 &Pth2`4X0 1 30 d?th!`#L Eߍ^4`HݪGT8-MEI@-(M0@0$00T0  00@ @ 0Ph0 $0 30 P 0S0S @0S ϳ(Ѝ^x;_ 00CS/@-@\P P @@@-,M@1P`@0$003XU q P000SV3"  BR0S' 00CS0S^ ⋳ 0000#V x哶P 0  0n0 00^ 0P0 $0 30 ,Ѝ^x;_aHO-lM3PP0d000000(0  C    (  tqP@0p#0C1  $ 8 C#@0 80DRATcY_    2K (J,0S0(@ 4`V #+`2pW8@ 0 pSpYPPU TX"D 08PSRHwPH,0Ho[ 0TSXz VP 8 00R!$0R*L P 4 `E0F!/o b '@V@` ៰Up`pU P0ES&Z& S0 ,僯 `| ჰ冩PU UpU pxP`pTZ T`Z SD ~,0 d0 30 [PblЍ^m۶HHx;_,HHH\HgmP0@-,M1P@0$00VUP0 0000 % R 0ST 0S 3T xCP 0  00 00 0P0 $0 30 ,Ѝ0^x;_`qH0@-,M0 P@0$00 000 00 0S HL Q 0 $0 30 X0S  00S0S00 0S S00,Ѝ0@^x;_O-Mh48dT000X40 Hd0D 044000 00, @,0TfMp0l0:V003/8 ἓ.V0,03 `  0R,c {$PXeP3 0 30 2`Q$pZ @0SB 00 0V(0S3#880< S 003/P80< S<08,08(0^,P0 U8@<@$ 003/0 t `88\8G[00p8:, I P8[8P @0SAH0pS! 0880< S 003/P80< S<08L008H0 L`P V8@<@% 0儰003/0   p88\⾱8Y00PO8 FP88PЍOQ XJ pR0 nJ ⹰ jJ 8 HU^^4`4`Hx;_a`a`HHH@>_HHH 0 0 a` 0S/0p@-@0tPDp@ l0S 00CSPU P^`A-@ P`pU ) P  ẦP00AoP k0S 00CSP`(pA PUQ I I PYR0 AI I HH^`H    0 G-Pd1PM`0L00;80PZ@ C   *} p g 0 p ᘬ p0X08耀 06 00Y H ;p 8p0 00((`,P?v0880&$0 L0 30 uPЍG ^>_8-MAH$EGЋH H@-,M0`@0$00c]@ @@ ho Pp0@0@ @Pp @@@0 .U Hd;@ rW@ 40 $0 30 5@ PH ,Ѝ^@-M`3``<00004P0T0X0\06d0h0l0p0'P Z@' P < <PP 0S r0<D (DL< 0,S  2T0XQt AQ@00C8S P |0t0tѮ<< <0 <H`  0H00ph0l S v Htde D^L^G  BRP00C8S 荩P0P*LR <P PePZ4K UtHt4e D^L^0 0 30+ }0p 40000 `p@50D\000勯dH∯0@PMP/ Ѝ^PHHH4`HHH H+HVH=_x;_^`A-@pX0SP0X0A XP`UP 0EPEP0S0P C0X S l0UL`H@TA0 %P (0S$T^CIoHCIx;_O-P2\Mp0T002@ $ 2W|"  (0S$d 0SW @T 2 T0 30  .$P i p$ (0@$PS00 . |`0$ ᣩ@ T TR0 0 ` VLp_ $Od F 0$ ⋩0`0tP 0V I TD P0U= 0TP'0  2 &0S &pᒲP Ti0S 0S 00CS9 8 @Y<>$<⵭<c g\Ѝ^x;_S`,.^`͔HHH HC@A-P0M@`0p000O P`I VTDF Q 0 0 30 Ѝ^A-P0M@`0p000P`[,*F ' 0 0 30 Ѝ^A-P0M@`0p000/ P`) 1E  0 0 30 Ѝ^A-P0M@`0p000pP`pؽֽE ӽ 0 0 30 Ѝ^A-P0M@`0p000P`}ᮽ⬽E ⩽ 0 0 30 sЍ^O--?dM䏟@@0\00RoL_?4`L0?X0?T00@0D0H0(00S  4pP@pL0`( y 2 0\/00TT @0L 0$00,_\L]LQ ?4`L0?X0?T00@0D0H0(00S P@pL0( 8(0S x 0x.0tX>pg @0L 0$00X^#L$L8>4`L00>X0,>T00@0D0H0(00S P@pL0 ( G >(0S  0-0t= . @0L 0$00]`Ll=h-h ``eX=T-T ܤU>(0,0`5[]I P D(0@0 嬿(0S , B ]J 5,` М崤̌<, Ĭ嫤<, 夤<, 坤ڡ<, `u0  㕤x<d,@h id<`,\ X<T,P L<H,D D @< , ,<+ <+ <, @= 0 \ 0 Wȫ;+p ޡ;+t @$ 0 C 0 >;p+ ơp;l+l ,0`  .X;T+T "^D 0 !4 0 $ 0  0 ;0S @j:* `:* `厡:* `刡:* *` ֣ d ܣ: *0 :s:* `ȡ:*@ x*0tt 00`*X*0\\ 00"L*0HH @@*0<< @4*000 @(:840<`5[ H P @pD 倾X(X A H 5) 呣Р 6[ |H P @p0D0 d' A D H 6p)p uX崠(6[ `H P @p0D08 4 Hx'x$ yA H ,6)@ pV唠(<8 @0808 @0808¢8(u9`u0 80 30 .$g0 (t8p(pYd8`(`hRT(TT @8<(`,嚠`0 h 㭠d6(08勠\坠5'07傠唠7'5'00@Ϡ7'`m7'\`e 0 ᨔ΢xnt' 0  ᯠX' 0  蹠D7 0@474007 @0(70|0F05 7@07 @060600F6 0@606 @0600F6 0@6崦06 0606唵06夠6&q6&l婟6 @ 0p6p0l6l0T0J@0X6冠PZ 5 @0868046@@00F Z 4 @0605@@00F |4 @05@05 @0500J⟠5%uLQ5@@L05D@X05H@T00 @S$hE  P@00$00 <L0m5 0!0 0+ @0L 0$00$00D@LLۼ4$L04X04T00@0D0H0 00S P@00$00 hL0! 0S Hn 0 0x0 @0L 0$00$00@⫼L⬹,0 \0 30 v 0S ^P]`:H4^`d UTG>S GT^`d10T_`LMTlTx;_OHb~NHQAJHLA_^= VC_;C_H ֤HdA_ #HX ޤHHL ݤHH|8DO]Q H*iRHԢOH|IQ=HGC_HHJHH8#OHHC_HKHd%#uY,H0H)HH!HoUH mO THHHp9`C_HĈNH nSH SHİ 8WHC_`I=_IH=_#IHlNI]HcIQH8yIFH(I*Q IO;_IlA_;OTIA_bH IA_iH C_hC_ IH7 ID, IC I IO I0A_ I0 SNYIII\HIH#Iد8P:$IA_8$I8:%I%ITO&IO&IS 'IS(I&(I7(I4(I"H)I)I-*I$5*I*I#+I`+IP+I,I,I4 ^,I,I.I.IEI.I01I1I 49I6I7Is+8I6IFI:Hg8IV8I8I!gY8I8I8I'9I<9I9I9I :IdH^`t^`4HA_hA_A_A_ᢻL⣸@ 4E <@D@dЍO-@PH3$M000 0S$ p`PUV2 0 30 E0SW 00CS `P7/P$ЍO P ` |" PT T U@@TUj0Sp ₍ⅶ1 0 30$Ѝ *c0S W0 003/7/P@t R$ R  x t 0S0S\ ⟍,0S  ☍HI DI, ?Iא ∍`PX 0S а&0S X  :0 0S  1|ۨQx@ I㦐sD @ ? ^;Ix;_ 1> @0@-000 0 00 0 30 W Ѝ^@-@ F P XBIR R R000/(CI@-00@ 4/ЍR R R000/CI0/p@-@Pc0 0p@/@-@ᗍ 0 000 001S0S$0@-"0 0 00/>I$EGX>Iy>I@- R@0 < 0880  B R00 Ѝ/ Ѝ?I$EG>I>I@-@ 0   /V00S R R0/00@-P8@00 $(,000X \`dhlptx|00 EI8-M(0@-@007> a`@-@7@-@( \ \ @-@P A4= @-@@40S  /@-@P A= @-@@-@P A= @-@P p@-@`VP A< pP0\/p@-@PP Pp@-@  R/  eg@-@P 003/@-@P 003/p@-@`VP A< p@Pm@-@P 003/@-@P 003/@-@P 003/ / R/  k[ -0@-S@ 0S0C0|0x 0tt0r 00S , 0R ( R <  8  Ѝ +`s?I$EGL?I?I?ITQ@-1,M@0$00D0H 00(0 Q-0 0@`S, = QP0 L  (0S Ǥ [ 0 00 ! 0 R00 0  $p 0R0 00000(0\ 0  P 0000-0,0 $0 30 0fM= ,Ѝ^TQ+`G-M0Pp`0|00 0܀ 00 00p̠YI0 |0 30  0L 00x 0p0j 0`S*L0.= 03/L$@&Ѝ^aIIV?I GP]`?I?Ip@-@P0S0 C  [?CP[Sp003/0S0 C  [?CP[Sp0p@ 0/&_@-@P @-@ @-@ZP 0@-@0CI@-@Q; 0@-@0*Z CI@-@?; <00S 000/[?0/R[/&_0P/p@-@P0 Sp(0Sp-O-Ѐ@IDAts)PAT0!03@p%*T` 2T@! `0U0 Y IPPY c PX A: `aP`BOGO-Ѐ@IDAt9)PAT0!03@p%*T` 2T@! `0U0 Y IPPY c PX A: `aP`BOG  Q  /@-@T.@@: 0 0R00 0/@- L0@0 000000 0 0 30 Ѝ^@-@P Ag: @-@QL,X@Z:  R/  p 0S/0 00S/0@-3/O-`0FC1s(AS@!@3@p#*TP 2T@!+ P0 0000Y  B S0CX` A: `QPB000OG0S/  BR/00O-Ѐ@IDAtW(PAT0!03@p%*T` 2T@! `0U0 X IPPY b PX A9 `aP`BOG  Q  /010/O-p1M`Px!0 000L@00H0@D0DAT #0Ā00#R*DH@V0: KHX @ @DDATʤ0 0 30 Ȑ 0 8< Q H02I2 Ā0 8< V D "H"@Ѝ^x;_O-Ѐ0IC1s'S ! 30Pr*Sp1@J0T`0  X I@@Y b @X A 9 `a@`OG 0CH1@LP*@-q'Q10* S1 !/ /m۶$I 0  0  0 0 /O-0JC2~sP'AS@!@3@pP*T` >3T@! ` PY  UX A8 @b`>CPQ  PHOGA-@`PpP   P0 0P 0P 0 0 0P 0p@-@`P5/P`p00Q/A-@`pPU ˟P U  E;WP80p@-P WpG-PQ @0圐0Cp1pBUǁh ̟`Pp ᙟAF`80e%j&P`m۶\G 0CHC1@LP*@-v&Q10* S1 !/ /988@-@P A7  0CHC1@LP*@-T&Q10* S1 !/ /988@-@P A7 Q0@-@A  V0p@-@H`F00P00FM` `pQ0@-@A  V0p@-@ P 0 00S  3/ 0 000p8 @-@p@-@`V0$0CC1Ξp$P98p@-@ P г0 00S  3/ 0 000pǰ8 @-@⿳p@-@`V0$0CC1pp$P98O-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !wP  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p( p:PpK pG1P X:I0 P0p  0@-@P p@-@`VP A6 pP0@-@0EI@-@6 O-MP`  k pڝ F@<0 080q  f$ b0`X 0CC1ຝ$0G#P0Ѝ|8 Tᬝt< 8 7 OG98O-MP`  S pv F@<0 080  $ 0`X 0CC1V$0G#P0ЍB8 TH:< W8 x7 OG98p@-P0`@0i00夷ue7 pO-P` pUF@   $ 0`T0CC1:$0G#P07 T M-; 8 37 OG98p@-P0`@0X00_0 7 pO-P` pF@   $ 0`T0CC1˜$0G#P07 T <ᾜ; 7 6 OG98@-@\0(M 0$00l0 @0@D(0Oo $0 30B (Ѝ^O-p\2,M0$000!R' R02,"0((2^  `!$0P0 00   0 Q00 P_ (0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍO^G$EGG?I98A-(MP1 B0$0008aRBQ000)#> 0U0@q0  U   UTP0BC1U:0!0000 L0 $0 30 Ÿ0 P ~ 5 (Ѝ^98 FG@-@\0(M 0$000 @0@D (0Oo $0 30B (Ѝ^O-p\2,M0$000!R' R02,"0((2F  `!$0P0 00   0 Q00 P_ U0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍO^G$EGG@I98A-(MP1 B0$0008aRBQ000"> 0U0@q0  U   =SP0BC1U:0!0000( $L0 $0 30 0 P 4 (Ѝ^98 FG0Q/! 0CC1P@40 /Np@-@Pp0PPUp0S/@-1 FIA-P`@QV 0SP UW` SPᾎ@Ẏn5 PVTT l0@-@000N 000C S< a 000 0 30 0Ѝ^ GI7@-@Pp0000. 000C SH  0 B000 0 30  Ѝ0^ GI ͜0GIP K /IGI 0S!C 0/᫪!S  R4C@-@o/@-@0P H4P H8P H0004080 P @00S /R 00S//C^KOG-PpPh` L`X00S $,@P=80 @DAᓔ$@ @0哗ЍKOb`OGI0p@-S@P` ((000`p@GIGIGIA-@` p PX Wp  p p@-PRp\0`@0S < <I8Tp,0(0,0@b`GIGIP@- 0S<88@P , &@1 S<@@@@W GI V0`GIP/ Pp@- 0StppP d %PO@PL </0SpD1( Cp@A%GI V0`GIHIHI&HIPQ 0Q/ //THIM?HI@- hHI@- HI0@-0 41# Q0\0C1L0&H 0D0D R03 0:00' 00 Ѝ䫪]II$EG IIJIIeII04 02# /04 02#$ /!R@-T 000/qII 0R4@-G 0  0C B10C /qIIO-p40`Pc&W+ 0@@D0A ( 0P pGP`U:0 00 D[! PU pG0 ( 0PPEH(00C( ЍP[$0 0 0ꫪeII$EG{IIJIIIIG-4 p0`P@S%V(00CT( A0P @ @DA`F PT010!`F@D0Pꫪ0@- R 804 0000 0 SC0@ ЍJI$EGJIIIIO-0S' @$ R#PC4`Cp$0Pl04EQ0PE`E`*$YPF P0(0 @D0C0@N0 00CC1R403 0#/N0@- @A$ ATPN!R@-O 00/qII!S @-D 0C C10/qIINA-`p0@P@DD0DADU:UPPPDPAPN7@-P@0  B0B T|0x 0tt0 QT00 T4RASP0@D@D@ Q! B Ѝ0NrJI$EGJII/JI0@- R (0$ 0 0 0@ ЍJI$EGJIIJI0 0C0C1o R\ B /N00p@-S`P@000 0ps@-@ 0R X0T 0PP0 40`PS4400Ѝp@KI$EGJIIJItP/x0@- MT!000X1R OO%.o0 0 30  Ѝ^A-0Mt1 p!P0,00`1`0\1\AkX1 T!p004`P ⼎41 0!00 P崎!0 p⭎1 !00P嵎 0  诎0 $00a00 P00000  @.0  @(0  @"0 ,0 30 W0Ѝ^C_oP]KIA_C_}KI\;`KIKIP;`KILItNLIWLILILI^,MIĭ=OINI7OILOIHA- M0@00000S 9`"&0P0 M O.TaXqV P4PWXa@!0d1 R|116 00 0 30  ЍAM 0 ^b`OIp@- M0@000<1S @%P  M / 00S L9`%0P0 XǓuM <0<1(0 0 30  Ѝp@^PIb` *7($ 0 B娑200P0000 SR0 S` P 0P 0 00 00P 0Z,0e P ` p0S 6 g, ,0 B P 3~#03 0z- 0S 6@E80 0S 31"0 3 0S 2"02 (0,  0(00,0 B0S0pPPd 0S 60 W0Qn`PO 0S w680 B ]00p 00S e6P` 0i*Q0S Q6֐ 0 S, ,0 B Bl000S 46@幐`V0SZ ` P7HS 0Q4 0S0ꀰ00R 40\0 0CS 0R 80@b0S 6t 儐0`ADЍ^b`FQI\QIQIRI$EGJIIQIFRIgRInRIRIuRIRIRISI7SIkSISISISISIp@-`@P0T  &@ `(I,p0S"DR4@DTIO-lM7 @0d000<0@0D060S  00S S S & 5*p 0O0 0CT!C2 0X1R1`10c0 0S00c`1#Rd<6 d0 30  00C 0 0 @Z0 " R0`0X00 R0 *< $@@D7  zp 04xe4 0 X1T0Z 650S @5@  0 R04@C 0Q^  C$ R R& RP S0 0VUH 0  Ct4J b \JP &,0@40,0yVU  fPP (0, 0 0$P   P P $ P (30S (@A00000040$(08h0@0P  0 (&p HP0L`PpbpP0 0bP0 0cP00T00X00YH Q0 Q+ #RN/ + <+ + + H l10S 0 VU W< j`$@@D 8 0PoS,0 R00Q0+ + T 0u 0C<d! C1d10C<d! C1d1 @ 0S ,0 R00 0ˑblЍ^b`aUIJIITI5TIrTINĕTITITITIKOTITIUIAUIA-0M1@0,00<1S j P:  H * 0`S 1P0S 3P p 0 `GG 0 <P = P   0S" P 00,?;p00 ` 00@00 p0` ` 0   `0 ,0 30 @` Q*  . * 0Ѝ^~UIUIb`UIVIO-M3@ᨓ 000000S W3`0Pll0 XҍlG <X t1S(#i3P 3 #03 ("T!X1R   PtǷ P0S Su Se⼷ zXaT1S2t"0px2^ 0$Rd2H"0DL2S pE QGP ^ ER 0S 20 0pE 0 h!GEP* 0  1t!0px1 !E0S 2P Md I 0R0C0 S (!  + PL P  P P  [ @1OS0|119 (U" @0 0 30  lF  () Ѝ^b`5VIVI$EGJIITVIVIVIVIWI1WIwWIWIaUIWIO-2&'pP @1SD1A(PEER  ЍX 0S "HPPE U` `@1SDPሡUK:|Aat|a HP V@ @@FP@:4i 庼  ,R)峼 0+S PESU``i4-S `DP U@F@FZPP2`PE U` `  0 P┌0`GIWIIWIiJWI@-@P A%' @-@P A' O-Ѐ@IDAttPAT0!03@p%*T` 2T@! `0U0 E IPPY O PX A& `aP`BOG  Q  /O-000CX!1P!SH+pAS@!@3@`5*TP T@! P  Y#Ԡ0qr㓇+3# 000\ LX 0 ,' A& 0T%P Ѝ@ K pIꫪUUUOG 0CCQ/1C"@-@ XIp@-@P%L05c9=?0P p@I G@-@D! P =! PA-Pp`@P< RRCP  ]XIXIA-taMp1@Pp0000S H}0 P>. Q0S i00 ⵝ0 0 30. 5 00 07P 0S00eJ 0PS `S T;0000L ₝(' ЍTp`^XIXIi_XIXIYIO-\M` 0@2p0T002y 00 0 R00.  $ⱟ $:T PU  $/ hP$D -  $( 0 $YPU P00$_D O1 T0 30q 1 EP^ ,K(@PD0<<0DPE @05c9=?0S *<9D $5D O&  <H ( <$H <D0$Q@ R OD @0$ (0< 0@0<0D 0 $( , PD P,$U, 0 0 0P Ѝ@ЍA_YI$EGYIYI 0P /A_000S$0@-C0 0+ /A_GZI$EGZIYI40@-0S$0L 00  ЍA_GZI$EGYIdZI40@-P$0U 00 D ЍA_GZI$EGYIZI000S$0@-^0 0 D/A_GZI$EGZIYI40@-P$0g 00ݼ H ЍA_GZI$EGYIZID0@-0S40p0 0,,0ɼ LP0@o ЍA_GZI$EGYI[ID0@-0S40y0 0,,0屼 PL0S0@ ЍA_GZI$EGYI.[ID0@- R400 0,,0噼 $$0CC2 ЍA_GZI$EGYIY[I40@-0S$0 00值 X ЍA_GZI$EGYIw[I40@-P$0 00l ЍA_GZI$EGYI[I40@-P$0 00X ЍA_GZI$EGYI[I40@-P$0 00D ЍA_GZI$EGYI[I80@-P$0 00/ Ѝ(A_GZI$EGYI[I@- 80P(0$ 0 0  ЍlA_GZI$EGYI\I40@-P$0 00 ЍA_GZI$EGYI@\I40@-P$0 00 ЍmA_GZI$EGYIT\I@-0HP804 0000ڻ @^ЍA_GZI$EGYIn\I@-0P$0 00 ЍA_GZI$EGYI\I@-d00 00X0QL0H 0DD0娻 @ 0 0 30 ܦЍ^A_GZI$EGYI\I@-0L BbP400 0,,0冻  bB Ѝ@A_GZI$EGYI\I7@-8AP(0$ 0 0l A Ѝ0@A_GZI$EGYI:]I@-@P400 0,,0V  @ ЍA_GZI$EGYIp]IA-退0S t0p 0ll0> P`p> "@ 00 003" # @ЍA_]I$EGYI]IO-pጡM0S |1-x!0tt1 0`Pu 0U @ 00 ; P P[ ; ```PPP $P(P04p8P2pO-0P0[ J 0ð[  P $  0 6$  SKU  0Y& P z;#p0CS*(14 >4 004000400,PP  P @ 008 CB\ 4 0 00P0 0b 0 p$0$0$P000S B0 <0 30 P F@P qPgr(ByP@P pPYr(NyDЍ^FbI$EGaI`I[bInbIQWQ /s@-P`@PP0 Ѝp@s@-`P@P0 Ѝp@@-@P A( @-@P A O-Ѐ@IDAtwPAT0!03@p%*T` 2T@! `0U0 3 IPPY = PX A `aP`BOGO-Ѐ@IDAt=PAT0!03@p%*T` 2T@!Ǹ `0U0 3 IPPY = PX A `aP`BOGG-`0@GDBj3CTAT ! 3@P+*T T@!0 P 0Y C     Z3pG0 W  U=V Ao 00㓤*@ꫪOG010/020/@- @ЍQ0 A0C @-#3/Q0@-@A  30Q0 A0C @- 3/Q0@-@A  200$0/0- , 0/0 0/p@-PPVp@P pA-@8`P4p4tTAn k!_)H\DG[O 0@-0 R  Ϭ A_bIp@-@P 0CCUp(P f 00 SU P 0CSp bIbIP/*O- $M5`@0(0 05P00M p<XP 0T?  RiRJ@DTP QQdQfR rcT @D 0P*4 (0 307 P@P  R fR Uc0 @DdROcX lRJc\ lREc8 P@c4 UA ,a0T00C?o20S 0bSZ TS BST DSTp@D P XS P xS 0dSTp@DP4p 400 0p@0 ?< D0 @040CS20Z'AO(Qq*0@" `"@455t 0*0@" `"@4CB5@5C0@w*!P@0@!`U4PC0b0$b0hTp@DP4040 A0@S lPuPiP0080 SD00C$7 0@@ TRE0ϬQ@^+ W 8p#3 @@b 0 0 妫 a@@T@@ U@T R W@lPV uPR iPQ <  p u0@)!P@0@!`U4PC0kb0 gb 00 R@P@<0S J`Zc 0*@P?0)@@ P@ 0`U4S0@>b0P:bL08@ TP 0 Q K^^V0WbIMQpH-@,M 2 P00 01QAAQt X X X   X  @ @ X  X X @ E1QY 11Q% QQ9 1 0 30Y I 0Pd1UP` X0 Ⴎ00 M0a0: !0 0KE0 j$ 0P0K0UP800 \0K/0`U 00S0 f0 |  Gl00K0 U T ;0K0  KpHЍ/^cI cI6cIIcIRcIC^icI GcI@-@xp_TPM1`dd  `_T00U0S 0@ FЍ@ꀗIbQPEGVEG}MH00S/p@-P4@`0  p@A_!_dI[OG-3`Mp0\00D2豭0D@  0x03/`0PPC`0 ᕀPBU 0"1 2 SA000S00QOD0 H2 \0 30 f0S 0S Z0  R=U=Do#0 0@ D00 0[0S00SXDP 0 0 00EAS00 A0DD0`S@S 0 ooP00AU 1P0 S U  A W S: 7 S*(000 0!P0S  0x 0N  RSD0 M0S AoD/  `Ѝ^A_A_(^A_^P/ 0P/ss@-vcጴ 0P/ss@-kXၴ 0P/ss@-`Mv s@-`/oV0" 000R x0F@0SP +/ 00 / 0 00 0 30 Ѝp^^EG 0/ P/0S@o/ 0As0QS/QP/P0@/-SC0 @-\  @\@ 00 00G-p`@xXRTX X0] 0HXIQZXUvU0HP#S?            < x                  X    Q 0CS)+$ 0 00 00d00 X墨 T  0R+ 0 U  0  0 0R* 0\ 00 0T  0R* 0 V  X0 0`8 BR  !!UXQ  0R* 0 \  0R* 0   0Ȓ00  9 T  0R* 0 U  Z0 0  Q 0CS*0" 0 00 00Q  0R~* 0  Q  0Ro* 0  Q  0Ra* 0 Q  0RS* 0 Q  0RE* 0 Q  0R7* 0 Q  0R)* 0 Q  0R* 0  T  0R * 0   0V1WcIcIcIcIO- MTM` = 0(0 00 00<ß$0$0S@( LKLpW7 $P$0S <,0 C0C$0 _0S |? 000S  l 0 1C0[;:K7 @R@ڸs 00 07 R0 0# p.3 0(`0`6v& #30 S {0@D @S p> 宦 01C0[ *(`p0S 0-0,0s d0s0S >唦h0S &R0h0X `q 1P0X  0  R !aESS  S  R]TppG`EoTPrdB0W !!Sp' l0h0p0 0C20C00H 0E!S`00 !S !S < ,0 <壢 0p00(0CW %[ `x200p01N0o000 S)LP l0傢  l0 R04000 1U^ W0 P ! 1UU V> :嬀$Pp#0CS*($4 .24 004000040,PP  P @ 008 CB\S΍ 4 V0 ,LYl l Pp` Q Fp 'VppYl` p Q  B'p0|ɟ 0Cp00<)d04Yd0S`pdpV |9`@q,0&0S0d) RX)X0h0 0S0C 00S y( U()N@0d0 00`p.[ P- 8  00 04#(8 0CR  "PQ 7 Q 012S 0CSt' -0l'0Q'k' W Dg(0CSx#l'0 000g(0CY x#4 L10 000C 0 1UP p`.1U^ ` S1 F!S`Ì&`0SK vx&帤0&層>0H&000SUd0s F!S& R 000 5pU0>00pcG,0S00CFS|2 p3 3 3 2 3 3 3 3 3 3 4 04 @4 P4 `4 p4 p4 4 4 4 4 |5 6 x6 (7 @7 P7 7 8 9 |9 ,: D: T: T: d: : : : ; : $; 2 2 2 4; D; T; d; t; ; d; 0< d; 2 < < < d= 2 2 2 = > D> > > 2 > > > ? ? (? 8? H? X? ? ? ? @ 4@ `@ p@ @ @ (A A tB B C ,C C C $D XD 2 E ,E XE E E E E F HF 1 G LG tG G G G LH H ,I I 4J 2 lJ J 2 2 \L tL L L L L 2 2 2 2 $M 2 $M 2 gII4JGZJGpI!_KGdI[OIIIbII!gYSȈIeIA_ 0=$0XP0S d`d d0p 0S0p0AD0@ჰK0P0/U` B 00S0P  0. 0&0$1S& 1&01%@1-#P1%`1j%p1000 S3%%1$1$1m$1;$1 $1#1# 2s#2dPS>0GC@O d*$ dkl2d S>0GC@; b dP20$ dᔡddPDdH2d#00N é (c dPP30$ drddPDdu&3dPS>0IC@#W( { d*w$ u$ dX 3do S>0IC@١,$:( ^ | Dd dP}l40U$ S$ d6)ddPDsd,TT""4|"4dP000 S3S>0GC@➡ d&$ d #S>0GC@⎡ d$ dp5d S>0GC@z $ e dP%50# dӠddPDd5d&00  ,f dPH60# dᱠddPDde6dPS>0IC@5&'  d# # dH6d S>0IC@0'y'  㻨 Hg dPd70# # duhddPDdkW!F!7B!7 w00@c0`Pu p0]T  0(GdY# \8~eP0LT ?'6d4dDd0D@d`0`GC@f0XPd00x0 $" Xx8: 0 sL: 000m$0pTjK0`PXd00h00l00000d00 X0$XN$TLKP0d0`h0l0Xd00 X0$Xi6@;dPS>0GC@ d%" dq"; 0<0C1p0</t  X `dP X!!PM%X<(<000 SBvT<d<t<S<<<f<<<000 St'=000 S,=000 S2X=000 SD=000 S=000 SO==d= ^000 SHLL0 H X00L0H0X00d0d  $dLH`]^000 SHLL0 H X00L0H0X00d0d  $dLH:37H`FFLH 000L D S0X @ H0D0d X @0d0%Y%dcXaL_H]D[@Y ?000 SeHfLcL0H X00L0H0X00d0d T %d75L3H1 %0 0`^ 0`o 0 `HpЀR H0d X00H0L0X00p`d0%dLH0d0d ?h@Р000l,% +0 ,0`0 0pFSH  *L H0L X00H0L0X00d d 0%dLHa=Q\P 2% Q0p0xM`T 00CST؁Pĥ D=DP`d0d3=J/=+<' ~t0p0P00t  ~*pP 0tPpP PEot`` p j* 0  p  R PBUQ Q c , j 0 P;P嵝%> ;P04QH $t;P0*QH $0S0p0ⓝ< , 0p0≝00d0 0ypd0S !" R   0p0 PU !0 -P t:% \l ~U00d0 0EpdP, m YP0 h 0h d2& \(S p`P9Q ř P% % C@S `PP 0 0D)p#  @8` [%  , 0X0 0 8R   0doX&峟e 4hXPp P 0 0喛dPkd0S %T P%0ȐS 0 0~X 7d0IPXp夜 dI%, dX I▜X>X0S thP H& LhP4 00S X0S  d0S>0$#k%\ X% 6$TpHt6$TjH\6 $TdH~D6 $T^Hx$`PT`M sH k$`PT`@ fH ^5$T>HX5$T8HR5$T2HL$TW pp$ C0Pp X 0`J0CS: q%   w% g%pP(F$%j' `f% V% ^%pP A ` a`0p0$T$d0Td0W$0d0dTQ$T pp$ C$d0Td0B$0d0dT<$T pp$ .$T_$`X0T`X0(0dd0#$T pp$ $`X0T`X00dd0$T pp$  !D'!D' ' p00p002$0p02003Kpx2l00+KpX2P00#Kp{82,00Kps2 00Kpk100 Kpc100Kp[100JpS100JpKx1l00JpCX100Jp;81x00Jp31X00Jp+0800Jp#000Jp000Jp000Jp x000JpX000~Jp80x00vJp000JpA_nHeIeIdIEG(^EGfIRfIcIwfIfIpHfI0MC@dP`U 00000G !0  0s t A ds RJ   x0C dts =J79p00t029p00t0- :p00t0(:p00t0#,:p00t0<:p00t0L:p00t0p0p0 p0p0p0p0:x 0L 0  0jd00S00 R SPL*$ 0d004+0 [0s 0&S0\+ R$ X0 S  d; 0 @Dz0{00S  >@0S [+嫗; 0z} 増0 0pP4ld0s @ F!SL,P,0S   lll|0 S  S @<4 0 30 00[ @D0zm dB  dXd X}_drpLndjXhLfHdDb@H n h dKX܍<ЍO-PP2MLB00082T4"0002\ P|PP|`PPPPPPPP0$SPPP$`0P 8y#$4 P@p ]H 4 404 4 00>00S<B80 8 800<0 < <00,00(p(00l 0pR00 0,000p h0dPP < </?/=/:/9/C/8///[]S@-@/O kI@-@\ @-@0p@-P(0`@3/ @  p@ 0p@-@(0P`3/  p@6@-@T0SDo@-@P`p7/@0 q Ѝ@-@P`p7/>0  Ѝ@-@P`p7/?0 ṕ Ѝ@-@P`p7/=0 [ ЍA-`0@Pp07/0 A'Sp@-!P@4/@0(03/0@ P ;0@s0S@ 23 Υ 000CSAp@襮 囑 p0kI@-@P`p7/:0 p Ѝ@-@P`p7/90 ll Ѝ@-@P`p7/C0 $ Ѝ@-@P`p7/80 ( Ѝ 0冑0  WA-`pP@8/ 0`06/0 ᙑЍA-`P@p0 03/ 0`06/0 ~ЍC-`p@P8/`0,0 9/0 n ЍA-`P@p0  03/ 0 03/0 ΑЍA-Pp`0@04/@ 0P05/A$A-Pp`0@04/@ 0P05/A貈A-`pP@8/ 0`06/ 0 ґЍA-`pP@8/ 0`06/ 0 ᷑ЍA-`pP@8/ 0`06/ 0 ᜑЍA-`pP@8/ 0`06/0 ၑЍA-`pP@8/ 0`06/0 fЍA-`pP@8/ 0`06/0 KЍA-`pP@8/ 0`06/0 0ЍA-`pP@8/ 0`06/0 ЍC-`p@P8/`00 9/0 9l ЍC-`p@P8/`0ң0 9/0 l ЍC-`p@P8/`0嵣0 9/0 k ЍC-`p@P8/`0嘣0 9/0 k ЍC-`p@P8/`0{0 9/0 k ЍC-`p@P8/`0^0 9/0 k ЍC-`p@P8/`0A0 9/0  ЍA-`pP@8/ 0`06/0 ӐЍA-Pp`0@04/ @ 0P05/A0jC-`p@P8/`00 9/0 ~ ЍA-`pP@8/ 0`06/0 cЍA-@ p`P5/P 008/ AA-@P`p8/ 0  ЍA-@P`p8/ 0  ᱘ЍA-@P`p8/ 0  0Ѝ 000 8200 C200 :2@- 0H 2 Ѝ@- 0G 1 Ѝ@- 0 4 Ѝ@- 0  4 Ѝ@- 0  4 Ѝ@- 0  4 Ѝ@- 0 4 Ѝ@- 0 4 Ѝ@- 0 4 Ѝ@- 0 4 Ѝ@- 0 4 Ѝ@- 0 4 Ѝ@- 0 z4 Ѝp@-`P@0(03/R0@ s0NPS0`006/U bp@袪p@Tp@-@PA0SU p@pA-pP` 0@(03/ @H k g AU@-@ hP@c0G-@(0`P3/ p`% ừ@0 <^^؀Y G; *!gYNGp@- @T0p@%@P pp@-@ PPPp@p@-@P A' 0@-@0 aG@-@ 0@-@0 aG@-@ 0S*0S /40p@-P@0000000pGܢL0@-@0  G@-@  0@-@0ȇI@-@  0@-@0ܢL@-@  0@-@0ܢL@-@  0@-@ 0h f HI@-@ 0@-@0V  DG@-@ @-@P A| 0@-@|0M 0 00o 00P  0  0 000 0 0 30 wЍ0^@-@P AN Mp@-(M8P`@ p00$00: @<0H(0 $0 30 aw(Ѝp@Ѝ/^LA-@WP A `V   A-@WP A `V w  @-@To(G @-@P !0P/00/0rC-0004pPp@pp-a `Pc``VIP0 0 30 v `  p n  Ѝ^ FG<@0@-@Q00< 8~00 00  0  0 /0@-@0I bG0@-@0HI@-@s 0@-@0舏I@-@c 0@-@0ȏI@-@S 0@-@0I@-@C 0@-@0ȋI@-@3 @-@+ 0@-@0| HI@-@ 0@-@0l 舋I@-@ 0@-@0\ 舍I@-@ 0@-@0ȍI@-@ 0@-@0< I@-@ 0@-@0HI@-@ 0@-@0 舎I@-@ 0@-@0 ȎI@-@ 0@-@0I@-@ 0@-@0 I@-@ 0@-@0e6lH@-@ { 0@-@0U6L@-@ k 0@-@0E6L@-@ [ 0@-@0 ȉI@-@ K 0@-@0 HI@-@ ; 0@-@0 I@-@ + 0@-@0{ HI@-@  0@-@0舖I@-@  0@-@0[ ȕI@-@  0@-@0I@-@  0@-@0; HI@-@  0@-@0舕I@-@  0@-@0 I@-@  0@-@0 ȔI@-@  0@-@0 舔I@-@  0@-@0 HI@-@  0@-@0 舓I@-@ { 0@-@0ȓI@-@ k 0@-@0I@-@ [ 0@-@0 HI@-@ K 0@-@0 I@-@ ; 0@-@0 舒I@-@ + 0@-@0ȒI@-@  0@-@0k I@-@  0@-@0HI@-@  0@-@0K 舑I@-@  0@-@0ȑI@-@  0@-@0+ I@-@  0@-@0HI@-@  0@-@0 舐I@-@  0@-@0ȐI@-@  0@-@0 HI@-@  0@-@0 I@-@ { 0@-@0HI@-@ k 0@-@0舊I@-@ [ 0@-@0ȊI@-@ K O-@IDAtAT0!03@`!*TP 2T@!. P0 00X  B  S0CW A QPB000OGO-@IDAtgAT0!03@`!*TP 2T@! P0 00X  B  S0CW A QPB000OGO-`0FC1s)AS@!@3@p!*TP 2T@!᳒ P0 00Y  B S0CX` A `QPB000OGO-Ѐ@IBtPAT0!03@p)*T` ?3T@!v ` U F  I PPY A PX A[ `bP`?COG Q @-@0 00@-@NN1NL^*Q10* S1 ! O-@0Z 00 PJ`0U0   IPPY   PW A `aP`OG@-@L00 00 000 0 30 rЍ^@-@NN1NL^*?Q10* S1 ! O-@0Z 00 2PJ`0U0   IPPY   PW A `aP`OGO-0 $M@q ㏑  0HP0L0UHP Dd D`pHE E ALPAADHPLF )00 0 30 q;  $Ѝ^ POGO-0 $M@" @  B0HP0L0UHP D D`pHE  LPAADHPL 00 0 30 Dq _ $Ѝ^ȈIOG@- M1@ 0000 000 0 00000000D   &   $0 0 30 p Ѝ^pH@- M1@ 0000 000 0埐 00000000[D US QOM K H FDB @$0 0 30 p Ѝ^HI@- M1@ 000EB0 000 0T 00000000DR       $0 0 30 _p Ѝ^I@- M1@ 0000 000 0 00000000D   E   $0 0 30 p Ѝ^lH@- M1@ 0000 000 0徏 00000000zD tr pnl j g eca _$0 0 30 o Ѝ^ȖI@- M1@ 000da0 000 0s 00000000/Dq )' %#!    $0 0 30 ~o Ѝ^L@- M1@ 0000 000 0( 00000000D&   d   $0 0 30 3o Ѝ^\L@- M1@ 0000 000 0ݎ 00000000D      ~$0 0 30 n Ѝ^I@- M1@ 0000 000 0咎 00000000ND HF DB@ > ; 975 3$0 0 30 n Ѝ^I@- M1@ 000850 000 0G 00000000DE      $0 0 30 Rn Ѝ^I@- M1@ 0000 000 0 00000000D   8   $0 0 30 n Ѝ^`jG@- M1@ 0000 000 0屍 00000000mD ge ca_ ] Z XVT R$0 0 30 m Ѝ^I@- M1@ 000WT0 000 0f 00000000"Dd        $0 0 30 qm Ѝ^iG@- M1@ 000  0 000 0 00000000D   W   $0 0 30 &m Ѝ^ȔI@- M1@ 0000 000 0Ќ 00000000D  ~ | y wus q$0 0 30 l Ѝ^hG@- M1@ 000vs0 000 0兌 00000000AD ;9 753 1 . ,*( &$0 0 30 l Ѝ^I@- M1@ 000+(0 000 0: 00000000D8   v   $0 0 30 El Ѝ^ hG@- M1@ 0000 000 0 00000000D   +   $0 0 30 k Ѝ^HI@- M1@ 0000 000 0夋 00000000`D ZX VTR P M KIG E$0 0 30 k Ѝ^I@- M1@ 000JG0 000 0Y 00000000DW       $0 0 30 dk Ѝ^HI@- M1@ 0000 000 0 00000000D   J   $0 0 30 k Ѝ^ȊI@- M1@ 0000 000 0Ê 00000000D yw usq o l jhf d$0 0 30 j Ѝ^I@- M1@ 000if0 000 0x 000000004Dv ., *(& $ !  $0 0 30 j Ѝ^ȒI@- M1@ 0000 000 0- 00000000D+   i   $0 0 30 8j Ѝ^HI@- M1@ 0000 000 0 00000000D      $0 0 30 i Ѝ^ȉI@- M1@ 0000 000 0嗉 00000000SD MK IGE C @ ><: 8$0 0 30 i Ѝ^\ H@- M1@ 000=:0 000 0L 00000000DJ     $0 0 30 Wi Ѝ^ȑI@- M1@ 0000 000 0 00000000D   =   $0 0 30 i Ѝ^HI@- M1@ 0000 000 0嶈 00000000rD lj hfd b _ ][Y W$0 0 30 h Ѝ^ȐI@- M1@ 000\Y0 000 0k 00000000'Di !     $0 0 30 vh Ѝ^PlH@- M1@ 0000 000 0 00000000D   \   $0 0 30 +h Ѝ^HI@- M1@ 0000 000 0Շ 00000000D    ~ |zx v$0 0 30 g Ѝ^L@- M1@ 000{x0 000 0劇 00000000FD @> <:8 6 3 1/- +$0 0 30 g Ѝ^L@- M1@ 0000-0 000 0? 00000000D=   {   $0 0 30 Jg Ѝ^HI@-0@0 000000 00d00 DE $0 0 30 g Ѝ^ cG@- M1@ 0000 000 0Ɔ 00000000D |z xvt r o mki g$0 0 30 f Ѝ^I@-0@0 00m0000儆 00d00D D>< 9$0 0 30 f Ѝ^I@-0@0 00?0000V 00d00 DX $0 0 30 uf Ѝ^oH@-0@0 000000( 00d00 D*p $0 0 30 Gf Ѝ^ȋI@-0@0 000000 00d00 DB $0 0 30 f Ѝ^I@-0@0 000000̅ 00d00 D $0 0 30 e Ѝ^ȏI@-0@0 000000垅 00d00^ DXV S$0 0 30 e Ѝ^I@-0@0 00Y0000p 00d000 Dr*( %$0 0 30 e Ѝ^HI@-0@0 00+0000B 00d00 DD $0 0 30 ae Ѝ^I@-0@0 000000 00d00 D\ $0 0 30 3e Ѝ^eG@-0@0 000000 00d00 D. $0 0 30 e Ѝ^I@-0@0 000000帄 00d00x Drp m$0 0 30 d Ѝ^HI@-0@0 00s0000劄 00d00J DDB ?$0 0 30 d Ѝ^ȍI@-0@0 00E0000\ 00d00 D^ $0 0 30 {d Ѝ^ H@- M1@ 0000 000 0% 00000000D#   a   $0 0 30 0d Ѝ^oH@-0@0 000000 00d00 D+ $0 0 30 d Ѝ^I@-0@0 000000嵃 00d00u Dom j$0 0 30 c Ѝ^HIO-04M@ㅃ 000HP00000L0UHP DUD`pHE 6 2LPAADHPLe00 0 30 cZ Ѝ^DGȌIOGO-`01,M@ 0$00P ,1 0 0P 0HP0L0UHP DD`pHE  LPAAkDHPL  00 $0 30 0c  K ,Ѝ^HIܤLOGO-pTM`@``` `  ւ 0P`00`0 `L0`H`V pH` DDHF" Pp  LPAADp qHPLpkM00 0 30 b`B Ѝ^ܣLOGO-00$M@b 。 \0HP00000L0UHP DQD`pHE 2 .LPAADHPL3 00 0 30 b( $Ѝ^IOGO-M1@P 8`0 000 0 00P0HPL0`UHP DD`pHE  LPAAlDHPL (0 0 30 3b P Ѝ^ILOGO-`0MP@ P P 0P00P00HP0L0 `UHP DD`pHE0  LPAADHPLyw00 0 30 anl Ѝ^LPOGO-@PMP PP P 匁 0P00P00P 00HP0L0UHP D[D`pHE < 8LPAADHPL" 80 0 30 a  Ѝ^POGO-@PMP PP P 1 0P00P00P 00HP0L0UHP DD`pHE~  LPAAjDHPL 80 0 30 -a F Ѝ^HoHOGO-`0MP@ P P ؀ 0P00P00HP0L0 `UHP DD`pHE'  LPAADHPLpn00 0 30 `ec Ѝ^HpHOGs@-@d0P`000㌀ ?  0<0@0`D0 0 30 `Ѝp^nH@-`d0@p000Pl D0 p0 `PD0 0 30 ` Ѝ^nHO-P41M@0 0000000G 0 00000P0HPL0 UHP DD`pHE  LPAADHPL00 0 30 F`a Ѝ^IOGO-$M0@000 0HP0L0UHP DD`pHEL  LPAA8DHPL (0 0 30 _  $Ѝ^HIOGO-$M0@000 0HP0L0UHP DD`pHE j fLPAADHPLk (0 0 30 _b $Ѝ^IOGO-@Pu 0P0HPL0U HPt DKDpHE`  , (LPAAD`HPL與IOGO-$M1@P000 = 0P0HPL0UHP DD`pHE  LPAA{DHPL (0 0 30 B_ _ $Ѝ^LOGO-0 $M@ ~  0HP0L0UHP DD`pHED  LPAA0DHPL 00 0 30 ^  $Ѝ^IOGO-0@ P`~ 0P0HPL0`UHPx DDpHE`  b ^LPAAD`HPL Ѝ\LOGO-0@P`w~ 0P00HP 0L0`UHPx DKDpHE`  , (LPAAD`HPL Ѝ蜢LOGQ0@-@A   0Q0@-@A   0A-P80@ `,@'DW P!gYNGA-pP`0@(03/ @͐ ؐ A A0p@-P(0`@3/ @ⴐ ?ܐ ?א p@00@-SD L T p @~@000 P00  Cr IIII I#IO-@ԀpАP̠T@! `V 7 P 2 P - P 0S, 00S@,@@U @@6I>IGIC-`Pp@" P P PL ''@0` 09/ ЍC@u@UP/ pH- M0@P 00 0000M0 `$ P0CU   00 00 0 30 i]Kp^O-tM5`P 0l005<05- 000Sh t  X0 $D0 80 @, %q < P X 0 R00 , 00SS@0000$0$0 S 0 P DH00CRS `q Xp<W` ` \RU *T0000 0F WPW0PWq 0\S. $7S/S` 0FPS00W0S: 0 80@S00"11 Q8US0 0 W54oq uS/ xS Wfq L H0R< H0P H \ 000  `WP00 < Cq R0000  df0hl`  P Q WQ   3?h h000<0000}[q R^0@᥈ 0ÎQL H0R<w H0Pp H `U 0:0S7 00 (0 )pP 0  PD0H ( B0020S,40Sp э@DH  B< H0 l0 30 \D HA?Z@W tЍ^D 6I>IGI I#IIV1WPIjIIII@-pp0MP@`0 00/  0 00|0 0 30 [Ѝ^C-0$M@@`PHp000  P P P V 0S`D0"0 `080 0 30 [$S>$Ѝ^S-PTO-TMP0`2xp0L00XR* 000%Y 0 Rb Ra0 00 S[( ((@ 0@@D P  Qp᷄0SE ᲄ0S@ 00Sit@ 0SS7`V0`D~0S   0s P 0 @00C00S00$1 L0 30B [R1@t 00S&f0S o 0 00 `VU 0 P`R@}P  0 4h!80S 4$o 4q |o TЍ^ IBIvI@-) 0 R R R R   0 0 P7@-<& @04L $P8<@TX\P  ] Ѝ0///NG//0//_Q/W P///I/I/3yH//pI/I/I///I/I///0A-`(0@P3/p @⋌ ;00 ,?W P≌!gYNG- P}A!gYB- PP - PP - PP - PP| @-M L0@c000,0`0(0 0 0 30 YЍЀ^<0@-@000Ā 0 0 30 YЍ^@- 000, ЍD@-@  0 0 30 YЍ^"-@-@(P@-M L0@c000,0`0(0 0 0 30 SYЍЀ^<0@-@000~ 0 0 30 AYЍ^@0@-000@ 0 0 30 ,YЍ^p@-HP@[@ B P (( (@@@_  pB_B_^D6p@-@<0`0VP A pP I@-@ 0@-S h0hd 0`0`m 0S P0i< 080Q40j 00 ЍG$EG\GjGGG 0@-S @0t< 0808m Q,0u 00  ЍG$EGGjGG@-<  4 \ (0 $ 0 0fm  ЍN4`GG$EGjG G@-0Q@u0000LN Up Nx `U`  ' ` Ѝ FG@-00000[ P x0 t0000 00T TH 8 ,0 0 30 TX q Ѝ^B_]UB_^D6-,M00$000[^ P  0000  0XT THo 8 ,0 $0 30 X ; ,Ѝ^B_IB_^D6-$M00000[( P | 000 0 \0]T TH< 8v ,0 0 30 WT  $Ѝ^B_IB_^D6@-Q0000|0x 0tt0l  000 S 00(0 0 30 WQЍ^G$EGjGvG0@-|1 0 00N# @0004L $P8<@HTX\0 Hb0 0 30 OWЍ^I0K-M1P>`]p0 0 0 00M @0) R81P 0 30E W^ R: \RY :R:YS <R( "B|Y\  H H H H    [Rp ]R >RSC YY Y \*0` 0K^P/ p@-P@W  opG-0` PSD p 000CS@R y<@u<0  @ m<@i<0  @ a<0Y@Z<0 @ |R<@N<Q`P @ <B<H @=<X@@TG4<}QRtIII~I%ML 0 0:0SS@-@  Qh<0S Q8 <Q;DIPIZI@-@ P 0@ p@-@P$`;|0 0 `P _ P0S <00S  & ;p@;cI!gYC^H:S0@-P M@   t 00  0ZIP8SI(0 0 30 UJI Ѝ0^ O-M@!0䠝000?000w.T:eP r:|? 0 30Ѝ0S 00S 0 000 SS- ? 0 30 0  Ul$ 0 R`"      <  4# 4# @" 4# " 4# "      4# 4# 4# 0 " 4# 4# 4# 4# " 0S S0&;S R <|-0 P @@mt` 003d6>3<04$Q 0H q R| 0 Bˆ S0S5 8n61 0=@S00 ,04#0`!100$  0000000 $ 10L6@ 0=@S0000TE*0 `U@u帵A R R00ST P(6P $ 4 R 0  0  0 p 6 $0=@S00 $00pQ100 0000000C[0105@ 0=@S00( R$0 P0 Q 7~'07d %g@㔷0S  0 730S3\!T>0 T 0 \0 00D5 00 \5 0@T tP  0S|2T30S 00Sp8 0 30ЍOu5 00S0S  0P } 0 R <a5DH]5 0@Tp0`00V$9 0 30 =(V E5 P3 0 0000^0 +4 00 QP r  '5 00 @p@`p  0 00 00p 5 0 G0Sژ 24 0PU0 p@ ^00 :P4 0Pz0k 0 0U ; 4_^(00 4;p@'0 2 0 0 000000! 000r 4 00 QQ 0Pr 4 P4; 0 30( :< 0 30D 2 P<R L<030(pЍO~4t6^,n< 0 30ЍO k1< 0 30  0ЍO_10S 0 00= 0 30 0 ЍOD^ 0T-0t40S~ 0SO-MDpP@@U 0 00S0R0S'  `V Vy?6ƠscV c `Fv0SV% % % % % (& (& (& & (& (& h$ h$ h$ (& 0`L3@p 0 ЍO[p00 0P  p 0 =ЍO3p003p000 0d `0Qp00rZ PsЍIFMIcK5gI4gIO-IGIQsQ /A-P` 0@0SSU  0sV0S0 0C0 pP P0S0SP_PS0 0C0 PO-,MP\0P 03Tp0$00X@`` 00S 2$030 YKP@ 0,ЍOg$0S% 2 0@000pP0PS U \.H2$030X`0P0 T@0,ЍOmPU 0Pj&- Pl  x 0$0p0#W00S !0M #YZU d-\-H10S P-,- 0; 0S8 U -W N0 10S 0D 00 0001c0S 0l0 $0 30b,ЍO.!d00 0 $0 30M,Ѝ^C^}QMIV4`[OO-@5lM`0d00Puso 00S S 0CS 6 3 7 7 3 3 3 8 S t5 00xgSVsPps 夀  D  0u   q  0 (P _ 0 0 0(00B$0P+ ! 0qP#  !qpP$00S P P.@4 0 @pPh@ 04/4 d0 30FlЍ/ P"0 =f/ ϴ0 P[ 0U: 0U 呥 ྴpp$ H/0  0@  `j0SsS 2 d0 30 I0 lЍO crp0PS 0P zP` 0ye 0 v@0 ` r{ 0X00C?o20S 0S 1 d0 30lЍON/0S0 000W P 0 400<pp0q~$p P ` pW R 0Wp0Hp 0b$0b#rpvPP x+X0@0du00 d0 30Q0 lЍO/^IPI4`.WsLOyING}QC-03TM@P0L00p0;0q 0` 0Bs0RS+q 0 R R 0 0X 6 P P X 0 RH H.q80 X,.:wP. 0S# 00S 0 pP\ 0 00G0@SIR@ P|1 0|g.x1 000a81 L0 30G H00CS`E 0@АJ.~P 0 uG`P  0 P0U{@X F E@Gq``dq!X`*]q5V Xq 0H .Qq*R@TЍ^GcK!gY VIII4`IA-@p\1P0 00H1FD!0@1@\ RP0`0 0 0Bs0S1Q 00R= 000CS T P EV00T PppW 0 0 R Q<0 0 30 GQ  00 Ѝ^Ѝp^SGHsI$EG,I'II@-Qh0@000 L0S P0S 0 ,0 0 30 FvЍ^07@-0000  P' @0S S 0Cs0Sґ0 0 30 E0 0 0 0 6;0S ! 0 PP Ѝ0^0@-LM1@0D0000\T L0SP0S ᜄ0S,  sP 000CS.<1 D0 30H EX僄0S4  Z8 P8  P<@P00L0 0 0Bs0RS00880< 0S 0R@ 0R 0-@R P X0P L0 0 0Bs0RS00LЍ0^lIsI$MO-pD4M@000PP0帀0`( 000T00 |0| t'9t W00X00V0 |0tt00x0|0!t ᗃ뺃 0S$ S TV (0Cs0S0 0[ RXTIVPWl Pi eTWX ů 6:#:00 00h @T $:: ? 1VE @ ::00 00dh 0 ,T ,,X - 0 00ST V Dx!x1Q0l T  DD2 X 00 0 00' 0 0 304 vDT \hT \n\ W P AX 000V  tRT tXtPFCQ . K bQ) 00D  b Ѝ^,OIII!gY$QMIMI@- H00 0000  0 0 0 30 !DЍ^@- D00 000  0 0 30 DЍ^@-@0000 0XH  Ѝ@-@00000 00  ЍO-5|M`RPᠠ@p0t00 d0\0\0`0d0\s Y00Z00W d0\0\0`0d0\a ,|ZU L0SP0SX 5X L0 00CxSXP0 0} Wp 30$ O 00CSB$|4|[U0 =F@S\400SV 0 4#dY Q 0 04# CMZ 0 04# 00W 3[# \ 00 4#0CS \I\ p 0 T3 t0 30 7CLQPQ@S(030(0u PP o PPP(0 0C?o20 04 [P, 'U @PhP    @DU@P0@P\  P    TK@ 0PU R(V 0 00S SW d0\00`0d0\\b Y P Zo 000 00iV W \PR \ 0=@S000@DT T T\0S` 0RV@ q=%R\ SXSDP0qL 0HH0,W |Ѝ^$QM$M!gYFMIsI1UIIIlIP$EG'II@- H00 0000  0i 0 0 30 BBЍ^@- D00 000  S 0 0 30 ,BЍ^@-@0000 0XH; 8 Ѝ@-@00000 00' $ Ѝ@-@(N P I oIIP/ p@-@4P5 P  q6 p@'kGIIp@-@4P! P  q p@'kGSI Ip@-@,P P 0p@   ~'kG^vIIA-@8pP`00  0 A^p@-P@ P@p^kG00p@-@P$ Pp@p^kGA-p@|0`x P PP p  3  p V ) 0 ^kGIB_@-p@0@-  p@^@-p@@-{p@G-PA0UZ@@T40 @ P-G0000P pr Pup I`V   P0LSBS EQ RBS``B_^kG?P/00@ S@-a0@SW@ A0@S7@0w 00U Ѝ)I$EGIIO-PL2,M`T@p0$00! XP 0CU  o 00 01 $0 30q @ p`2묱 Pp 0St 0p0CUpB" 0 P0 0000000 p 0ST00 0w 0C 00S6 TS S5P Z(0U > 땽  p0CP   00 0000 00C 0P0Y0 0+P  0 0,Ѝ^>IIXII0/^/Ip@-P@T | xO @g p @p58 8O @V p(T B_JIII@-@p p@-P0@ 00000_ . po p>IO-,Mp@1`PP 0$0000Z00;00 0 00 !  0RT  s  40S' TS S+ 0 S*:!P0CCUCE 0 S:00 0 00 0000C0t0 $0 30 ?000 0< 000000J0 0#E,Ѝ^I  Q  /G-FM2M0d40Q x"tR h"hR d < @P L2PX\00`0}Q 0 00 0 X0 P `O ]m q`VI ! PE d" > PᤡQ0HF.  $R/R0HF CQ/Q0F>00Cd0 , P Z  0 R  0 Q  ,Z P l P0 Cf P 0S$0 ``V h@0 d4 30 ><`U FލЍ^W PIII$IB_,J@-4M1A0,002 $$Q8@0  BR0 0;8 " ` P 0Sl100 `q$0X1Xa0T1TQ0P1P 0L1P0D1p0` 001 ,$0$1P01a 01010 01 $00a00 0000000P 00 $00a00P 00000 00 ,0 30 I>4Ѝ^B_kG^@JH AD D0 00[@$ " 00S 0| 000H P tD , t $帞 \ 崞 D ,0 0 30 R3BEЍ^6 05P 05@050505Z 5%'5%!]  0 d 0 `5 05P 05@0|50t5} p% 0l  `% 0PL@ H5 0854005 P0(50$5` 5%` 0  0 4 $ $0` 0 q 4$  0  $0_$0_$0_$0_4|$|@0 t4p$p@* h4d$d@$ \$h0X z L$l0P8@ 440$0}  0  | 4 $ p 4$L04i  0 h 3#\ 0P ] 0S 0 U 3#PH h 3#A ~ 3#@ |3x#x4 t3 p0h3@0`30 PT3P L3 @0<3*Jg*J6w`*J~ T=T*N*J -W+J˱O5NG+Jl 4-Jp H~ 9-JJ| 8.JWJP~ 7/JJd| N0JCJe1J )QAJ1Jy pV2Jxy [UD2JqXu2J2J MYX3J 4J Խ 4JV L6Jس R|T!&L[:J O ?J| K?JP?Jx tS@J w @Jv @J@JAJdC_ZAJAJH:EJ vPC_0@-P-1tM0l00 tC  P@1 T LC q" P404@0 $4LP^>P0P\0$PP 4h@4I>@P0P\0#4PTPh@ ," 0 l0 30 .tЍ0^`FJFJw`hD_FJFJ2A-@000pkTUPP  "묫  00S/SP@> @a0/S 00@0SXBP 0P/S ᤛ  0 ល @/S*0.S'0/SS P  P @.S0/SSXP PR 0u/S@   PPW  !0 0 30 .Ѝ^Sw`*)SC-p1LM@R 0D00  T`B P:P0 000 @P 1!0||1B > 0S PX0ST V #U>  FP,8 ~:0`0$$0/, $q:,g e 0 D0 30 -$Q , ^:Q 0dFB 롫 낯 Ɜ 띫 ,G E 뺪 LЍ^FJ7EJGJ~GJ$EGJ8GJGJ,`GJ0 `lC_QsO@-DM1P  0<000L 00! 00 (P" `=I PV@! PD( P p?( PWP @ $$# D9$ᵓ$ 80 <0 30 B-ᩓ$ [ DЍ^ <@Ԁ P PPH 0 B  $0,R    (0`,09 T% 2, P4> @@0@ 0e00<<@$040@@(080D@,00@4@8@@0>$$(0 S :$4H` +0 00 0S  0 0 B Rp0 S S@@ ,SU"0C8S< $1P@0 0#0CWpppp@ T T00 T@p+ # + V0 \0<00L0000<z#R 0C8S 0 0#1,#400#<@p p00S > <00p000L0[  >  > 0*S-LX{X&l= 00 0儠&+C+SP  | ˅\ 0  fm῅\0  \ 0 S L0S= 0S uV [= KJNKJuKJHKJKJ0@-PpC_LJ$EGvLJLJ@-@ P-D_TP0|S!S A-PDp`@P$@Dt@T8DF/O-,MP 1pP`0$00H00E3 @P) 0 0  " 00 00@sp0Sp0 0&3 0D R P 0幼 @ ⵼ 40 $0 30 "@ ⪼  ,Ѝ^@-@P@DP}P@- ЍC_0 S 0PP// O-M,1`000R p@P0( 0 0P Q@Q QDQ X 0 00 Ὃ0PU@$@@X00 0 30 !@릞 Ѝ^G-0P`PE0 00 pZx0 0 30 l!  R @P 0 ⿅@0 zu Ѝ^PJp@-8M1@0400D0S  0 40 304 :!P0H ``Q0 0 OԻ pm 00R  00  0R0`000 0崻 ⱻ & 8Ѝp^!gY}Q0@-PHDM0@Q0<00| $p p0$0 P 0$0$⋻ (0 <0 30 $₻ DЍ0^!gYE_SG-`QP@t0S tpW ``  OxpWV Gut0SV@RMKp07@-S`0\ 0XX0^5 @PL]<Xp,   Ѝ0@OMJ$EGvLJLJ*MJ6pRNp@-@PpP00S x@TpA-`QpP @ / 0V `%t 8A tA3MJ[O!gYG-`1(Mp@0$00T1 $0 30Y 2 pZPPUP   0走PP0 t0Z0?$_ZPPU 0 蚰P0 D0S P 0 00Px 0{PP0 nx ∺ @ ℺ (Ѝ^p@-P0@ ` d00S t<VpDPp0Sp0 p@3MJ[OA-@P`pT 0pQ U @u u0S 0S 0S V oU V U UDP 0 O- M0 @1p0(0 04 P00 M 04 M ` PE 1 80 80 4ს  w   00/w  0 ||Pld0 (0 30  K^8MJ=MJ^MJtMJ!gYMJMJMJjKNJ#NJ3NJrNJNJNJ0@-$M|0000p RD0@PG0 g⇹ (0 0 30 ~ $Ѝ0^p@-Mt3` 0000 00`00 vP @PT 0 0 H0|00Q00 \|P ` t|G Th H000Q00 B6 ` Z- 0D -D`e[`|0,\0-g,w``` 0Dx0-D`e[`0,\0-g,w``` |0XDx0 0 ` `V% D-D-D07`w0|0`x0_D07`w0`x`PMT| 00 0 00 0寸 P0 0 30 ⦸ |⤸  ⠸ Ѝp^E_NJ&OJfOJOJOJO- ` 0PR00WS0rS0iS0tS0eS0 S${ C_ PJ C_ SPJO-PhBdbdr0`P P"LBD"0`<8b;4"0,"(@ 0P",@ 0P"%@0P!@ 0P!@0P!P00@!01!1!1|!p1l!`! 0D0PT1H1D!P814!(1$!y1!s1!m0 @g0 @a0 0L0 ЍC_C_,YQJR-QJGVMVQJh RJT RJxTRJSJSJHSJPSJySJSJPSJSJT TJ@ !UJ@ UJ, , qVJ-WJ WJ XJ YJ YJ |ZJ >[J [Jt P @-M0`0 000P0 /  p PY+ @ p* @M+ T\0OX 0TT0.  0 0 30 ,Ѝ^]JPJ]J$EGu]J.]J0s@-@`P000  3 0S T.  \ P  I0 0 30 Ѝp^C-$Mp1@000000HPpwSPⅦ`00`#qV{ { . q ᑐ P { { . aS. . ᯝ @ 0$ 00D 򀀄 p  P p<0 0 30 s{ v{ (@. $Ѝ^]J]J]J]J^J ^JG-(Md1P `0$00%P 0S $!$1aQ 1. 떖 5@P). ỵ P p"P`GB!  = 0 $0 30 WB0S Bp P`- p#B!! p >(Ѝ^GR<^JL^JP`^J P S PPJ ySJPJ HSJPJ SJPJ xTPJ {PG-@Ml1(0<000S 0S0- D,a@T 0S- 6,4`p4V0:- @P$ P000  0(S @ A0@,: (8 80 <0 30 03,- (+ ѕ @Ѝ^^J^J^JP P S PPJ ySJPJ HSJPJ SJPJ xTPJ {PO--,6TM,0L009D`PS@,8,PUP @TN  Y P,t) ,,PU% PU" X, <8 x <F4P< ,@T; @T8 ,@ @@S4P@P@K4`@ ,P! @T >4Zp@ :, @@p`P480S 0@ Sp`@p8Xf H$ <1 <P3 = , ; i P<OZ P m k/V0: , 0 00T  0#02S 0H0< i P L4 @@@ <0Y X >@;<_0 izP @= Q, @*<8" 2 L0 30  <1<Pjy my M, <n6K Pt C, <0dX<n<0 $0(000r 00 V *  Y :cY@ 0 0F00#0 0 T0C 00030# 00S 0D 04 0i@0$(00( 0 P $0@y y L+ @ 04 w 0 0 0000 00 0n$ 0 0h$ [( 0  0yP < d+ @}@V< y gTЍ^`J^Jw`_J H<_JR_J_J_J]J_J `J"`JD`Jj`J[Op@-PQ80@000 6 p FG///c>p0p@-P@`+M@&0S @D <$0T0p@p@8,`hF<O-p0pApSl3 00 000P00 000 PP= S6  ``U V00Y@@ߜ@WPP@@@ ЍP 003/P̜PPӜPP՜ 0P0000000 000  r U`@ ` D_l9` 9`P/ 0 cJXcJ@-P@=P/$0 0P/( S @-S$5 8qP/$0 0P/( S @-S$5 8qP/$0ӑ 0P/( S @-S$5 8qP/$0ྑ 0P/( S @-S$5 8qP/$0ੑ 0P/( S @-Sq$5 8q@-@T00cJ0@-@0VcJ00@-@0P 003/dJ@-@t @-@l @-@(00봒 dJp@-PT5 @O 뤒 p0@-Mp0P@ 0 000S 1S  R 0 0 30 dЍ0^@-`0 0 00000000 0U0 0 30 HЍ^G-M81@P`0000000 0嘛00p0 00塛PᏜI>0 000fUQ  000 0 sRU PU 0 0 30 Ѝ^A-10 000@T P0PP 0R @ p Z0SnSx0 0 30 ~|`P SWT X DAQSё Ѝ^ D_0` V@- x00 00*0S>SP0 0 30 NLP #cV+S뫑 Ѝ^@-@0 0 000SST0 0 30 t*(0P /US놑 Ѝ^@-@0 0 000SRT0 0 30 O0P TRa Ѝ^@-@0 0 000SRT0 0 30 *0P RUR< Ѝ^@- x00 000SRP0 0 30 뼎P GTR Ѝ^0@-Q0M0 00 r0SRp0 0 30 떎P@P jꭃQP UkR Ѝ0^A-@-PpT0`0 00 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`0 00 0S  pp 00$P$@0 0 p 00p00p0A-@-PpT0`0 00 0S  pp 00$P$@0 0 p 00p00p0jA-@-PpT0`0U 00 0S  pp 00$P$@0 0 p 00p00p0qA-@-PpT0`0( 00 0S  pp 00$P$@0 0 p 00p00p0xA-P0M@`0p000P`+  0 0 30 Ѝ^A-P0M@`0p000P`  0 0 30 Ѝ^A-P0M@`0p000P`떏  0 0 30 mЍ^A-P0M@`0p000⾹P`ḹ~|l y 0 0 30 CЍ^A-P0M@`0p000P`TRB O 0 0 30 Ѝ^A--50M0,00㸍td+ 4T04 `(04$0000000S  @P@000 a! 0x$00ppD 0 000$00 4h$000000S uS  3 0003($P   *  3 |000,3($P   PS  03 `0(3(0$3$0000000S  P@000 S! 0"0p2 0 000$00 | "00000Xt0S ,o p(!00000]_ `!00000MQN OC 1 `01(01$0000000S  P@00L0 ! 0 00^ 0 000$00 l0 ,0 30 0S e   0Ѝ^X TDGP]`bJ T]`LG>S G4 t]` p d]` ]`]`x d , ]` ]` ]`_`   /R R R000/cJ0/R R R000/cJ0/R R R000/tcJ0/   /,`,`000S 0/,`p@-@  P0P 000p 0CHC1@LP*@-wzQ10* S1 !/ /988@-@P A  0CHC1@LP*@-UzQ10* S1 !/ /988@-@P Aދ  0CHC1@LP*@-3zQ10* S1 !/ /988@-@P A་ p@-@ P 0 00S  3/ 0 000p @-@p@-@`V0$0CC1p$P98p@-@ P 0 00S  3/ 0 000pÌ @-@p@-@`V0$0CC1kp$P98p@-@ P 0 00S  3/ 0 000p돌 @-@p@-@`V0$0CC1"p$P98O-MP`   p> F@<0 080  $ 0`X 0CC1$0G#P0Ѝ TJ  < OG98O-MP`   p F@<0 080o  $ 0`X 0CC1$0G#P0Ѝ̌ TDĐ  OG98O-MP`   p F@<0 080  $ 0`X 0CC1$0G#P0Ѝ蒌 T>r느 만 ȋ OG98p@-P0`@000 뵋 pO-P` 5pF@   $  0`T0CC1d$0G#P0M T WE b 냋 OG98p@-P0`@000 p pO-P` p%F@   $ 0`T0CC1 $0G#P0 T   > OG98p@-P0`@000j ;+ pO-P` pF@   $ 0`T0CC1$0G#P0Ë T o뻏 ؋ OG98p@-`0M@P0000 00 0S 000 $ P0 ` N0$00h0 0 30Ѝp H0 0S $0 0 30 Ѝp@^P]`>S GG@-@\0(M 0$000 @0@D(0Oo $0 30B | (Ѝ^O-p\2,M0$000!R' R02,"0((2&"  `!$0P0 00   0 Q00 P_ 0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍOI^G$EGG`J98A-(MP1 B0$0008aRBQ000v> 0U0@q0 , U    P0BC1U:0!0000 W L0 $0 30 0 P E 롉 (Ѝ^98 FG@-@ P ` 0R t pp  P0  `0$00 0S Ѝp H0P]`>S GG@-@\0(M 0$000 @0@D(0Oo $0 30B 7 (Ѝ^O-p\2,M0$000!R' R02,"0((2  `!$0P0 00   0 Q00 P_ 0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍOI^G$EGGNaJ98A-(MP1 B0$0008aRBQ000u> 0U0@q0 =+ U   ئ P0BC1U:0!0000 4 L0 $0 30 H 0 P " \ (Ѝ^98 FG@-@\0(M 0$000 @0@D(0Oo $0 30B  (Ѝ^O-p\2,M0$000!R' R02,"0((2  `!$0P0 00   0 Q00 P_ 0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 ,ЍOv^G$EGG bJ98A-(MP1 B0$0008aRBQ000t> 0U0@q0 %* U    P0BC1U:0!0000 > L0 $0 30 0 0 P , D (Ѝ^98 FG qdJ dJ0@-P|001D01D80 1 30 Bߍ^qP 0S 0 03/ P0 B0RL0  P P00C S@3 @#,P0S Y$``T` @  p=00CS0 00P00L00@P0C0 @(0 0 30  $ЍOЍ/^sJ GA-` Pp@@T  P   P   P   P T  P p  P \ ޗ P H ؗ P ,H~YkJDO2QR_sY#O@-P 0S P00S ЍSR/p@-P@&|  0S1SSp@ S  H/L0p@-S@ 0ST,PP` V%,P  0D?o 2 RQ p 00S @DQOoB@Tp - pkwJwJwJ0p@-S 0Sl@PPU lP0 0 Ipp pkwJwJwJO-PPL1$M@A000 P 0SaPP 00 P0S ӏ Hr UPp|  @`V[   P 0S p[ H p$0 0 30 $Ѝ^@RwJxJ,xJp@-0ML2P @0,00f02`` 0000(0 0S! RT긊 ؊ 4 l | l 4 X0QK " gGX0QC 2@X0!1QX00S S SX X1T!0PP1c q ,8X <0S0s  X <0 S r X0 r0 00:  00R 00 ( 0R0 `0000壾 0 ,0 30 V 0Ѝp^1S,H2QJTxJCxJkGwJ-P)H5Jp@-@$1@MP0<00z 0`0S 0 00 $CDP  00 0 0$  `V {z$0 6/tz$0 A0 3/$⯎ (0 <0 30 $⦎ q @Ѝp^xJ$EGxJxJVMG-HMd2``@0D00`zPD"D@ PT 62 D0 30~ D0S pQ!P0S"@,t, pP   00  00 D0,R pQP HQ ,JH0D0S ,p p 00 ,' p,t,+  00  00 T b 00S " , ⷙ ⵙ{p HЍ^OxJhMSWxJyJ@U!gYO-\MD7@ 0T00 0 R 76'07 PPS'  Pqt ( 8 ԑ 8 ( , 孔  0p`0 000S \S0SH00p6>"0P 0`X0`V H P X` o `/ 00S `0S! o @V0P S S An `ᖺpX0X  `P X0pD? }0 3/V) 0 PCsUPP"`pp7 H`PVPAP>p01H0 `SD4Q`B  NLX4 T0 30 PPRX0 R] P `VF 0SC  pxR P? W; R P?  L P9  F P3 Wڨ > P1  8 P+  2 P% l , P X & P W<  P ( pGW  PX0 RD`^ k <0 R S S 0 0<0 S  P P0 0<0 Sp0  ( P  S  RX0 Ϡ\R 0\0p  `0V H X0 R Sx C _ = V`Fv00f 0S1 SSSX00 Q 0 03 B! X0 0@^  X0 h 0!X0| 0\Ѝ^FyJ$EGxJ yJ!gYYyJhC_pyJ~YkJDO2QR_sY#OkGJyJ,HwJkwJwJyJyJ-P_`PJ)H A-RP@`p! QT  R ! 0 0 000P 0P   0ph0`0W0000 S0p000000O-M1P`000p 0$ 00 00аt0Z$<00 0 30 0T 00| 0 t0]0 0aS[T#0$!0n 0 3/T$@0Ѝ^aIIV?I GP]`?I?I00S0^yJzJ00S0^=zJ]zJ@-0< Q 0 S$0 00o C ЍȃJzJTzJ~zJ  8-! (0  0 $ȃJH , (  $/HȃJA-(M0P@0$00`0 SP SP SP SPPp `P0 000 0 $0 30 B (Ѝ^WzJzJ@-`x0$MPpl@0000D !00 0 30 0 $Ѝ@^zJzJzJ $J zJ zJO-4MP@X `,0$p0\ d0X1 T$0L10D1a000419($K H1 $0101a0000#($52Z0 $00a00000 0 $(PH0 ,0 30 4ЍO0 ,0 304Ѝ^ l {J{JE{JȃJX q{J|{J{JD ,J{J|JJ@-4M1`A0,001P!00`q1!00`1 $01 p01A01011 |$0t1 pp0h1A0`10\1X!0`?D!00`90!0X`3!0`-!0`' 0`! 0` 0 0R 0` 0 ,0 30 4Ѝ^`D_hC_0|JzJ C_ ZHU|J|J|J1^` Y|J}J~J0^C~J~J~J6J~JJJoJJĂJlA-P`V @⊉ 0@⇉ W`@T   !? @@DAQ`pP $Aj m ,@j j```p@-@`VP A{j pP Asj 0S  3/$P@-   Q07 00U Ѝ䴃J$EGJ~J0S 0@-b0 0D /ᡘH$EG\HHC-M0P`0|00 0p 00 00`pĐ-X-0 |0 30 Z 0Lx 00p 0@h0p- 0SYL--fk 03/L$@~-Ѝ^aIIV?I GP]`?I?Is@-`/oV0" 000R x X0F@0SP ᱈ 00 ' 0 00 0 30 Ѝp^^EGA-P10M`0,00 0$SB 8(@P  00S %p@ TT@@P@@T4   pp@@m 0P0_X0S00 @$Ps c j `  7 QL 0 $0 ,0 30 0Ѝ^tJJ&J\JO- M2P`0(0 0080 -R0p80 p80$S[8K'@P _ 00S$@$@ 8@8@  P_ZY8@D0 0M 0ᣡ჏ 늑>4K|$@P4@80/ XXPX 8@" TT@@P@@T#8@ 0W@d (0 30 + @080 80 0 B RP 8@ T P8 ' 8  K^JJoP0@-@0000 0d000 0 30 Ѝ^00@-R$ 0  Ѝ!gY߄JOJ    /000 00/0p@-S@ 0 0S0 000+ p0 -R' -#`0-SV P PS U-UPPPPPU  0 0SL 00 0000 C R H $SPJJ@-Q00O, 0((0@ 0A Ѝ]J$EGCJJ R 0S Q0C$S P/-S/00C$S P///@-P0M000 0S 00 0@ 00P \ iP P P 0 0 30 * Ѝ^mJp@-P@T`t PpA-@pPp ` P0Sp i U p000@-(M<0@ 0$00 0 ⑆ i ^J@-$M0`@P0000 `0000 0QR 0 0 000i 00X0 0 30 VpP  p0S h $Ѝ^A-@`Pል P pP y Pp 0S/0S/@-; чJ 04 8 /@- \0@0 0000?U  U 00 0 30 a Ѝ^@- l0@0 0000?U  T 0 0 0 0 0 30 A Ѝ^G-P`@X p჌ P0@ 0 0C0` J7@-@P᧌ 0 ᶈ Ѝ00p@-@PQU  R 0 0 000p P P 0O- tM p 00 P20(0 0i f 0t" 00M0`p xK⯤x@tT@Ff' (20S5q` 0 !07  `p 0Ah0Kp0 0Ul0 h0K 0S: XK * 0SxKzx@tT\1P q P0 $1 (0 30B !d0a0p `ppKXK^XK p0 @Kf pKF0p0s $ @K pK |g d 1 `Vp @0@Rp 0@K@K pK  K^JE_bJSJJ.HG-XMx@` p `PQT|  R@ < << 0 $  0S 0 $0000 0S mp0 0 00000S $␄ ⎄ P0 T0 30 NpD 0 $~ | f XЍ^SJE_LjJJG-PPl1M000 P1 0 30L 04` P@  OoB  P  P  P  P T Ġ<p0@ @$@W ! D0`(@S  #S  ⾅ P pЍ^*J4J?JGJPJdJyJ-4Mx0 t$0,00d00`00\000 0P00L00H00D0B0 ,0 30 A 4Ѝ^JxC_tC_ J݉JJE_O- M8@|  0(0 00p L 0D0 PMH 08 0 80<  h0l 00@0H0p0xP P` J oobE P @ P ; P 6 P V <VPt}P V vX rxnX |\ Kh GfP ph0X XPT` Pd 00 S  4KSR 4K X0Ps S:`0X 0SH60Sj o840K c60S_ nP X0|W(pl p$0`0 R  4KR d0,0K4Kⱄ PP L4K⬄ PP 84K⦄ PPP4K8k L0P u `0 5%l0pp pd0(` 0d0 &KS\0S9eR` H BAXHLKp*08%R 0x t0 ʂ t0x 00RHP LP00` 4KR%l0 p0 00 @0`` 00\0<0 80  \0P@ 080 <0 0p 0GR \ Q X0Edl ap$^`[X U`0T KPT0 L0p0 P0 l .U P00 30S} 6n l0ut8h h0p0t0.0@x0 X0S9\ 0S5@., 0P0 0  C 00M10 @ỉ 0 00 K  PpPd00d0 t0`0t0 h00h0 l0V10S? m1p0 P P(x0 |, ` 00PQp0 P00410S m@x 00B0t0 0`h0 d` l0 0d000d000-@K@KLKGKd Sd X0`0V\ p0 00R0Sd0  `  LK30 (0 30  K^yJJLKU*J4J?JGJPJdJJE_#JOJ FG JJJ@-MP@p`| 40  000@00p`ǝЍp@-@`VP Ab p0P~ Q0P 00 /- BR   C 00C00 O-pQ P0@0C@@C2D \!W B Ѝ^*8P W`! `1`!*V V`!0[  0@00SP AKb p00㓗'哖)p`  0 0 0 00000 00R 0 00 Q00 0@0D ꫪ\G0P0/|P/`0@-0h0@lS\00 \0 F_/0 YKP/3x @- 0  ? Ѝr=m`aOp@-@`ᚇ P0CQ9}  ᮊ 00 000 0S(  (  00 CB\  pp@-Pd@`PP000   B!E `Pp کpF_p@-P@S ᰇ opp@-@4PI=p r y >p@=F_J:J@-@(s P,0  @   000F_A- Mx2PtbppB00000 0489O 40S q0; < 80103/00SD0SH0 0  ᗇ 0,010L0P! 000 00   T RF SRS<eSJcSSCS:Q8 00 00<0mi 0 S 0 0!&0 @DN @0S< 0D1 !08/0S0 @DN @0S~0s h032@0 0 30  Sh0CSS Ѝ^j`F_OJ$F_T 0@-@0 0 000 0i Qpp\ IX D0 0 30 Ѝ@r0 0 30Ѝ^T J:JA-`@M00@S0 XPp 0PX 0S P 000C S. 40  00@p`zЍ00 C R_S0_SF_iJO- tdMl2@ p0(0 0 PH`050500,20?@00 S.*\ S+*T K@K|K0|0 0Rd0SL S S M( @`60\T K|Kc&K1>! 000p`fS 0p0; (@0 0CWX{ 0 0S((00CA\  0@ V0 (0 30 M( @`0\T K|K&K 0$[02|v@D`@D Kj`^F_$MO-p|M@L`tPR `7'7!PX p\ 7 t0 30 |ЍOop\ P7 t0 30|ЍO0\@h0帀S00 pWRppp 0@ 0H0/0 ٴ6 t030|ЍOV 0SP 0 C   0S0P0 $6 t0 30|ЍOz60SC 0儠L0pWg t   4 ( ` p $ @x5 t0 30{|Ѝ@ @0S@ nvT@@4@8@<@ S ' 0@5050040 p4 t0 309 0|ЍOo S  0@    0 0U@00S  0 @    0 0 003@0S_ ;pTY00T3 0S*\ S*H \  0  Q8 0RB fR 0S 0 uP00!?! 0  崀0R (`0 0CXy 0PQ (00(000A CP0 00` PR20S000:0(  0p0`  ?  ( * 0 0# <\t`p0YpV#PQAY` @因 \0}@y @u$@0S n(@@ 7uTe,@,00S,kBZ@F_^i_nJ$Mm`j`J@-@ϔ$0d茎JF_C-(4$MP0 000`0@0  00? 0$0 (0 0p0! 0Rp9 2- 0 pp   0s! 0 0 0 P0X 0S)0 0  00` S0L01 !01 볦 0 1 00 RS9RS+9;&0 r0SS0CS  X  S ʂS S" (2 0 30 , S 0 1 0o9 0 1 0p0 sE! d10 0 0 1 0p0 s!O| d100`1 0 S 0d 1 0! 2?">2d0"0/1<02A0 0 0 R0SS Pv 00 0 Ri0  d 00S` Gqh00h@YB0 0 00SSPP 0.S~SL +v 0H] $Ѝ^F_J:Jm`s@-P`@| P 00 P 0( 00Ѝpl| P P XP` 0S QP 00C SyJJċJO-@-?[M_h0d100 p00,0 4`P   | 0  <00 $ 4`L ( 0X , 0P 0 0` < 8 `V@  `J000 40`80`0``DNPId2L00x0 0TS  ' | ;d P `PPU`h"l2pRtb QJ P~ xdI ?VUd S{ ] H0H00|05 0  01J , KP% }I <0p0P03/P`00W0SZ`1V|H0  PFcI U=H000SS , b u 0P 0P000oI  P0I P~t9d|d50<0,%4 ?628SH0"0  A 0,05 080 004y P/40S7 k5P \40Sڴ= |6^580 SpP0S3崀X530S<3 30S ڴ= `%0 0<6, 0 o0@0d2S# hl2[0H30S X =p"t2 R0h" 0hdb0C0`<00CD0d2p"0V 2`p`F C$< 0103/0`0S Spǟ0p0l0-5D 0@0 `0l0 0` H6` p ` 6`L(y P l 0 0005xy Ps4P 10S/ڴ?=+ 50 pC(1R ,1<10Sڠ.=40S 4P`ĀF? `  ` 5a4`p<p0:4P pWL`t p6( 0 0 0Sp 00 0 إ<^F_ FGϋJʋJl ҋJJ!gYj`xH_JH_ i_J6J:JH_m`yJNJRJVJZJ^JcJhJmJT sJwJ$F_H_JJJJ:J[JJJJJ(^F_JJ J^ 0(  "R  ⩥P` 000S0 0 R 0 0 0$0oB01(0hP00U $0 0R$0Yx P PP 0R0( h00 00 0 00ა00剑 ](P 0CY s j nP 0 R((  BA\  s 0 0S  0:q 00S(0PhPT0S 0H嬀P00X#X00U0,t _ ' 00S   P P 000S R0  q!R 0Q0 00P0 R 0S,D' 000!E 0(  % 0000!ኳ P >{P%-241S 0 BR͌H>0QL!)R v L10!41H!0L1R0u 41Su |H0xH0L0d2P00Z4 d1 30"  0N?P4!p81d0WP1Hq81>d0H1P1h 00弓P iP iu ^[ߍQ/(V p@-P0C@P r 00S(  (  00 CB\  pp r @- d01/ᧈJ.H@-@P A~V 0S00/O-Ѐ@IDAtDPAT0!03@p%*T` 2T@!\ `0U0 0u IPPY + PX AEV `aP`BOG@-@P A5V  0 P/ol 0s@-000000P`  U  R p2D0S@ t 00 Mu 0 00 0 30 4 Ѝp^^EGP/@-P 00{, 0((0 @P Ѝ#JTJJRA-@ R 0P ҿ0 tpp`ɼ00VX¼ HA辿0`⸼00VᱼCJcK@R}MZJ @R \ 4 D d D D D < 0/,/( 0$8@- //%UUiJJfJ:UO-`1$M@000孽p WSpp lPhpU WPᚽ41 0 30@ 0"!#6 _pp 3ွ 00S S   E oP 00 0tgh]\0 p t P<$ЍONt wV ^JBRJ(JNKJӏJݏJ8JP0@-@000 4 9 0 0 30 : Ѝ^=J@-M40P< P@ƷX @ <@@a<0SHD<DD<HHa<0S P R 40D0D0H0D0H L0t<a(0 0 30 <aV Ѝ^< @-@D0D 0 00000 0 0 30 Ѝ^KJ\J@-@D0D 0 00000 0 0 30 Ѝ^fJ\J@-MP@c  0`(0H 0 0 30 ЍЀ^@-MP@c  0`(0 0 0 30 ЍЀ^H0@-@0003/,P .Z (P *Z s ,J@-@0.T 0@-@0 0 ȴ @T @0dЍ^hJG$EGGGJ۟J:J,JJIJxJJqA-te90@QP000a  pUp U   Fj  FGC-$Ml2hr`0000S U @ 0   Y! 0"1 2 S0S gU @PQb L 0@0 00$ 10_,⼈@0Y( S CUh ǯ!0 ᘧ@P 00S !d0A0P @P 09/@P @ P 0) U 嚯0S Y U 启d0 0 30 Uh hL 00L ~L $Ѝ^ti_J(^TJX^zJJ(J?JO-|Mdᠰ(P@40t00¥ 0 02$0=* 0 12 S   $ 0 R' 1d \ d ` 4 2S񟗴<& % L' ' ' ' ' ' $ 0% % $& & l& & X& 0 00S S@P4\h 3 t0 30  !0p ` yp`P0S40S[0Up` 0 0PP 30Pw 05/p`P0 00S 0͞$0 0 000 0} w"0|p ph kX~ [#d@a 4 P HN PWj ,4`PU J] p`8m80 8 840Pp`!0p ` p`Pwh1d!0@\1D P0 8c$sr 8M88`0SNP J88@n 0` \j 8$00\ 0 0040p00`[ >84\g \J 8|Ѝ(^^X^ĚJJ\J1JJ͛J8JvJJTJmSG- M p@` @P0000PT@@  0 0S ڕZ 0S sS x0000S eS D40 0 30 @@0 ЍGoti_^JӝJO-@4tMp0l0040S BS ƭ 004P0׷PQ I 4X 00 PP`\0T<`@`D`H`L`P`T0 .n P0  0T0g P00T\0T g 0 0T<X 0T#000 mgT.g @<`Y UL0H$0 <,300#0R i30S U R2 l0 30  _ 0X 000 ,`P$<$P`P` 0 00C S8, - |- l- X- X- |- , , X- X- !d0Q0` P`ꚱH ꑱ1H0囍 0:/P`ꀱT{PwX0d ޜH00 0 0(0P0,0`0 0 P$0 Sa !0  ᪤FR0 l0 30 ktЍO¬`Tnf oI 00I AI P5`b0 l0 30NtЍ^ti_ѡJ4`JJX^!gYJJ^EG@-@ P AdG P A^G p@-@`VP AQG p P,f p@-P@Q`  p@nꎥQ@-Q @x@-Q @q@-Q @i@-Q @a@-@PQ@@QG@-Q @M@-@Q E@@-@Q ;@p@-P@Q 0p@p@-@`PQ # 0p@A-P@a}Q vQ ApC-@`P؁hQ  0pCp@-P`@YQ _RQ p@up@-P`@FQ ޮL?Q ׮p@@-@o5Q ͮ@`p@-P`@6)Q /"Q 㺮p@p@-@P#Q 㮮p@G-@Pb؂BQ 㠮<Q 㚮P 㓮 0 Gp@-P`@&P ㄮP }p@A-P@aP q0 A@-P @e0P/s~s@-33 P/F s@-`/oV0" 000R x 40F@0SP d 00 O(彬S8O Ьph_JTLOp@-@l`0S `n003/0P@S O0坬:O 㯬ph_JTLOp@-@`P0S TL0 03/0@S N(|N ㏬ph_JTLOA-`ppP@Q \G 0$01/0@S N(YN lh_*JTLOA-px@`PP `/ 0(p07/0@S N(4N Gh_>JTLOA-Pᰀp@`0S N 3N , 0,p07/0@S N(|N h_RJTLOO-$M$q`P@0Pؤ`S eN _N eXN   ^QN d00%hd00%! 003/0P@S 5N4崫Q.N ƫ$Ѝh_aJTLOM-p@`PآP x 0408/0P@S N4别%N 㚫Ѝh_lJTLOA-`|pP@Q hP 0801/0P@S M0aM sh_JTLOA-`|pP@Q h* 0<01/0P@S M0;M Mh_JTLOC-`pP@؂Q h 0@01/0@S M,M & Ѝh_JTLOA-`|pP@Q h 0D01/0P@S oM0hM h_JTLO0A-`pP @Q t 0H01/0P@S DM4ê`=M ժЍh_JTLO0C-`pP@؂Q t 0L01/0P@S M4嗪4M 㩪 Ѝh_ΣJTLOp@-@`P0S TE0P03/0@S L(u L ㈪ph_JTLOO-Mp`@P0أSЄ | 0T03/0P@S L4JL \Ѝh_JTLOO-Mp`@P0أSЄ | 0X03/0P@S L4L .Ѝh_JTLOO-@pM`P0@TS؄ }L vL P0  0 0P 0  \01/0P@S [L4کwTL Ѝh_?JTLOA-@p` P0S x>L ֩D7L ϩk1L ɩ\$ 0  `01/0P@S L4坩:L 㯩Ѝh_^JTLOA-`pP @Q t 0d01/0P@S K4sK ㅩЍh_wJTLO@-`pP@Q t 0  h01/0P@S K4JK \ Ѝh_JTLOO-@`MpP0ФS؄ K DK = K 6 0 lP 0  l01/0P@S K4K Ѝh_JTLOA-@p` P0S jK pcK  0p01/0P@S QK4ШmJK Ѝh_̤JTLOA-`pP @Q tA 0t01/0P@S 'K4妨C K 㸨Ѝh_ߤJTLOA-p@`PP ly 0x08/0P@S J0}J ㏨h_JTLOM-p@`PآP xq 0|08/0P@S J4RJ dЍh_JTLOO-aMp0PЄS J LJ F J ?J 9  0؃@ 04/0P@S J4 J Ѝh_JTLOA-p@`PP l 0儀08/0P@S bJ0~[J h_%JTLOM-p@`PآP x 0ሀ08/0P@S 7J4嶧S0J ȧЍh_;JTLOA-Pp@`0S TJ 㲧 0 0  ጀ08/0P@S J4僧 I 㕧Ѝh_KJTLOC-M`p@P0ЃS I ~I xI t I m8 0  03/0P@S I4AI SЍh_fJTLOA-@p `P0S I =I 6I /$ 0  `01/0P@S I4}I Ѝh_uJTLOA-`|pP@Q h 001/0P@S ]I0ܦyVI h_JTLOO-@`MpP0؄SХ y?I צE8I Ц4I ̦ 0  @ 0  01/0P@S I4囦8I 㭦Ѝh_JTLOC-Mp`P@ԃQ |o0 0  01/0P@S H4n H 〦Ѝh_JTLOC-Mp`P@ԃQ |B0 0  01/0P@S H4AH SЍh_ޥJTLOO-PpM80@S` H :H 3 0 b 0娀08/0P@S H4|H Ѝh_JTLOO-P qM80@S`" cH ]H cVH  \OH  UHH  t 0嬀08/0P@S 4H4峥P-H ťЍh_JTLOp@-Ph`@0S X003/0@S H(句% H 㢥ph_JTLOO-PpM80@S` -G ㋥'G ㅥ 0  0崀08/0P@S G4TG fЍh_&JTLOC-`pP@؂Q t 001/0P@S G4*G < Ѝh_6JTLOA-`ppP@Q \ 001/0@S G(G h_JJTLOA-@p`$P0S kG qdG `G u 0  01/0P@S LG4ˤhEG ݤЍh_[JTLO@-`pP@Q t 0  01/0P@S #G4墤?G 㴤 Ѝh_oJTLOO-@aMpP0؃SФ >G 㜤 F 㕤 F ㎤ F ㇤  001/0P@S F4[F mЍh_JTLOA-`pP @Q t 001/0P@S F41F CЍh_JTLOA-`|pP@Q h 001/0P@S F0 F h_JTLOA-`p@P0S oF uhF  0Ԁ08/0P@S UF0ԣqNF h_̦JTLOp@-@l`0S `003/0P@S 3F0岣O,F ģph_٦JTLOA-`p@P0S RF 㰣_ 003/0P@S F0兣"E 㗣h_JTLOp@-@l`0S `4003/0P@S E0cE uph_JTLOp@-@l`0S `003/0P@S E0AE Sph_JTLOp@-@l`0S `003/0P@S E0E 1ph_JTLOp@-@l`0S `003/0P@S ~E0wE ph_#JTLOA-`pP @Q to 001/0P@S UE4ԢqNE Ѝh_8JTLOC-`pP@؂Q t 001/0P@S +E4媢G$E 㼢 Ѝh_IJTLOA-`pP @Q t 001/0P@S E4倢D 㒢Ѝh_dJTLOA-`pP @Q t 001/0P@S D4VD hЍh_yJTLO-^ 0A-`|pP@Q h 001/0P@S D0%D 7h_JTLOA-`pP @Q t 001/0P@S }D4vD Ѝh_JTLOO-@pM`P0؃SФ ^D dWD QD  WJD    001/0@S 7D,嶡L1D ɡЍh_JTLOp@-Pt`@0S dw0 13/0P@S D0員0 D 㥡ph_YTLOG-@p`8P0ЃS 1C ㏡C ㈡$C ァ   001/0@S C,WC jЍh_§JTLOO-P| `- M@@R؃PT0 0pC 8;0T0 P@ ЍO1h_ԧJG-PL0@(`0ЂS pC ( 0Gh_ԧJ<0p@-@0PS `C p@Vh_ԧJ40p@-@0S PpC p@h_ԧJp@-0M0@` 0,00$0P0000`0P0@ @凘t0 p$0h0`0`0A0 @T0y0 ,0 30 ȼ 0Ѝp^xC_JtC_OJڧJ~Jh_JJ:J`Jh_7@-PQ|0@000P f[0S000!R ,0 0 30 9  Ѝ0^@- pA- p`0 B0CSBP P PUA- `p0 B0CSBP PPU@-@8Pp40U` E`<0`U  P8P0V02 S BP8 @  80`p80P @ PEU Ѝ 400 00S h0d 0``0  @l] P S B( Ѝ@h_J!gY5JJ$EGcJJKJp@-0M8P@1`0,00 0`F00 00`  `E!E 8!0U @8 0Q 0S 10S/ NB6V8 0S  `0@P `FU 4.00>0'0  000  p`0P0S<0S =-0 =X 0 0+0S 00@!ڮ40 00;ή0S x h P h0l 0 <,0<cx 0 0@0 1WWUS D 0x 0P`vux 00S0 4 00S 0 0 3D 0 S ;J+0 ; KD 00000 0p` RU hP-@R 0x;  \P0Phl0\0p0Y D00 00( 0 $0%" $0 -@R * R    #l0p 1 $0$0PP\`xP 0 JR (:m)0 :n 0 0000DoP`$07# 0   hp 0=@S00( Rp 0=@S000 R 0=@S0H9 Yp 0W 0DP'p ,07# 0   .p 0 \$   $  0=@S08$ 000Z\⴫ 00b h00 ChpW#0S t\0 (0  0pv,0 000   0=(  9 0  4g 0 402R800dw0  S00300\0<0E  6w80< 040000(00,000000\Hx:DD4 0@Q x&0 R  t  qQ  0V0 S L 00S S 5 %05Z ( (  ! 0 0$0000,? 00h0㏢hX5 ׎ 0岢(0!0   Ӑ  , (0, 000 0 0$0000, S2(0|(0 S,  0 0 1 "0Bp9xD⴪>\Pee 0xP`vuE 0\kx 00 00p0 0p0\P`p 0 W 0 0h 0C 0 000Sh0Shpi 00  \\xNhW\UxE  x}  q}PP  0`P  000!  B  L2!0@20 0006 i 00E 0xs 0hx!h0PhuthxP`wh 0xTP`vu 0hx 9 .h 00P0`000 `Chbj: 0P`P >Ѝ^ΫJTJcJhJG$EGGGJ:JJ۟J#VSbQI;JzbH$MJJwJRLJ(J JJPJJ--PJO-,M|1` P0$00 0@ T"  0" r @0 @ 0p  00000 0 T 0 000ꄁ0 4# R   00C0@ D 傡 P@00 $0 30 2 ,Ѝ^IJA-P @p` yp0 `Q Q 0Ѝ 0@-  A      A 0@-@A- 0RR @-QN o//qp@-|0@QP000a  `U0` U   V0p  FG@-@P A1 @-?@N2L^*\Q10* S1 ! p@-@PTp @O O-0J2sAAS@!@3@pP*T` ?3T@! ` PkY  UX A0 @b`?CW PT  N PKOGA-p`@PT0 P @2 6 2 1 0 @-^@ ^@    O-` fpDPI@P PPY ZA:B@ P)O   P O T2 TO L6 i2 1 AOGp@-`@0T P@V0 00p p@7@-P@  0   Ѝ0!gYJ -|07@-@P 000\0\  0<03/$0 0 30 # Ѝ0@Ѝ/^!gYEJBR - s@-@0P`000pp0ԙ  0P03/@0 @ř$0 0 30 Ѝp@Ѝ/^bJ!gYBRJ - s@-@0P`000pp0姙  0P03/@0 @ᘙ$0 0 30 ʳ Ѝp@Ѝ/^J!gYBRJp@-@P 0 p@FƮJ@-PX0T 0PP0m 0 L!P:0Y ! ! Ѝ"J$EGJԮJ.J@-$M`@8pp P   0@ &N (0 0 30 u N 0 $Ѝ^hJC-,M`@Hp PP $  T 0 `p 0d  0H Z M (0 $0 30 @ M ]0 ,Ѝ^yJJ  Q  /O-M@PH00D0 1@ <01801L0 1P0$1T0?000E/0|000000H0@ 0P?˘?@ Ƙ@0PL0`S00`00800XX00pp0X||040`04 000\0(Sp0`X Rʈ-W>` `ᒘD 30804010 >V.0>} |h/ 40q X p>o\.0XX>l 80K401  4 !W (S   4 q/P`IP>0 @ Rؔ P  P h P P P P 0@,S갔 P P h P   Ȕ Ȕ Д Д 8  ` ` P h 8 8 8 8 8 h h 8 8 8 8 8 8 8 8 8 8 8 8 @ 0\0PPoP p P   1`p`` `h h  p ```h `pG 80Kp?t04010hhp401  4 !W   4 q    80`pG@p?t04010ddp401  4 !W   4 q   { 4 !0V`1 pF2 PDU h D`0DS GL Z C@ @   H0 09Z9@ U|>9 0 30 \0S 9 D9 ?L0S 8pW:H0 0H92L0 (*0s@d80 G4010 8003/ .  |0K`S񟗳 ` ` | ` Л  $ P d ( Ğ 0 ` П D ( \ d l t | < Ġ Т $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ L ` | ` ț ` ` ` ` ` ̠ 0 K?Q- g1`X0S T0 p0s$& P d 1 00( H   0#`p 7  0` '  0`   0 ` # %`$2P K? p $`%' 0<  p K`? p  `'( < 0xP xP p00h00< ծ80`#20@⶿ T0h ,0P0(00$0p00!10<00< D0#00@ 0 #K"F2 }@` "05<2 l(2 g2 "1 x\1 hW1 XR1 H[`qpP *- 1  p1:!,!!p J` !0!"R01 1"0~ 00 R(0` ` 0`0S0$ 0  0  Ѝp`0! m00!i!` 0~00S 2m!ᐇm 0዇ 0 6 0$ 0S 0 00 m 0wPm"s h    $    0SPUp 0 "ti_VJJJO-UM(0=$ 0L10s,00`4 0888P  0  P 0 | | | |F 8P :4O( 8 (0B0 D  d@P0 T0X00\ h@l0 TP @8013/PP  e 800 0^f0@0; DWD00S႐d ` K Tw0p 0ЀX s(+0( ; 0S S 0+ ; 00CSllw0 pS Sl w0w0*0  [P>T d  #0CU(xB 4000S,P  P @ 008 CBP8 4 00 13/P100 0  ۿ P Yp0 090cG P90S 1 l000 S 0Sh D ḿ 0 <c3T@!$ `U B IPPY L PX A $ `bP`>COG@-$M1@ 0000S (00CS0l0# 뼥0,0PP 00I I `P B 0 0 C 0 00`$PV0A ? PU @ B P# # B x0 0 30 p0 Pnj*I P჋YzB $ $Ѝ^a`^EGO- $M3P0(0 004 `p $ 40K@000K0P^r0 ᠐P0P ^) 00S l2h"0dd2[ P`0P L) Qf $ 9l 0S Q e p1Q00M`180 ` 01!01-  0 J 0S0#p1X!0TT1  ! 180 00Y 1!00 10` , @0 脸#P40S 0 00 % 40S0P  t0L 0HH0Ի % P( 0 (0 30  K^J$EGJ`JſJJJ #J;J00/d_0@o/00/d_0@o//0/P/8 @-@@@-@>-@蓉 ᑌUJ ፌJ ቌJ0@-,M0@  0$00Pl0  00!0%P q 00 $0 30 ,Ѝ0^h_0@-,M0@  0$00Pl0  00!0P ; 0o 0 $0 30 u ,Ѝ0^h_0s@-000000P`  U  R pC0S@ @ 00 ^A 0 00 0 30 E Ѝp^^EG7@-Ph@ d0(000PJ, 0 P,0,0 0 30 ( E# Ѝ0h_^7@- p@H P `0\ 0XX0ֺ TP Pڿ p P$0  ,᧺  Ѝ0@8 J J$EGJJ*J2JX0@-M(@000 >( P  0 0 30 Ѝ^@-`0M( @000p  `( 0S SR D债 P_0 0 30 Ѝ^ZJ@-Mx0`,p0 00 Y( 0SP=`@; @0 0 30 Ѝ^T0@-@000>4 } 0 0 30 ~ Ѝ^Jp@-0_S0_S`@P H% >A P Pu<UpJJ0 0/00/0 R/0/0 R/(0/0 R/$0/p@-@PU  0 3/pP5/00/@-0\ 03/P03/A-HM3` C 0D008P20p"02`p40 4,@00`4080[8' P <`,080< "</ 8i' <0 p"pphMT0[T& P H,0800<08 "$ K' X0 "$` p.p0[& P $P0(0 応! *' t0 !Pp圁bq 1 001 P0|10x10t10p10l13h1 d0\1 0T1p0L10H10D1n@9 ( 0,1 (0 101p01 P01墀9 <0 D0 30 X & u! DTHЍ^h_C_ WJKJ^= IG4 Ѝ^ ,Jh , O-M`!9020Px0p0txhP b %0@P 8b<@T 0 0 @T 0S R #$N< 0$03/ P003/ 5   0 @ n80000Y0p00 V0  = :pW0 @P(@ 4/HH0S ) $90S 000S  p0$0$aU5pVa8 yB ^/p!0 Qp x!   ^  t!p^?Qpt! R = t1p t0p!0t10= = Wp t xPx! xpPx 0px1p1p1B t1S p0808~" 808$0080P#mP PU  D P 0808~$ 붳 P0S -S0808~8娅PJ[8$f > P 8T8$V8N$P= ,: $Pp W0 != ' ,07 pp0p  0(0 8#= $(Q d E0S PU"DB ۓ P(帀(  / 1 )X(裟7  P0 0003 0 03 < < < ({< < D#, 핻 ,0S m,P B 83@8-8,0<0| pU,P * d20S  .㨭 / P, -( H层A P e ,0S0,808($gE< k p?< ,( 冂3< 1< k p+<  &0j!8j80S&0S 01#,!0((1- 80d,bh0  80V,TZH0 2 30 M 0800,08ߍ^J4`JH 1S[O8Jh_pJJJ(HJQ6JIJJJ lJ*)SxJHJJJJJhJ$EGJJ0@-\M1$@0T0000$  $ $ ԷPPP00 F Q 0S 0 3 t 0 0@N7E40 T0 30 ޠ ,: \Ѝ0^,`J!gY0@-LM,1@0D001$0$  $  $ 0 0 0(0 00 PP⼱ P 0Sa 겱   ,嗰 ,0 ,B; <0 D0 30 ,5;  LЍ0^,`h_JJ0@-4M1P0,000$0$  $  $ 0 0 0(0 00 覜 @Q@ 0S 0 l F @岧⩨40 ,0 30 B ➨] 4Ѝ0^,`h_!gY@-@ A-p` @ P0!SU@010Q/0@-&0 0 ȴ ]J$EGJ9J@-@P @ @-@: : @-@P 003/0@-MP@t0U000       ά  㰫 0 0 30 ǟ Ѝ0^p@-@PU @d: P p R/   s`J-4Mt0 p$0,00`00\00X000 00H00D00@0E|0 ,0 30 4Ѝ^J C_hC_ JJi_9i_-@-0@000 00000 Sʈ0@0S 3/`0 0 30 ] %D% %$Ѝ@Ѝ/i_^w`J[Op@-@PU !: PPp` P 00P/ @-@QA-P0@0` qP q 00  1 qվ  Pv: 0S` 0 bP 0P10!0 A-pMPp16000vf01S@ W9 P9 0 <,bV3 0S  06vf0!R 1@ 00 00 0 30%  @ R  <,bA e  @T ] 00@ 0 000 06 Ѝ^0 /p`J0 /p`J0@-0D03/04`p`0@ R/RRP/n0 G-Ppắ 0`@ S@ @ 7@ Pt @ Pt P0`P0P0P@-: @-: oQ! G-`P0@00 03/ p@0 PYW@00 PNW0@?o2? 03/  9X T T QW 03/{`p@-@0PT3/03/0`3/V VEppp)JX0-tM 0l00F 80P  @o l0 30 ȝ tЍ^G-@2Pp0000SR  P` .S`_. 0 3/`V`PEPQS20SH 10SD Wn WXGh 0Se /S 0S㼁 /S 1RDe10S 3/? P?  = 0Z/S/00PE0P= PP/PGU 0/`3/0 0 30, P 0Q^3/ @  P J :/`Q^3/ 0?3/`3/8dHPP/PЍ^`_X*)S4`h0@-@0S /? 0P R  R  S0CT:/R /R@`RA- p@PPBAn2 @Dz> ` A  A `O-M`b> PPZPY00Ѝ0 F@p 0!S0 'W \Q0 W" Q@pUUW* X  8 P 0P 8 P PEU@`ZpY 0s8 P4 @ 0p i8 P@TJ0@-M0@P000l0 0`0000 P0P@0P00SH00T00 0 30 ] Ѝ0^J_ -000//J/,0p@-@P0D03/ p@4` J|0s@-@P000= \`< P  !00 0 30    Ѝp^J0/p`@-00 Fr Ѝ@-@XD0X0P5D0  <08 0404000 D0DS  Ѝ h  04 @-@000 0 0$0(0"40D0H0L0P0T0X05`0DP  >  @-@XZDP t 1 p@-@P `D0 PpD a 0]0pp@-P@ P1 pp@-P@ P00p<0P 40P ,,0, P///   O-P,p0@L`(V0 Y Py;7 x0P [ 0  [ P^0 ЍO/VЍ JO- $Mp 3@P0(0 030D03/2 W00M`1`80 0` A= 8 0W 1U 2?"02̯ < JP 0 0S,0  `00, K00K }0 0 S S( P0PB0P0 p+`0`80 ox80PX,0S W D0 0x1!01 (0 30Z ƚ  0 W 0 0hX70X S SD\ W 0 W \Q W 0 y0p )X x8 x8 P0WP0B0P0 ,0W D0S 0@ \Q W 0x0p K^4`p`J$EGJ2JC_J@-# Q y 8 0S 4 Q ЍM Ѝ \/@- Ѝ<^s@-P@`;  0  ЍpA-08a@0T hd d pAQ0 pL0S# P@T0 00Ю @!P@D@; P0 00 0 00 0x 0t 0d0ЍP@d T   @ i_(|`0|`J$EGJJJi_p``_p@-M0P@000`S; 0 bL R P0Sʀ0| 0xx0z H00P0P0 0 30 H00080 040000Ѝp^J$EGJNJp`J_0@-M0 00L0S0 00H Pp0L0@0 PL0`S Pp0L0: 0 !0 0 30 h Ѝ^J$EGJJ@-@]0XSA9 15 0R R 00\0S0@-]0S/`@-@XۼX D6 0]0| p@-P@\0SpXP: qyP: @T @opP00P0/G-1(M@D`0$00< Pf ᖼpH0XP C0 00 00YPEQc. 0 S ~5  `z5 Y ` Q ީ P`Pj5 Pr3 \`PV0D 0p 0pa0C0`^3  H0`!` 00  T0P`S R *: P0U 0C?o2p  0 0 $0 30 (Ѝ^8 @-p1MP @`000p:   X0pS9 0 ppp`9  0FO pQ: 0000S p 80 0 30 J p e Ѝ^   /0/ 00  0 /0 /p@-PU@PEp`V`p@-@A-M,1p(A000 1  1 0S9`WP L0S9d Vd㻷 `0 0 `p0  |0 X0 0 30 ؗ @Pd Q    Ѝ^i__`(|`0|``QG-Pᄐ`Rx00D03/`@pPT X Tp 3 P~3 P J4` /JO-@l4M`000X4 RL4H$0D4DB Rp00R0S 4 $04 40S S R 03/#0d 3 0 3/03/&P 03/l3 0 30VЍ0s0d300\3Y /9 PD P8 YYPE`F0  U SPEUP20S20S 2 e 03/2`V`{0E000 SO420S0T3/2 0 30z P Q 0  00U 0'0 0 WU0000`3/0S 0 0CV R`Pr 02/00 S 0 B 0 0 0 0S U%畣cS!0`3/0S 00CV`P=Y03/  02/ 00 S 0B0ЍO/^<^J$EG?JJJ_J@^L`__0-|`J-4Mt0 p$0,00`00\0000 0L00H00D00@0s0 ,0 30 D 4Ѝ^J C_hC_JJJ<^C-PaML100 000S(1 0 30B & @PDpY 0S?  D0q 0`S%W 0 j7 0p 000 0ȵ JP00000 ]0`0S`0%`p5fb` ^ Ѝ<^^|@- @IT8أ B 0 0 30 Ѝ^JA-p0M`P000 P@ 47 @0T~S 0  0  40 0 30   Ѝ^@-M|0P0 00`WX0 0 30 q 000` `߈܈ Ѝ^G-p00 006 ``V0 0 30 I a PP 1 P  6 @P* 0@  Q⩈⦈L Ѝ^JrUO-Mt1p0 00`6 L1WH!0DD1ש FP) ,P@#0 0 307 w k@P 0S  6 Ph*  0  + 6 pP  S* 0p  HD Ѝ^J$EGJ.J    Q  /DO-p1MȁP`@0 00c 0 T-@R0x1@@DT1`1 0 30Q @R   0S 0 [ 0S   _6 P ) @ 00S0  0 0-@R  0  Z   ;6 P[0X 0 P ) @DЍ^$MO-DM3p`0<00 000 R/ P& b @0CQP0CS P00040805 0 0X00&:|3 <0 30 0S Hj0ȲP"S'S@@0@0 @ 0@0S  0SPPT @Du(\S0'S P 0D03/"S'S0 P T:S @ \RSPP R SP/ P  5 0  Z: 0 蠀:Q Q 0C 3@ T )8`4 Z $ↆ$ 0000 ( 40 , 80"(0,09$9PPHe 4  . ZP0 iRx9Άt Q1 N I04 0 iDЍ^4`J0*S P0p@-0P0@P p@7O-DM4@ 0<000-S.0pS+ `Pt,0 P  CPPÓ0X 40S0H0P00P080S 0P R  C P ( 0` pp0 dq3 +,0 C P 000 4-S  npppx0 AqXY% 0S7( 00  , 00S-S0 S04 P00P02 q2  ốW)X  h   2R ኅ  8R0 QH4& 00"S0000 /2"02' 8PP3 P p0W S X*0pG SX F3 P0p0P0d1 pX1Q P 0@ P IP0 0P00p0 K8RG ➅ R   0p{ pP 0G0P0 p5 YP P0Z Pv PP0 ypH0 tpUR0 <0 30 DЍ^J4``NJ!gYeJTJJ0L00 A-@TP@q`AVl0 GB!/o b DW @ DP0`TP A  0A-@R"  00p0`X *3 0 5c9=?0P D0 0C`00,/ P0 ЍG@-@,+, P (AE #, @-@P@6 O-`0FC1sAS@!@3@p!*TP 2T@! P0 00Y  B S0CX` A `QPB000OGp@-@`P5/P`p00P/G-@`pPU P T  E+ PO-p(0BP?@ð[  J/T00!C!!@C`Do`X9/P 1@ 00F?`` `1F!P`F11@pO-@P`pE@WGYpHp1 `WpG05 pE G!`W Ѝq !P P JP04 C0P   09P 0 p .PGpH %P[:I0 P 0P! 10  0@-Avvvvvvvvvv}v{vyvwvuvsvqvovmvkvivgvevcvav_v]v[v|YvxWvtUv@Rv[OJ7J{JJJXJJJ6JfJJJJgJJJHJJJJJ_JJJ,JqJ@-O3v1v/v-v+v)v'v%v#v!vvvvvvvvvv v v vvvvv|uupuluhuduuXuTuPuLuHuu<u8u4uu(u$u uuuu uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuxutupuudu`u\uXuuLuHuu<}u8{u4yu0wu,uu(suquoumukuiugueucu au _u ]u [u YuWu UuSu Qu Ou MuKu Iu Gu Eu CuAu ?u =u ;u 9u 7u 5u 3u 1u /u -u+ux )ut 'up %ul #uh !ud u` u\ uX uT uP uL uu@ u< u8 u u, u( uu ut t t t t t t tt t t t t t t t t t tt t t tt tt t t t t tt t| tx tt tp tl th tt\ ttP tL tH tD t@ t< t8 tt, t( tt tt t t tt t tt t t t }t{t yt wt ut st qt ot mtkt it gt et ctat _t ]t [t Yt Wt Ut St| Qtx OtMtl KtIt` Gt\ EtX CtT At?tH =tD ;t@ 9t< 7t5t0 3t, 1t( /t$ -t +t )t 't %t #t !t tt t t t t tt t t t t t t t t s s s ss s s s ss s s ss| sx st sp sl sh sd s` s\ sX sT sP ssD s@ s< s8 s4 s0 s, ss s s s s s s s s s ss s s s s s s ss s s s s ss ss s s s }s {s ys ws usss| qsx ost msp ksl ish gses\ csX asT _s]sH [sD YsWs8 Us4 Ss0 QsOs$ Ms Ks IsGs Es CsAs ?s=s;s9s7s5s3s1s/s-s+s)s's%s#s!ssssssssss s s s|sspslshrdr`rrTrPrLrHrDr@rr4r0r,r(r$r rrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrtrprlrhrdr`r\rrPrrDr@r<r}r0{r,yr(wr$ur srqrormrkrirgrercrar_r]r[rYrWrUrSrQrOrMrKrIrGrErCrAr?r=r;r9r7rJ[OJJAJJJJ$JHJJJ"JlJJJDJYJJJ-JsJJJ:JJJJUJJJ)J=JJJ JVJJJ*JIJJJJZJJJ4JzJJJDJJJJaJJJJJ1JzJJJ0JqJJJ8JJJJ JQJJJJcJJJ-JpJJJ?JJJJVJJJJ-J>JJJJLJJJJ`JJJ.JsJJJ>JJJJWJJJ(JlJJJ#JdJJJJJJ^JJJ,JsJJJAJJJJ^JJJ1KuKKKAKXKKK'KhK`KKK8K}KK KRKkKKKKWKKK K[KKK KPKKK%KJKKK K6 Kw K K KD K K K KV K K K KM K K K Kb K K K1KJKlKKK1KHKKKK?KKK KSKKKKeKKKK`KKK-KFKKKK[KKK/KwKKKCKKKKZK{KKK1KyKK KXKKK0KsKKKOKKKKZKKK*KGKKKKaKKK4 Kw K K K!Ki!K!K!K@"K"K"K#KF#K#K#K#K$KM$K$K$K%Ke%K%K%K+&Ko&K&K&K<'K'K'K (KW(K(K(K)K])K)K)K*Kb*K*K*K +KR+K+K+K,K[,K,K,K -KS-K-K-K.Kf.K.K.K/Kf/K/K/K 0KU0K0K0K0K1K]1K1K1K2KF2K2K2K3KW3K~3K3K4KG4K4K4K4K85K5K5K 6K(6KY6K6K6K*7Km7K7K7K>8K8K8K8KA9K9K9K:KS:K:K:K;Ka;K;K;K-K>K_>K>K>K/?Kt?K?K@K@@K@K@KVRKAKVAKAKAKBK]BKBKBK2CKxCKCKCK!DKiDKDKDK6EK|EKEK FKRFKFKFKGKVGKGKGK#HKkHKHKHKIKQIKIKIK&JKnJKJKJK P 0 01D0!1[D{0 0 30* 6 0t 00 000 00c,0$000 040 0StZDX9 408 0,0000p@a`p@-hM$1``0d00D0,0040%80,@@0HPD0P0T0\0`0000 000< 0 000X 0 0 8 @$`(PXA,i}]p@0 d0 30  nNa hЍp^a`E _ 00@-Q @0AA00 0@mC-$M\1`X0000H pP- (Y* PU @ ᕡ @0 P @PP[ P 0 0@P B0 0 30$Ѝ78P y`  2 01$ЍC/.P 08 .@P ^a`6]K FGp@-@M1@a0<00000 00000 0$0(0,0004080H!0 @8P P 8000 40 00$ 0( ,000A88P 00 ,o cand [)0P "0 000GE 0 <0 30 " @Ѝp^a`_KA]KO-f Pp8fn P֪? ֮x0  P $# Ts0 40 30%  %< Bs Q p0 Q @$ݨ <Ѝ^a`j]K]K,` Hf]Ki_]KH0` V]K]K^KNJJ7@-P@hUxP00S D00S L0_H 0DD0E T 8 Ѝ0@e Ѝ0@[ Ѝ0a`W^K$EG[K.^KUZKO-\Mp0倀W 050T00( ,t5p%0ll5 @P`<0 $u<@< T  j P0 0(X, BP <u$ 06fZ@   R 011cV@0X<P 0S@ < T 8᫓ 0 D@ < 0 R D0 0  T 0 R@0<000@0D00$000 0 8 00S 4$ 06瓆f0!R 1@ 0@0 0 @ R  <,bA d  <_ ,r? @0 <|t< @<N T 0 0(X, PP \20. @+ T  q j 0P 3 q1 T0 30n r~ ب0B 0H 0 $` `   D $P( U @ 00P$P E A\!X!TPuT!3@.*Tp T@!0 0p E E` ` 00 0U0[ 1 2""P ( A p0t'$P(p@H`< ' NMN\Ѝ^^K$EG[Kh^Ki^KPa`_K*Qn_KUUUOG ////_K//@-@P A @-@P A ,0@-@,0 _K@-@< @-@P 003/p@-@PU ! PPp`K $Pg 00P/_ p@-@PU ! PPp`/  PK 00P/C O-Ѐ@IDB~tPAT ! 3p@+*T` >#T@!0' 0` U00  IPPY ! PX A `bP` Ѝ>COGQA-P0@0` qP q 00 $ E q  P 0Sx` 0 bP 0P10!0 QA-P0@0` qP q 00  qᬜ  PM 0SW` 0 bP 0P10!0 G-`2P!M000m 07gZ @ 0X,*P' @TF$e 0 @  0Q0 0Q0 000000 000 0 R 011cW@ 0S  .07瓇g0! R 1@ 00 0l0 0 30 P|  @ R <,bA  $ ] Ѝ^iA-p8@`XPPx P `i_@-P T @^A-`pPp$@T ᨟$ ^01$0 A{Z00 1i_G-@P-10M0,00SpaePhpFd`I\!M0T L 1 ,0 30@ { I0 00  00J0J ` 00 0 C0/@# I0` 00 00dJ\I@L tP0N 0Ѝ^i_cKNK/cK#cK6cK[O:cK@-`0P-p$M000@kI 0`P `PPJp^I 0``P `PCJ,0 0 30 \{ ($Ѝ@GI^@^ZcK/cK~cKcKG0 0S @- /@^cK00S @- /@^cK00S @- /@^cK00S @- /@^0dK00@-M$0Sp0Jl 0hh0ݏ C8@B@3/ Q /  P   Ѝ0@^dK$EGdKfdKdK-^ /@^A-pጀ 0SP`@ȣI 00=@SI 0 <0R 0 8/Q @^$M0(0S @-{ /@^4eK0,0S @-q /@^4eK@-$0^f @/@^4eKLQ //@^040S @-P /@^4eK080S @-F /@^leK0<0S @-< /@^eK0@0S @-2 /@^eK0D0S @-( /@^eKT0@-000D0H0S8 @3/ 0 0 30 Yz Ѝ^@^4fKd0@-@000P0P0S D0 0 0(0 0 30 =z 3/Ѝ^@^gK40 R( $@- 1/i_wfKdKp@-@PP 0܎ |@XP # \P  \`T X T`Lʼn X< \L Ppp@fKdK@^kG^fKfK@-TT@PL0 H 0@0T<RT80 4 0,0TЍ^/cKkGhC_m gK0m C_po vgKH R/003_R0$R0.R0S/V1WA-@8`P4p4TA !_)H\DG[Op@-`P00@~ P @7T/TTP T@p^T00?P@ \P@00@D00CSA 000CSAPPlKp@-P@ R opP/q 40JQ01@-@$ 0圑@蘑lKbQPEGVEG}M@00S/p@- ,@P(刑p@聑i_!_dI[O0@-@ cR Pǜ000000   @-P`p0 @ P 0 00΍  Ѝ=T$EGhKgKs@-P` @ P 0 00嶍 Ѝp=T$EGhK)hKs@-P` @m P 0 00垍 Ѝp=T$EGhKkhK7@-P@ P 0 00刍  Ѝ0=T$EGhKhKs@-P` @5 P 0 00p Ѝp=T$EGhKiK@-`pP + \\( S0v 0 @$ \\! U0f @ 0 \\ U0V Ѝ\\@ 0 @\\0 @ 0,QB| | | $} | $} $} $} $} $} $} $} } $} $} $} | } | $} | $} $} $} $} $} $} $} } $} $} $} | | } $} | $} $} $} $} $} $} $} } X\TPLHD@<840/GGGiK>iKTiKKiKbiKYiKqiKhiKGp@-P @ 07p@A-` @pP0 90 8AG-0@ `-SP@B`>p=pZ@D 0, 0P!0S fR@D@ lR@D4 0,0S1.R0S@  0  LR0 UR@DYS@Z @0 SLD@<4@ V0WL gIV1WgI>iKGiKKiKTiKhiKqiKA-`P@@@PC@PR   L $ < | {P ^PF [0@@@K|P }0@s0S_P$P4 00  pB0$S_S 0G S񟗙t , $ h L @@w000\S H0 0'S 0S@L: 'S 0S Ѝ$:@ 0 p B0 =QP(  @@A.P0.S@G@0@ P0'p=WX9@@0"-W<9@@20>W 9@@30 P@'@0pG W@-@0㬈0 p E^ S .R0-P 0P0 XR0 0DS0 S.R P QE^+B 0 G`R 1Ppd 0S`007 0\00=S7@@+S@@71@+0@I0=S@*@Cd7@@z0=S@/@9@7@@p0=S@%@/7@@f0=S7@@_|S6@@J00=S6@@P&S@@6)@&0@ 0=S6@@?0=S@@x6+@!0@0<Sk0=SH6@@*<6@@.00>Sf0=S6@@6@@/00=S@@5*@=0@0:S@@5 @:0@.r 0S@5 0S@x5pP  XP@&@<P $P   P@0@P 0@@0%P @ 0@P@0@P@ 0@tPg`PaLP [8PCU$P N P@0@P !?P@E0@P F0@@08 @pFptP @ 0@XPDP0yPE sP mPo fP@0@l^PIXPRPLPFPp@PB FX9PD3PD-P'PB!PP #P@ 0@ P@0@PP =S@<@P1@@K0=S@>@z(1@@-0tV1WiK{iKG5JigI7EJMiKiKfgIIlgIogIrgIgI7gI}gI4gIK1gIugI+gIygI3N.gI`QiKiKaSiKcSbeIjK#jK0 000p?wO(@L/>C 0 0x0S l? p'0pS   0 1C0Zh:0J @07R@+ 0S00? 0@y MY#*>n$ 0k0S  ^n0ZL0Z Dp>R 0 30 s 00 07 R0 0/0 9 0(`0`6瓶& . 0L S 0@D@0S = 帋 01C0ZW*(`TWV 0-00sY y 0S L=p堋4Y Y =<咋  Y MYn$< 0Ұ0S l,個 z0`q4V%`<0 S <`V0f0W0S0C00S H|T-T^ DX4@<08S0S6y  MYn$3#;5 0010S 0S00; 0̻0+0s 0q$S0+ R`V0 S H;@Dx pO~GW0pzS   ;0 =C0S00c$00`  0 0:0S00CSt | | | ` h |  ؘ  8 P h ș  ( @ X p К  0 H ` x ؛  0 | < X | p x | | | | | | ܜ  $ L | ܞ  | H h ğ < p | ؠ |    | ( D X l С  $ D  | 8 \ x | ԣ  8 H < p ܥ , | H \ | t | ̦ |  8 ` x ȧ |  < h ( X ܩ  0 L h ت  , H d | |  P 0'00  B,$0 0$07Q& D7, $ 07$ ('OAQl 7$, 0060S 6('&0?CS6S60q 0J1D @a(  , $ d6` 0oF VK B 00S0\PT& h6`t`0 ` 00 c0 S` [`00 T0 S` L`0 S` B`0S   0 0 S` /`0S  '`| 0 `u0 0 `n -`h '`b !`\ `V `P `J  `D `> `8 `2 `, `&, `  ` ` ` ` ` ` ` `x `d `P `L `8 ` ` `| `h ` y`< s`( m` 05L`p0`p p` pp0`p p` p0H 3` _``0 ` {0 ` v`t0 ` o 0p`g 0cD ,0p] 0p`U 0cD,0pK0H `D^i_!_GGKHGyeIlKKGKGAHGnK^HGJGJGVrK:{K>gIKG(K4JGZJGKG KgIjKgIjKSI7EJ6M:gILSILgI gI6I WVYXSFM*)S5SIiJ+gI3N.gI1gIvgIzgINI5gIHSL4gI7gIM$QJrUjK~YRIKG!_+JGdIK[O 0/`pcD 0/,0pp0 `  0 7` 0 7w` 0.p`p0.  0 e`p,`0 .\,00`pp0.  0D` MD0H`pp,` 0.>,00`pp00 )3  p0`0) &  p0`u0)   p0`h`f`d`b`0`^`\ `Z`X`V`T`0 ``M`Hh8`Cx3`>.`9()`4$`/`*0"   p0@`0# ` p0$ ` p 0 0+,p `0 00`0 0+,p `0 00`0* ` 0*` 0`00  ` 0` 0`00  ` 0` 0``H0  `0 0``  0   `  R   0 p{Xw 0 pq0X00aD0h 0p00`0S  p000 0R00p0O0S 00pp00pB`00p;0`050 00R00 ``0p'0` 0!00@0SD 0O>CS`00p*@M@K0Z0O>CSWRݍ$ЍH0@-@000 0 $0 0 30 k Ѝ^00 @-@  00 Ѝx p@-@Qm pPoP0@-P@000 0S00p@-(M1@P0$00` @@L@@4u @0 @0P @VT 00 x0 $0 30 k  0 + 00004M (Ѝp^p@-@PU 4; pA-pP@`V@G< P`@-@P`pE R  R '4PP 0 FE!80 0 30 8k 0 R Ѝ^I- M0`p0 0 0@@P0:S  0 00M ; \000M  >80 0 30 k  PK^`QLZKs@-`/oV0" 000R x0F@0SP r 00  0 00 0 30 j Ѝp^^EG@-X P5JG-pᘐ9`P 0 -@R   R@ښ00 9 0@00PPEP@P $Mp@-P=@P 830S  p@Xp(0@- 0 0AE ЍQEi_ KKO-`-2|M@0t00p0娐嬀S 0 000S 2 t0 30 Rj 0 DPU0S P0S 9 0=@S020So `0 0 -@R ! V\0 6# Q P  D_Dv d \ 0 Q\ d    ^  \`   Y 4 , 0 Q, 4    ^  \0    D 0 $ 000,0]$,Zx ` Pt (0$PUgg\i Dg ,|Ѝ^$M`QO- ܁,Mp1@0(0 0P80`S 00Z80 1 < 8<0 00`8J 00SHH!# 0@ 0S rJ / :8  80  M P 7y 0 00K 0p0S 0P`Ux  ᧍ hBJ00K40 (0 30 >i 8 4}  Kr`^IK8KrXQGK:KrKA-`1 M@p8<P000 P( P pV P `1\!0XX1} 0  PC 0 S 0 1 0 30< h 0W0X0S Vp* JP0(0  O 0 SW  h;0S 10 07 00S 0  0000 Ѝ^`QK$EGrKKO- \MH2`p@0(0 00S , P) P PPM0 k i @WPP 0 \1 (0 30d h 0S 0P0`0 XpK`0 0 0X Rh 0d0 HK h 0SP0:S 0D0 H 80K @0 @K]@0 PKBP R@0 PKOP RD  d0 000S Y00  0DS`0 000 0H ` @K ` @K >  K^`QO- ,M @PX1p`0(0 00S' T :S0 1!01| 080 80 0K00 000S 0K0 (0 30# g T : P0 0 0 Mp1p80  80 !0  K^K$EGrK KO- 4Mx1@8 < 0(0 09P 9PP 8p=@4K0:S 1 (0 30= g  DR1 u `P,W`G0 0Mp1@0 00Mp1D0    @ 081D D40 1< 00 (    ,0 ' |]p@ u]t K^5JO-PP4M`p,\XP @0S 1 ,0 30w 2g  /@T  d0S  PY 0S:S @\ P0S $(0RE  QJ  P0@` 0RS) 0SS#$Go1 P QQ 0   P0 0S 0$!o$o `04Ѝ^O-Pሂ U7 >\8, P. 0RHHk  { 0 0 -P 0=@S004 pP 0S Pᘊ  3G  0p 0 000 `0000S P`UL  v (G<Ѝr`^KԌKKG$MGO-P0$M@`Hp000U 0 0S (0 0 30 e P$Ѝ^O-pM0@8P0 00`0S =# 40 F0 0S0 0S PPH  <F$0 0 30 e Ѝr`^KGFKO-P$M1@H000p-.0`S ׉ g4 0 `lF`00 0 O0S0 V0S PPH  <LF$0 0 30 Ke $Ѝr`^mKGK@- 0SS4 4 4 R `0\ 0XX0y !S 0CS20CSR  Ѝ"K$EG KǍKp@-`P@ 0CQ6  00 000 0S(  (  00 CB\  pA-@p`m P0CP   00S(  (  00 CB\  P/ 00S/:i_8Kp@-P@<  opA-Paq@0:S: S5 0Cs0SA$# S) S >S# oS) <S@@0>S@:S A藵 @@@0)S :S@U 0:SQ P@ 0 @-S S (S@@<S >S0 >R@0 <R@5KV1W@-l@0 @- @0TL4@ 0s@-000000P`  U  R p0S@  00  0 00 0 30 c Ѝp^^EGRp@-@ R R R @T   P00p0` 㦃 P000P0  hK 0 P/p@-[@@P0[S & P)<0[0[p? Tc i_@0@-DMA10<000Q P0( s 0$ 000c>s 000>ZGU $ D 0> L$D00܋$% # @0 <0 30 rc ϋ$  DЍ0i_^WK KKKd^KQpH- Mt0PP00 0 0 0@M 0a !(mD0 0 30 =c Kp^Hs@-P@0 RЍp:R ,0K( 0$$0w `0@K$EG KΎKp@-M0` P000`0 N @T w |0 0 30 c 0d 1 2SP 1 0@0S S((@w Ѝp^K(^;KdKKG-@Pp!됐P@CP@0Ss `(Z [Z@P 0:S 0qPEP`Q>:[P[ 0 ,0 30 [b 4Ѝi_^C_3KcLIMK$ KK 3K;`8K\;`PKKݑK^@-MX2XB 0t200004Sه[$2 "0[0S00p?0S 8m @P '@10T00ST h:n hEn h  0W0H0 d@`00 ,0  H P0R P  `@^   L 0 P H L P `  d  0,00(0] WHz 0x p? s VHm 000i p?L d,0 t2 30 a ߍ^^| i_@ @-PT1@Pa0 00000   uS$ sS P  0S0  C`V`  i`V v 00T X0 0 30 ]a  P0`0T p Ѝp^V1W%HOK@-M0 @ 000  y  0S0 P $WT0000T40 0 30 a T2 Ѝ^0@-M@1P @0000Q  0wT 1 0 308 ` 1 r0S 0SS S USS !S    ET00009T B Ѝ0^@0 @-@000 0 0 30 ` Ѝ^p@-(M1@P0$000S  R  0 $0 30+ ` `|0S@@T   SV S0S 000S f  [  S (Ѝp^!gYC- 1MP@`000 P p   PU*  0   3PU 0 00t S K u P0P0S ,0 0 30 ` PЍ^S$EG KGKD0@-@0000 0 0 30 _ Ѝ^O- LM2pP0(0 000 M` @1@`0  `0a稢( P@`V 0 PKJP0S Y  9/0P 0@I $2 (0 30 _ 000CST . 0P  @P`TK(00CS 0 00S Q Z`@`HK+`1H K\ H0 <0KD0 0@0 <0K,0K0&@0DK X0 h@ PKPKTK8PKT R V @HK)0 -PKLPQ X K i@X0PK @0R@Q h ' D kQ" ? PKRHK)TK K^pK1S!gYO-4TM`@0L00pT% W RR00'R0S  Q 0  J0S 7/0P 0 wR3 L0 304TЍ0CSS         X l l < X 0 0 R 00CS 0 @2 L0 30 ^ 0 TЍOĢ,P=*24,080008H0S Sj0 ,[ 0S  0,P( 0040P0 0S0 , (0 t40 $(00P- 00d 4 m Q Q,(m ~ 0 0 0P0Q0 ( d NQ ,.Q ,(PP 0 FS  , }(000#40 00  Q,l(E  @Q  Q0S St l X X l Q^`Q1S@-P@`0p000"d Q Л00 00@ _Q40 0 30 ] @ TQ  Ѝ^@-`0@P0000_S0ZS pP 4} Pp00P0 0 30 ] jPP  pWp 'P0p04d  Ѝ^@- M0 000000 000I@T 7P o P @0 0 P40 0 30 _]  Pz  Ѝ^@- M1 000000 000o @T  P81 0 30F 2] 0SSS !S 0S 0 RRd L L d d d 02 BR0#S\ @ 000 *rP20 @0 0s fP  Ѝ^O-M2@P0000$0p(@c ,00 9 P@$Cl@@@G&`V$U1 0 30Y \ 0S@ $F&M0@ P U0- P8  P4P0U`P.PEEAt P$T T0!03@*T T @!K| B`U   XPP A: P O`Ѝ^OGH-M0P`00 00S p @ @ @@M 0 t  Pm%@P  Q%P  J0 0 30 ,\ K^`QG-`pNPU G$@TP 0S0S  0S S P @ O- |Q M@t1`p0(0 0 Q q0S 53 Q*@@X9 PP 0 0M 0ᣑ ! d 00S"P R !   R !!0 5# P 0 -@R  R 0 (0 30 [ K^$M@-`pQ@ T Ѝ O- M 2@Pp0(0 00000<{ `  BR A2 X` `n`40S  ` ` ``M 0 T  PDq$`Vm``Vb H`$$` V $` V0 (0 30$ [ 0Y` 3 0 *0pW` 3 0 Xp PA   K^`Qa`O-P`@IpTp'P0 9PT `U`P Ѝr0P :P 0 00o 0PK$EG KKs@-@`P0T    0#9PTPPЍpH0p@-S0P@R ;E0H0pP/ 0P/@- oK 0 R  0S 000S /SO-DMp 0@\2P0<00$ !` qp 2 <0 30 TZ DЍO@ApN、ܱ#) 0` @Q 000R 0@Y 000^:t1 <0 30h DЍO?  02QP5 0 0 X 0 `!1>! 0X0X @<? 0$0 0@oi $>P0 <0 30DЍ < 00S,   ^G$MYU`QD_0Ss@- PPL@L`0` `0 , `0 X Ѝpj_H O-EM@!81<0|=0 10ㆂ(0SX]8 40R ,+ <= ,0,=h 0R  = 0x>H: 1 30 X @00D0P  0 `0=@S0:PU0 Q0 S+ P ?P0B: 0PU $P sx $$0$ P0@0P0H0D0Ho 0P0PP0H P@tP00S 4Q>TX< J;80 S0C; @;uo9;iPUph 0(pP0 V0P"0S ( 00`0000( 00孍P QP b ! 0 SP; OP 800S,ᜯ4D A   P   P 0 S S 0 S S 00C S#Z 00pW0$S. 0@ PA0`S W S: 7 S *\0K 00 @S0 R 00S0 01P!@K X  Kj_^ܞKK4K^j_dIUUj_2dIdIeIK eIKO@-8M1@04000[_00 0K20S !"RA AO0 0 0520S0 0,20SA ,0 40 30 G  ) 8Ѝ^j_(^j_P/ 40FQ01@-@$ 28_@4_ܞKbQPEGVEG}M0P/ss@-~f @0X0S/p@- ,@P(_p@_j_!_dI[O 0/ P/0S@o/ 0As0QS/QP/P0@/-SC0 @-\  @\@ 00 00O-@P0U 0000Pt %E`0  000 PAA^`POGO-@P0U 00Pl _E`0  0 PAA5` aP`OGO-QM?4MOQ,000X0S ?f^0Nm\00OP$`$P `!X0S ? R^X0S )0 0C0V::`F7 R010P007 R00i  p 0$8x(  N=$0R X0PE`PS > ^00C0V*$ pFZ  0X.0(0[s* \0sKX0S >,]`0S &R%0`0 1P.P4X~LLp렀.Hoᨂ0X !S(.Sd0`0h0 0C20C,01 R}娀0G 1Rd 'p0CW   |同 |00p|00,d QF"p RVS: |0R` |0. |0 0|00B[ S |  | x0 | 0 B0 ̟AY 0dpL0d  d0.SASh 0.S AS ;*0 :Y 0#.R00S0p'0CW   |v |00|00000.Lo d0 0,0 S# 0⋂p 0r040 0 01W\ h0Sj Rp00c0 X0Sf0GbS񟗃RRRRRtSRTRTR TR,TR8TRRRRDTPTDTPT\ThTtTTRTTRTTTRTUUUUUUUUUUXWRRVVRVR VVVXWdWpWRRR|WWWRWWgIK4JGZJGKG!gYIȈI(^pHoKfIKcIwfInHKGj_!_+JGdI[Oj_KGܞKKG^`?M [d  00 0a d410r dU HYddD5 d dG>;CY d 'Y d!dU G>;CY ka dm10E d( YddDwF0  0000 <@0Q00< 8!00<0 3<0XTP  XdP0d 0  RX@P XdP0d 0 dX]`ZP JJJH L0X D P00L0H0d X D0d09Y d00` 0@',X\P 0 $1 2S 0P 0 W\ Xd0S 0 0W` 400PL0IP0 0 nLl G>BCP0S T $P$P4~U k@zU 0 0S`5Z > 0 000 0P  0d+&[ P5QNU X  [000,00''D;` x6d 0d    ,u0d0d hPZm  Z0 Sʇa  X'd0X0Ke0  )E0B c00c  2   Jcc  0   wc0dd0 0dd0000 RS@"0 PX0S  )  X:(X00` p@PY\ r \ Rd90%X0S Yz㔉 0S N=$0R 9Q, 0 30< ? 0V0dPL랼 d X PLHD dd>X: LJH*Qݍ4ЍG-P1 MA000p1J!00S 30`d 0hXRX00圐000`0 0$0h `0PP    P 뜐Y@0Xp 0 30 ? 뜐MXp%  Ѝ^j_ LG$EGgKKa`k_F//#////@-@ᵺ 0p@-@(0P`3/ cq 0p@qA-`pP@8/ 0`06/0 TЍC-` pP@8/ 009/ 0`06/0 S Ѝ@-@C 0@q@-@6 0@-@0a?G@-@F R0 p@-@ PT  B 0 @B@R@p/O-Ѐ@IDAt刨PAT0!03@p%*T` 2T@!^ `0U0  IPPY  PX A `aP`BOG0@-@0E褞K@-@  @- M1@ 0000 000 0] 00000000Dj } {yw u r pnl j$0 0 30 =  Ѝ^K@- M1@ 000ol0 000 0~] 00000000:D 42 0., *뺺 ' %#! $0 0 30 =  Ѝ^`bGO-04M@:] 000HP00000L0UHP D D`pHEm  LPAAEDHPL00 0 30 9= T Ѝ^DGLOGO-@PMP PP P \ 0P00P00P 00HP0L0UHP DD`pHE K GLPAADHPLyw u80 0 30 < lj h Ѝ^dKOGO-@P\ 0P0HPL0U HPt DlDpHE`   LPAAD`HPL$KOGO-`!M@P  ]\ 0 00P0HPL0`UHP D/D`pHE  LPAAjDHPL ?(0 0 30 `< 6} Ѝ^ILOGp@-@z P0C_S`} 0`0S(  (  00 CB\  ` 2P " 2 # 2" 2" l2" X2" D2 " 02 " 2@"  2@"$ 1"( 1",`!0"0 `#!0"48`Rl!0" 8090 090`$!0"<` 0"@`) 0"D0<H48L84P 0h"T 0b"X p0 \"\p WISKbiKƪKGiKͪKTiKҪK٪KتKLgIQުKKKKKmSGKK@-L0L0 000 P,0P0 0 30 X; Ѝ^٫K 04k_@-0뾳 DЍ^O-pᤡM⠱`q_k 0@0SU_P_ 0 RL0 RF  0 P@ 0 ( P: !] P3 `lp c 0 0$ 0 3   @c0P@ 00C0/0  00p_ 0 ЍOJIYP/7 O- Mp1`: 0(0 0 @P  @D 0 0M 0 Pᣡ6 0 100S_ !0 00X?o20S 0  R _000 0 (0 30 5  K^ @-@0CS 00S(  (  00 CB\  00S/7i_8Kp@-@D0DP <`Q  KY0 Ap0m`j`k`A-P`@PpX P0CS*  / 00 000 0Q(  (  00 C B P   A"s@-AQ P9 UY# 34 U*J 0`S   R01XP\0  ៟P  !00(   PEP  Q#HPP0300 000C0000ЍpPk_k_iKA-p@ 0R$ 0P00$0P 0P03/$0` 0P \03/$ԚP $0P 0T03/0(00 00 0,0` 0S%$00P0Pk_j`k_@- @0S 00000C0 Ѝ00?$'Pk_p@-P@@T P  @    p@#0!G-@dS`3`00 00pDᎷ00$冷04~08vPEI 00(0,0 0| 08 <008"< 0001 0 30v S4 ᧞P P 0P03/00{0S0uhH 0oȟP :0e#0CX(J 40,00SP  P @ 008 CBP0 4 0 H0D 08000 $<0 0IP000, ᓝ`0$0S ЍPk_^yJJLKUKKA-`@Pp,00p 0W *0, s*00, 0$00S02Pk_i_j`KK@-$@P y00 0 k`0m`0 @-( 0W00m`k`@-ę@A-@$`Vp(PVTPUZPO-@040` Dps\ 0C0#"N00N0P H0S* "!N00N0چ0pW,p  ,!@ 0 00Y#p #R $R04PU@P Ѝ0S N T AoQ N 0`R  0P O(PTX\;\V ,0@00T0T0X0X0`ͮ " 댲KPk_O-lMP`;ᘐ@0d00 0p唰儠uPdVp0s+ 嘻0 @H0aP P h;0dS mUVF UJV>V V >V ;0S7 >40F+Sꜘxxxxxxtxxxxxxxxxxxxxxx@xxxxxxxĚxxPxxbV `VW(:'$*0 :BG dV lVW=V ʠV ʂVX Vp0s). 1 0P@V Vp0s\)V Vu VV V V ԗ0SO-P 9|0#S $p$⦗PP @d8`8 d0 30! #2 8券0S # 0 0N  0 0m`80H0L<  08(00S( V 7 p0s' !0 07@P: P 00FS$Vp0s8' !0SR MP F  0((Q !0,k @P6 D6 ɉPjڰ60Sjڸ6"e&H00S0X0S@0D 0P@ 0ᅊ<6H R X R @D oP @ P 60₊80H0L00X0S 5붉0S 50S0嫉|Pڦ0S 0 Y0*\50Sxϑ 0  0p45 p0s$E 1 0P@p r$ l0S  [0  0蒊r\ljL0U,L0Q(0Y LY0 I 0,0TL0A$L0=(L0(007$l   @ T 1ꉠ',L0#$TꡉxhL0$L0(0Y T3 430SKXDG׮ P0T <"@D0 0R @P ̲ R20S 0#!Ԉ !=0  000ƈ0 . 0  2P0S:\ P 0SS p0sr!6 1 0P@(V ,V &V!&t0s!! 1 |0s!x 01 0P@!d0A0P @P+P0D$< 8 @^00S(  00 @# 0 @W ^ P  x040 H W  zlЍ^JPk_ m`i_TKhM$EG$KkKj`^m`ѯK8KKKK,m`KK2KKO- n P p DR 4  00P03/0m\0K0[0K0` 0\03/K厓0 RP0T0P03/X P\[0lP00IMPP(PL H- 0_8-u * 0s0!#SPL`K lN0@s0 cGbP dP>Up<5*PP4 0@s0#G8/( ,0@s0S#d,#à#T<4P&PP P, P`K }P P P` 0r 32P P<00PP P0s0 S # `K R`K N\0[`XpS"S"0CS0 <$XdS8 P0Sp:`d X `5dp5s h 0d` Ppd hpyCt*op A ty>*T A xPty4), A ty/)u A py*)w {A 0CS P P PP0 00RjtPPyP) `A x PPPP P P0P-S0lS  P0UoS[0U.SX 9R0 T8 X P 1:p  |   $ Q1 1 0X   0x000t(T0S `QX0,00X0:D8@ pPPp`$8'0 CQ 'Th0 p 倇 |   $ Q 1 3   0x000t@4@|@ x@ 7`K 47 ?0S6  X6 Rl. T,h`0 K ` 0t @/&0O0(P0 T0X0\06\`VT06X0000 000,00_\0pl000l0pp 00 `ᜧ 5TK \ M pIP 5Pp R pT 6 60Sy6ux5\`0V X0p ``x0x!P0q0SxP `ʃ0 0 01CР(0> xP R 0F0 CQ$52CU崕U ! 3P*U0 UP! BK P0 F F p X V  `FY$&a a""`  0 A& 0 H5#0 `K zpP 3Pp R pT V P PP Px0S 0H Tp \0[$S0SX0  0$ 000\ 03S N0 $0N0: PP 2Ep0S `SQ xFQ `-Q S#Q (Q Qh X@0KH0  hKHK h0H @0 H  h0H hKD0 H9h`V1 c # 0CS%: 4x 4 00040000`40VP  P @ ,008 CBP 4 0 hP HKZ Y ( 00A Se10S`^GQh d` t001p00X00000 0([   cQ TQO VQfQ tQU{ h d`  t00x0p000000d hfh d` t00,0p000X  0!8[0000Pk_^2Kk_  E@DU@KܰKK^K, KOG*K j`BKJ$KPk_Kj`i_TK^0U*0U-0 S* h d`  t0\p0p000d h0tSh d`  t00p000000d hPP 00@ S(0@s0S13 eP0-S0:S`aTq" 0P :SS00 Eh d  t  p 0000 00d hx0S ,S0S;S  ,S  Rx \S ?S0S0 3/h d`  t00X2p00000d hIYT/MP : 0020SZX0S P T 0  hKOh0S0X0 T p0S P X0  0N0p 0N0X T   p0S 0Rp0030!R00S N0 0N00p0 p0h d` s#z> s0tp 0 0 TLP  00L40St៉X0SP T 0  hKh0S0X0 T p0S P X0  0N0p 0N0X0T0   p R  Sp  3 !S  R N 0 N p p h d` r%= r tp00  0;`K 5`X\0W 5 50Sw4+0X& P!0Sh S e |Q|| 10P!S|P Xʠ0 00 01CР(05 |P I P0QA  T= 6P07 p  |   @4@|@ x@ *<70S%L !0 RyT# `d rq p   |     $ Q 1 1   0x000t0TK\08 00 30 ,( hP HK R(Kp@- M` 1@Q000(000P0U00!dP 0H 000C0 0G P`G X0 P0X  D0 0 30 ' ᦣ  Ѝp^Pk_O-@R@p04`000000 0 00pwP* b< #0CZ (Ҿ 400 0 S,P  P @ 008 CBP0 4 0 0 0000#ۑP 0 'W 0T0 0CS00(p 0070 p00ea6(00 0Z0000إ 0p( 008 00 0 `0000(0000 Ѝ I Pk_KO-@-$M`p!2PP0000 0JCd` Q\; 0 (00\  P 135V`1P1`P$R `F0+000%`0!(` 0 00 006 `00 0

KO-P0_S@ @  P@ O`pC`V. TV7 (V V $V" 0@qpGp.VXV _V0T_0C?o20S  BR0_S  @ 000T a0BORS00@p  PΤGV0WΜGV1Wp@-`FD0@0ADP:pp@-`6D0@01DP>p0p@-@0P0` u0R`Vpp@0u P003/0 @-@r0\,001 Q @ /A-p`@A0tPS0t @0 03/P Q0A-p0P03/`PA@t@A0 R 00 03/0P A`@t@A-`pP@A t0R0t @ 003/P 0A-0Pp03/`PA@t@A0 R 0 003/P A`@t@p@-@P` t0Rp0t @003/`G-P@`q0S K000p  011g 0PQUP 8/P(PO-,M3p@0$000000 p50ppY2 $0 30  `0F` 0a 0S0008瑨h1S Z P 0 <,bX p0 pPp0 0 尷 0S* Xp xx - + H  b ވ10? !ᦺ 0pS3嘣h0!R' 1P 00 0 Q00' $ <,b\ 0\10!0  P R  <,bQ 0`F0C 0gP> |,Ѝ^O- [>  [  `d0| \00'`04  <  8 \W!td0 |0  00<0S4[$D9)\ D0 80S8 ? 0$0p0( 002 蠄00 000pጱ(0?,0(0U,00 :h D 0H0L P0D0  03 ᚑ30  P`Wp 0p D 0H0L P0D0$  r  @⦿;@0 0 30 C  @▿\ Ѝ^KwNKJrUNKMKIYMID_KIKXKK!gY5cUK}QK[OG-@XMP@q 00DHaPQ3/ 0000 0080@AA?0AA0S00*V L! 8l- P U  ET0 1 30  0@ 0/0 3ލ1S^tp@-`@PW 00pO- M 0R 0 0 0 4 @0(0 0 0S`4a\$0XX4a-   !  bL Р@!  @\`VZ:2P` ^  * R $p WY R Rp P` p  Ђ 0Rʹ U PpW 83!(3/o b  U( #]W"Kp䂟p P K K0Si 0SGU; S/ KtKd Ph" 0 wPlKY<"lKP!0 0 0 v" xKtxKV|KXP0Sڈ | . KtK*0 0h0K刐000  000!  0FpS  0R0@ 0R?0S lK8YtKVKV0 (0 300  lK+YtKV 000 y|K lKYtKVKVɔ `bP`2 R >* ` p dK2$K!/ K^FK$EG3KKhzKKK[OO-P-M400800 00$00(07000R`P 0S@@0!0ST@@0  TPV 0S%6&06, &x8000 0400$00(00!x V뜝06 0 30v 2 xVO 6)&0 &徘 0Po000 Q b*@x0 x0"$&(*8 |0ጠB@oY p tpᬙ 0pS:$0T(00:0%X0L0010H0U0P   ,0PpGg,@  0 0 30  $Ѝ^@-@S GG@-@P0M000 0 0 30  Ѝ@|X PDy$ mt0 0 30Ѝ^HK/0@o/P/ 7@-@ \PX0X X00Pu  @0P ⮟ P  Ѝ09h99@-0 @ @O--x2,MpP0$00 `8y(  0@0 @S$2\ "02d @Ts . Pj R hPP 9Pc ! 0CS ᴟ 0 009 0P0P0 9 0p氁 P}9 0p!PP 9 0P X0 0BS ~   0  S000Q44$00CB\   庐d8 I $0 $0 30 " ,Ѝ^K$EGeKK0@-S 0' 00 ЍK$EGKK0S0SS/(S$S S S//S !S/0@-S,0U( 0$$0 P ЍK$EGKK0S0S S/0Cs0S җ/K?0S PP"P//0<0S0S 0/G(00S/Ѳ@-P2 @'hi_K P0!S S/0Cs0 S@-@G13 (00SP hi_=K0 S0SS/0Cs0S 0ӕ/KP!P P/0S0%SS/(SS/0C s00/ 0#,!0Y,P /0XP$`0P@ @  Cdp(0  C0<0  CP0E  Cd0x  Cx0  C`0! $00Ѝ^EKpK*)Si_K K$EGKKXp`^EG.K`KHL L@LLLp@-@PQ ἞ P Q ᵞ opppp@-@PP JPp@-@P z0C-@PQ L pl`6<PT(C- 0` P Qp @C cD8IÌ0P?S @ @ C pc4C@t PVP0 0S S @-*SUUUUUUUUpx K@- @0C S  0 0S(  (  00 CB\ 0  @C 0Bs0RS/@-| Kt0p@-`2@Q Q QP 8i P!R$0rpP+`KUKL ̠       $ 0 4 8 < @ D/xK R@-< 0C0/qK @Q!:@-/  B B/KO- M0@0(0 0pD* 8P=* !l`PΞP 000M+* 7p` P ;l ɞ`P$0 (0 30 3  K^0@Q!:@-  B1S/K Bo/@-P K@-P K0Q RS/@- ]KP/QQ00Q00S/@- K@-Q00 00 @P0Bs\AQ RR P 0T RP S S80 0 30 R j0PЍ^0@-M 1Q0000 0 305 P@ p0Bs\"0Q/  ^P 0 00S0  S0T0 R0R &P S Ѝ0^0@-Mx0Q0 00\0 0 30 ^ 0SP @P D o Ѝ0^A-pRM00000 0 30) : P` p0BsQ0@/ T:?X P E o R @PЍ^@-}0U+`0-Q 0 0A @-P`0`@0 00) 02 0 00 0 30 Ѝp^@-  ЍA-p<@@0Q P A   (<$`00C0S8?4/00? `p WoWWfWLp@G9TDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfDfPefftp il`esq@ql`o8opxeeecl`q|rr il` s s(0GSd pkkkkkkp0GS񟗮8cl`l`il`dDdXdddddee4eghphh@h/W#W0G s093 0CS ~OW1- P G?Z10@$0i 0s0Sq0GSmol`l`l`l`l`l`l`l`l`l`l`l`l`l`l`pl`eq|rr$j sl` sHrcc\q0 G?` ]i0p@`Y0S D0#@p 01L K a0`L403/D0p@# 0 L KO0`L403/ 0` &i 0`0@p` h` i 0`0@` h` i 0`0@` h` h 0 `0@` hL K `$KT K `%K< K * ` #K@< K <08 ` V  , )(000$0 )0$0q  ` h < K`#Kr0h)0$0@ } T K0`03/T P0 0B< K  T K0`<0T K  0`pX Kd0 \KD0 0 0000Lp 0H 3/X \F$Q(Q 0@44/0D LKPz T0 P000@d p< <K#KLp Hp Dp <$pLK9p@;pT7`'0\7# 0P0 T T`@ 0CSH pCKKKK;KKK*K^2p0  @04/` f`i` `eK@4$ m2T0`T< K *80`<1!>k$00CS0$0>L K < K #K` $KYT%040,` `e0$03/!` `e` e0 `(1/L K L`@` Vp 00@0< K3p  80<sq0<0 08 0@<0004/` `e0 0@0L K 0@L ,0`3/-< K L K 0`L ,03/0<  03/ L KL`Q 0 ,03/@WWpp Q f#Z  0h d0 ^#&KSRw0 -@0803/X@ \ K\pKXK]nP4 00 30 \ (K7@-@ P0S 03 00  Ѝ0#K$EG#KK@- LK@- @-@P Au O-pЀIqSdQ0G@!@3`@)*TP "T@!0 0P 0W  B  S0CXp Au QP ЍB0 0 OGG-`0@GA0T dAT ! 3@P**T T@!( P 0Y C     e pG( W  ` V Azu (0㓤*@333OG00/d_0@o/0kP/ 7@-PGi@DiD@p0 00F Ѝ0 K$EGKK@-4M0`p@0,00hP0 00- t j000 PEPH04 0000 ,0 30 G 4Ѝ^VK$EGKKiK7@- Rʄ0| 0|0|  B@ RdP{ PP08 040{  Ѝ0@ Ѝ0K$EGKK+`K1@-M0 00l10ST1 0 30N `phP(Q h@P1 { 0P PU0 00 fhP0 00 0Sʬ0q 00002P0S` 0t0 0Pd0U< 0P0PqЍ^^hK+`N$EGKKKK$KKDKK@-@`Pj@p̐P0\1!01L 0Z0 00S B0  Ѝ@eR0C S0CS! 0p 0l00 wV 00CS" D(0, P 0 ЍxV$EGKKKK07@-0SH0KD 0@@0 @PP  Ѝ0@je Ѝ0?K$EGKK00@-20$0$ 00y 0 ЍK0,`@-@P 0C-@PQ L pl`6<PT(-  R*R03#<0p@-@P`ᢶ0S  p@/p+`C-M`20pC0 00"p00SD S S@? S@ h"d @S PS@@FCdT @B`@@P 0@ 0@F_@P R R R!\PxH XdꐂĂ$؃؃؃؃Pd@P  0@0000 00000803/0 0 307 00000,000000 03/ z00000<03/0000000000000$03/ MiЍ^9KzKaKKP/r  'K @-@0C S ㇍ 0 0S(  (  00 CB\ 0  C00 0 0@-S ^P@ 0 ^U  P#30S ^03#0p@-P`@OP 0 -Up 00p0/0P/p@-0` VUp R 044cQ p00P/ss@-__ p@-@P$0P p@Cp@莁+`@- 0< aP P Ѝp@-@PPp>Pp B0S18pSp0P ,ᗗ P+≑ Pp00pK0@-@P PC8 0A @   000 BFA GB   80<0@0G80@-dM(1@0\00P|p10WPp`^gx000 0000(m ,QQr, VP@ ) L0 \0 30 B 8 V )s Yr dЍ^XKK0@-@塴@+`0@-@噴@+`0@-@呴@+`p@-@Pa$p@aK@-(M0@0$00dPdP   ts@dP YsP\  6p00S@$0 $0 30 (Ѝ@p^ДPP0K[KK-4M00,00@x0 t$l00h00d000 0X00T00P00L0e0 ,0 30 4Ѝ^+`K\,`X,` KKK^@-@P$4  P@ep O--dMS @  , ' \ 000004080<0000D %D`P  U0* 0[0 V0 0P3/p#XWJ 0P#0CGSH$​ 00,`(H0SL  L < 004 CBP 00 , (0 p40A00$00C$ RSB P0Pᵕ \p p PP0eS 0hS P&P00qB0S0p800WC00S80 P001<0H 0P(0 $! 0 [ Bp b < X?R@  B pb̎8nj x ( Rg  $ R  H fPY HL $  ? $00zS00@0 P PPC P0P0(0p0S2 L0CS+pďďďďx,03/pP#- ߈80|00 4 D000< WD0Ap(0S(,@v `[ R0J 0b00 0c000  0S 00EpS? V  pW0W0*#0C'S($l 00,`((0SL  L < 004 CBP 0 0,  PP 00,0  0000{ 0= R1!01 4D000< p 0 & D0D4P00< 0 0 PD0p0p@0S P zPm P0[i:0p 0P`` ,Pf \ Re000S 0 0S S x0 \0 30 x00S 0l #SL00S 0D  dЍ^K*KK$EGaKNKi_cKK$KA-p` N_@I 8<0 0C1T0PP*PP,T0@0SᕋP#0 ART%00ꫪi_yKO-|M p0@00`0000 0:0t00Є[~:#R (PU 0m 0(04: t0 30 P$ ?80<0?0 8<0h P40l00#!08$ 8 02#  WP? 0#gN/Q',l̗D(DPԚdԝ 4 ,000< 0 0,0P  Po\'2#400 0# P_\'2#400 0# PO\'2#400 0#8 \8P Y8 TP#w8 L8 P-?8<0' 8 02#  8 68 P?8<0 8 02# 8 !8P ?0 8<00 P8?04008 2#  0 (s(Q QlTQf0 @00 D00H00000  ` $ d (  h (0@@K8 #!0 0PS 0 l0h40#!0##!0 008 8P ?00 0PS 0 l0h40#!0##!0 4 00  0$ P8 8 Pf?8<0`0 v80  400 08 e8P F?@ 8<0`l0P@ hDb8 N8P/0 E0Ph l400#08 08 .8P@ ,@Ph lD08 8P0 80  400 08 8P ?@ 0h PD0@l0#!0!0@ h PD0@l0#!0!U0 PO8 8P ?0 8<0h P40l00#!08$80 D  @ r #0A#S$ $Pq bx #Qz: P@Pp?t 04h0 fk l |Ѝ^i_KKQKaKO-TM(5pP0L00H0000405@0 0P8p`PPd1`!0\1\  0R, &R<1(!0$1B@ T1 00 R :PJ R 0EQUZ P ŀ00PPEEP@ 0 000S Z0$Ѝa`KL$EGKaKKKO-M`P$1,(00p,1001 041$010000 4`p@P_ ,Y1!01` 0h0#h0آph00 `0 9h8Z88C,0ph00 `0 "0S S * hj ( -0| Qx0 0s 0@ hX0 0 30 L ,0~0@ 00 0$ 0Ѝ^-KMK$EGaKhKK@-P00 000P @] P 0A0S @od0 0 30  ^H0`偬0S 3/PoЍp^^+`O-AM5P000^`@'00SG0@ 0\ 0@\ @]40PP5 %05 40S4$04pp#80000 (,u]400 0 p0Y@z@@c( ]0P0+ 0( ,Z!:0 Z *40 0p/0S &ኄY(#0 00 &]40$$0 0p0 0S SI #> QP+j 0 SPDj P 1^? + V0 \+ P਒P 0U2P㌒匢ptL \4P 0UV Q*0.0S 008 S800 g40000 000(zpu'l 0 :/P& 0pP00?0.,0S0S0S p*  MLPp ` 0FS Q0*#pWW V( p V``Pp@80 0 30 ym i ph Aߍ^:K$EGKaKFKK+`i_dKC-MP`o] 80@S p0 Sz4,@l4̰ıt@X8 P ЍЍCX 0 0ЍCX + ЍC}X40000 P 000 0 0 0ЍCtX40000 P 000 0  ЍCX 0 0! `p*@d 0 0 ЍC/ 2 KaK0@- KK@-8 KK@-2 KK@-, KK@-& KK@- KK@- KK@- -KKp@-@HPD\? *p@T 0abp@-`@PH2\? )H p@Qp@-@(PU 0e P Ae pp@-@H`F00PV00" "vVSS 0``00Q`B  ᯄ 000!!!! 0 0$0$0(0(0p00@- A !A!A!A! 0 $ 0$0$ $0( (0( (00@0@-@08P @Ae P Ae xK0@-@0XK@-@Pe @-@Hze @-@8nl@-@P Ahe @-@P p@-@PU ! PPp`PHe 00P/@e @-@NN1NL^*SQ10* S1 ! O-@0Z 00 _PJ`0U0  IPPY  PW Ae `aP`OGQA-P0@0` qP qRg 00k g >f Rq  PჄ 0S` 0 bP 0P10!0 A-ML1 p000P06瓆fP @T 1 0 309   @0000000 0  0S  06瓆f0!R 1@ 00 0 @ R  <,bA kd e Ѝ^Q@-@ PQ@0p @ A,`Pp\0L 0C1 2C$ꫪ G-PQp00C @1Ɂ UB^*RU@!@1@*T` T@! `  BR   Ad @YP0e%`d&P`諪UUU\G@-QH0D 0@@0 0C4 1QA Ѝ ЍK$EGKK0Qp@-P P@S A@D@DP u pG-PQ0@ p BpCBUGp }`p  BRዂ Ac W PQ`P\GA-@`PpP  P0 0P 0P 0 0 0P 0p@-@`P5/P`p00Q/A-@`pPU yP U  E' PO-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !8P  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p; pPpK pGP X:I0 P0p  0p@-H 0DD0  @ 0 0 30 Ѝ^{K$EGfK2K0p@-@PQU  R 0 0 000p P P 0p@-0D@(P04, ,0Q(PpPc +`[OZHUVK0 @-\  @\@ 00 00/@-@(b 0@-SH09D 0@@0 @40,0S $Ѝ@oЍK$EGKK+`K(0@-@,0S ^00+`-K+`$0@-@,0S N00+`IK+`@-`TMp<1@0L006P$00`  U  R OP ⏀ 0$0  0  0J ─ ⒀ c  4f< a4℀ ₀   00 L0 30 4w TЍ^^EG*)SA-Pd1 M@0000S00 `V 0U ``1 0 30? q1,0S` h 00< P 003/ 04 00P` Ka Q \c ,0Svc 0 <mc  b  Ѝ^aK+`K KKK10@-lM40d00 80S 4z A40LL t1@p!0hh1@a\ T1@LA0H!H1,@D<1 P8!4P,1(!(P !00$01  0100@P0 @Կ0 ,00000 000000004 40 d0 30 L 4 b lЍ0^+`hC_(KAK(,`K C_,`HMKgK,HK2QXKKɀYKSSxC_tC_ KNKzKp@-(MQ000$00, 0P v @``0T0@ 0( A PP  C 0 0   0 0d D I @0 $0 30 >  a tN(Ѝp+`^+`^EG@-\MH2p0T000Sj P`9P2,0S` ]1 T0 30 j \Ѝ@P80 CD0 C@P 9P1,0S: 0w5 pP0S 8 ~ 8@0S < $8r# 80P0Z Pa  0,0S 0009A8M#~ |0 T0 30\ЍQa T0@,0Sb 0@ #a 8.#~ a ^+`KKK4KdKK@-@~ $0@-@0p   K@-@ _ A-`P@CpPV p$q@Dp@-PEP B @p0 R R/10Cs0 S җ/Kp@-@P`00S @0D 4 B800CC1B1 00p,0(0S `p@-`P@ 0CQz  " 00 000 0S(  (  00 CB\  pG-@`p@P0@DDA@DPPQ  P 0@-@ & T (KR/ BR/ B@-@% p,T 0F 00 ЍDKK$EGoKJK0P/ss@-LL B@-ό@\ B/\    L/ Q A  SB PNqaW1Q Q0pp@-LrL @-0@AT o} 00P/0@-P0U00S  4$bQ 00P/ss@-ULBLk P/i^ 07@-QA00000U0P0 0 30  0@XP (0S  Ѝ0^P/A-@`PVp0W*T  E} pP  W:p0A-@pP0E@SCaWF1 BQ A05   EB!60ES1`\ *P*!\* \* 0 ` Q: C0\:V :pG PP*(0@-0 0ȼ ЍnA_tKK O-Pl1Mp000@0@`D0 00  I  H  I  H  0C 0CS 0o 00 :^ ~{x u ry"0 0 30 Ѝ^0K$EGoKKC-`0M@p0 0000PSP !   7 p` 1 8 pU`  01QaP 0SP0 0D0@ 0<<0" $0P 0 30 W Ѝ^K$EGoKSKO-p1,M0$000`IP!0A0 1P3S: 000 000 @ @0DY E0S# 0A 00 Q 0 000 ! 5@ ^ o0GSd0P 0L0n ``50 $0 30 ,Ѝ^K$EGKoK&KO-`1TMp@0L000x 0 0S1 L0 30e  . P R9'} P `0 \ %0<S7 !PAA0CQ- A  00000P0S8  8 ( 00 CBP   ){   0S `0  w 4 4 P4{ 4 {  { ~] TЍ^A-`XpW# @P04 qP@ 0 k   h0 &  000ЍA-@P`p00X04 00C0@ 00<Ѝ,0(0S 0 A-P@`p00X04 n00@ 0fЍ,0(0S 0 O-p?M0300@aV@@P! BR  L2S R 0S / P8>Y̎ 0 $P.>W  C   0 .03Y`> + 2R001Q  0!r 0 P *`0@|0 0 00Rd p00 0% p 10CCW:00P00) dR/ ⨠00Ab  0XQ (0S | > Q0 R+pR0'V0C0 ( B0<@"Q<,0 t< .hd!tqHp1pG003/003/<"@2p0CpH"L20Cp0 pV pp0000G R*;),0 ; ig6R|a+I H ?   0G 000 0  }  w0!1 BB1c 000j01/  0a  [<"@2R|:_*0 x:] d!h10C C1000E<"@2R$:\*0X $:G p!t10C C1000/<"@2R9*0 91 0C000  0  900*0CZ l9W)0 D9 | <"@2R84)00 9 Y0 03/0 03/!fR|+l%&'+s d2V03S00 #H1  L1 P1T1E8S Vu S.R S [ 0  (0%  0!$0A(0A,0Q0030000u 0P00 %p00 |0xp 10CCW:040@804<000L26 4 |@0 00 0X`Vi (0S 0 |0Y 댠0 5eeH@P0 p0000u 0 RF0S | 0S=5%05( )0S p l05ee0!R 1@000000 0 @ R  <,bA |g(Vt ; 0 @(@  0 000p\0S -P     0@0D0H00P @  R/ !1 BB1c 0_ PQLAU6LQ000050P1`L`P`T`X`\``````` 0 0Sap!P000LA05pp0pp@0DZX`LP,40`@ PF0S  `X pFG!/o b C@W@p V R@ 0R %"* \ 0 QQ  RR  ^00S  R 1Z!01% O@A_ 0 00a P00\ X0pB p0@`00`pG` `Gp p 0QpC  v 0 0t@]_ Ġ0 7g PL0 |d0000mt *Y W ] Z bXL@4KKKtKKKKoK5KKKK KK*KK0KKK$EGoK[K^|0S d 07瓇g0!R 1@0t`00p% X0C00AA @ R  <,bA p p@W0PX@mPU6 X0\``F0|0j PpB`0 ; k0 `PP 0 0 0p`P|cU XG|[gPL3L-0S3 00dp0p@0 |0(00p0t0x0d0h0l0|0p@V|@ o(Vr ST'"R 3 #03 |3S .r.z {l3 3 30 'ߍO-M|1x!\0|00p0 T   p@| P  @0S 1 $`X0 |0 302 p¿E P`GPP ᶿ^ 0P 0^ 0 Q W X P!a᜿0  X X Ѝ^aK!gYKa`qA-pC @0`0CCQppG P pAA PQpP蛸H@-0@$09 P K@-@,$98t O-`,3MPQp000  t0 @ $ ( , l0 z P ls 0lt0l st 0l lp0|x Tx <x $P$,0QT ( R t (0 0$ 0(00s <s Ts ls   Y( P ,  $,$0 !0  000  pP,儷7$ 0P ,P P,0 Q =,0S U" `49$`V0& 00 U0(0 l0 0 30 <{s Tys lws ,9Sos U 0BЍ^*)SKPJK]J$EG9JJ^EG00P/vT p@-@PU  !t PPp`?-P_T 00P/WT p@-@PU  !s PPp`PBT p@-@PU !s PPp`$P-T 00P/%T p@-@PU !s PPp`PT 00P/ T p@-@CPo  lPPpPxDP \TP,@PH,(,,pKKO-P@ ` p PYP 0S ^ P S  P PZ  0 o^ 0000000P/S p@-@PU  !1s PPp` PS 00P/{S p@-@PU  !s PPp`PfS 0 R/ 0 L1 CP*@-A Q 1 *Q1!// A-@C` p#3 W'  BQ00 P A3 P0 SP A(S pPPpP@P0^  S \GA-@aP aA:B0@- 0 Ѝp@-`@x P0D@ S pO-@Mp᧣∬ᨳ p `倐 V 000 Ѝ r 00PF0# @   P 0ES0AS0CR` AR 0`PPP00OG@-@NN1NL^*@Q10* S1 ! @-@  + 0S 80y4 0000p 00 0@AЍK$EGoK7KG-0`P@Pp0X L0CRR@go P P0 11cU G-0`P@Pp 0Xr P@P 02l U Qp@-@00 Pn!@q p0 p@-@00 0% 00Vn 0PS*!pyJS p@-@PU *Q p@-@P Q p@-@PU >$Q pp@-P@TpP ` Q @-@P AQ Qp@-P0@0` P!PNq 0S`p 0 bP 0P10!0 S 00W S R @-@P }Q P0 R0 / C B0O-`Q @@0p0Cp@C1G !V B Ѝ^*? VP! P1P *U UP!B p0SP A3Q `0㓆&哅(`P 0p        )0fff\GA-T 0GC1QAA(0A$TP``)W@Qp@-P0@0` PG!Pp 0Sd`p 0 bP 0P10!0 R 00V R R Qp@-P0@0` P!PWp 0SM`p 0 bP 0P10!0 R 00V R Q @-P0M@`0000p0000 0 m 0S  06vf0! pR 1P 00 0X0 0 30  P R <,bQ Ѝ^O-$M1p 000000 0% @ 00 p$0(0,00PU 44 0  U:1 0 30< Q E@ 0`(s0 1a0  P`0 00n`00V u P$?Q 0S0 4$Ѝ^i_KA-@Q@8TaRu`0 0 30 M  @ R <,bA (]O $Ѝ^O-`dM2@ሀ0\000 Sp& S& SL| \!P2 0ޠZ| ኣ0P0SP^n P0 ( P $84+  p`  ,Cj,0<S501!PAA0CQ*, v !00100Q1S4! 4!$!00!CBP !!,ml P00 0(0 0$ h DgD &PDUl   p` D0 \0 30 D=l ,;l N dЍ^KG-p0MP`8<000X0`0 0 30 t 0  00@S  0 *Ѝ^C-0p@P`X`04 00@ ``h0ЀQ 4 000 Ѝ0Qp@-P P@S A@D@DP l pG-PQ0@ p BpCBUG\ Cf` Pp Q6AAa`P\G,8O-LM 0D000R 8(08  @ 13: я b @  { 0@*ARB(0 0 003/ 003/ `0,000400`V v<:*1P 0| P l ,PP0P4PPUP",P0C0  BC1BQ:[ 6&06X ,`000CC17g R 1P`0P a!R00000004 k;0 0 0,PS 00S00,P%(`p,E0 0  |0PAA(,P0 0,0@0004 7; 0㤠000800]08 00a P`20`0 0`F`8 `0<00P?0p 1a0 P0 0 0;0<088,M 03/!0A03/0S33#03 ` 000S 0  匀07璇gP18<S@P X\ P UPUDy P 0:aW8 0P0$0000 g $0S (Zp쐧 !pj 0ܐS6p7皇gؠ0!R0 1P0000PS3 |??W <,b\ 0\10!0 ,M 00)Q FM K N P R  <,bQ p00?  ?0S0   0 0*b  0 0 0 ?U `* 00 0,0 D0 30 LЍ^K$EGoKK\G!KOG K0A-P`c0@ N pn̈4nj00A-p`Ac0P D d5P?U @ @D `eČ>ƌ~0A-p0`P,0@3/p0 03/ 00PppW0 0 03/0R0@- R0@ 0/0 F 0,03/K=KO-P010S<0@@@D|1A1S@T 0\ ^@`D0V 00`00 000F0@` Ѝ<1 FA1Tw8T ! 3@**Tp T@! p0   0    V0Y㨁03#` D AI \[L+ 0   0$ H  p(ЍK@-@ G P Q0*8 0 0 D0 H0 DL0000W    c:  p W@*0S(p " 0pt0S񟗝`babcd0Pn ~? P , @ &PxPp^ !Pp! 0 7SPXpP㗽 0`00Sd 0^p@ 0Xp/ ,P#000 0儐0`X00 }D@Mp #QP00CPv@  %c D7x 0`R|00*@)pZ  c @{p! @qP0 0 30ЍQ"(< 0P S @]!p 0 S|00S DX@HSp'< @ $< @?PA; D^ L8-M LKK K,,`@-$  ~ЍA-M0 耟000!0200S0 00 @P/딉 0!p2$`0.0  8/ 0000 B0 0 30 ̽ Ѝ^(^SK$EG KKA-M0 耟000!0200S0= 00q @P/O 0!p2$`0L.0  8/0000 y0 0 30 Ѝ^(^SK$EG KK@-M|2P@00000SV S SpW  R0s ` ᩘV@2 0 c R`  R0s ` ᒘV@1 0 -/ 0000 @0SL1  0 30 ) Ѝ@ 0 30Ѝ@[`0  v Q  R0s p QW@ ᥲ0 !0 p0 0 30Ѝ@ŕ!d0 0 (0 0 30Ѝ  ^,OKKbKK KC-PT4|M@P0t00@|Q`$,P P=00CSmnjmhjhjTn 0pS3O#03j 0@S  3VX00h0l00\0  e1h $c10(S 00&ჼ 40S S `@40S   @`8N '` V T$ <2 t0 30 F Q#: 0` S S20S B^> 0:  O9 ,: P1\!01z!R0:@ 0000@!@!`,!3 < 0 X`4 ,@P/ !  P) 0000 0`P  V 0 0R `P 0S  0 0吵|Ѝ^*L$EGK K\ L,,`GLO- srM`P( P Q| 0 0M@1@00 =` 00` !0 u0 (0 30 K^yL@-$ 0000 a Ѝ@-@Q0 $`P0 000 ', 00 0000D0 0 30 S Ѝp^O-|MHPp0`0@Њ0 1嬰0t000$0$0H01L000004j400 0mPZ 0 @0 000@00D0080@0 t0 300  0 00Q P(00 0klP 0S 00 0 0(\,  :fzR 8 0 @rR |Ѝ^T?3@-M@뮉P0p`1 > 0P# @K;Tx0t 0p0pv 00C(S X0D 0@0 P000000!LЍ% JL$EGL KLG-M`poi 00S5ኡiQ^Al dP@ 0C1Z00Q0S 0T@J T( 0TP@@@D0ST Ѝ|0{x 0tt0 p:P4,L $!@ P 0L=L$EG KL% JA- MpP`l@P 0\ | \"03< P~@h:00 @0`,0 0 30 P Ѝ^KLmL% JO-|Ml9(0t00980h0 l0p0 ?o200(0S D0<0  @ T ( h96 <0D0anQ 0 A q~A @(0p@`SP {σP (v 0 !.1, @0y v@, 80 0C144Q ( U:U`P4@0S,0I 0!.1, @080(08008HE+ p?^?LK P$ L0!S~00S : @p$0` h001JP0U@p(0hP!S2l0.0Cd0\0d 0X001H`P2@PX0S $0  0`\0S: $0  0300`0$0P000 0< 0%0$0 l0.0Cd0\0d 0X001H`P2X0S L \0S 8 00 0$0 000D000l0!0Cd0.1H`P3 0$ 0 L`TL `ࢁ H $  P 0/(  0Q!.D$0 1^0 <0`  00 0WH0hP$0P0#03Q^O(0hpSL Pp  T0 0 0 0900H 0$0p000 eH00P0S U0 h0 0 b0V E0 00H 0$0000D0 00Z0 1a(0S $0 000 0yU8000 00H0p 0q$ ~0 X ?:HJ 0P$ 0 PU`P`;P`00P0$0 `000(0S 0 !$.1Q*$0S S 0 0!00 0 00(0S$0P` 04004080 40C1@Y,P#2Q h,0 t0 30 tg 40(@0A$@$ Q,  P$Szx|}|\~|Ѝ^L KLHLKO-@0Z 00 PJ`0U0  R IPPY R PW A3 `aP`OGO-@-M"0Ȁ(0000>000 000\0`0d0h0l0p0I 0ს$0PHu`Y!l0x0|0,Ua|`!,`t R x`00$0<0p04080W:Phl00CCUb:tah_\]= 0 30e `P$0 V0G,!V0FS񟗢ꈄlltl$8`t؅$4d<\ll̈\| $,L\4Ȋ($tttttttttttttttttttttttttttttttt                                00tl,,\hVq V V 0 F?x$   ! 0PX0S 00jH0L 0 H0L $     0wPp     0wP     0wP     0w PH ѴP ҴP(8)޴P F? P Ỵ)PѴ% 00 ᭴P0 X*x th\2 Q0:l {  0w0l(P᧴0T( ጴp FP?Z P { P%Hw(i Yw$~P8 }P3 P00H00!7 ]0 PH0  (  P  0S j(v9)P00v/+3VP pp0G G0SR2  !W> v(v 0vvv vH` 0v+vv v 0v+v vP P%o v+mv v+gv   ~| mv+Mv gv cv+Cv ]v+=v:v- Sv+3v MvW Hv+(v Bv+"v ;v+v 5v? 0v+v *v2H00D00P0 000@00(00!P @v( Hvu %Av00  0(00H00D00` P!v  Pu 0P$ 00CH\P0Hh<0W VP(1>!(04 8 00AR0:P H P0S S %v$ R :!.1u~uH00H00L0(408 0 [+lu(u fucu4 09Ó <'6pV09p Ŗp V X 0<0 0 R VI X0< F 0C1000 R 30S% 8倓`0V8`k 00C01 ` R8` q0  ((`V!,hz0 Sd 3J#03 @HP<(ܺU0 0@ S20S 80 000A80S @D0Q@@ , <>,#S,0S-#R `3HL@ @03aS0P 2!01 H SR 7nQ 1P@^P   - T00CT00,0S R  >.bQ1 0,@4nh4`T s@! AVp g` 0`0 ` ÿ H@~<(@($`F$0 $@0$@X0 d0 30  00/ w3 / $-. lЍ^L,,`LLLLL$EG KL LL,O-LO-dMp00 00040\00*!P, "`PW#@/!T) 0 @g@!pC0 ᙌYPD @C0 00@ M /pP3l#03 Y 0@g@p0 sW@|3 Ǧ0 - ! 0[y pUV' 0 @g@p 0@g@Wr ᠦp 0@Xᰂ ᔦ 05 0 X @ 0 $40%80<04L0P T0X0 c80 0Q0 00PU #S@400 RCa 0@Ng@P 0 U@1 M0 #`Q P 0,1g,P 7P 0؋Q00 㕾 @Q4h- @,B00S 4{P"0  RX X X  B/o" PU ^  R 0$0 0(0 00 \0 30 K dЍ^,OXL$M$EG KLLLLDLC-$MT1@P000 0`.0000p$0 0000h @00CS$0S! 0p 000!V) 00!Pp@ T ,0 0 30 - $Ѝ^ L@-@pM P`  p    ]P  (0 0 30  ǽ Ѝ^L$  p@-PQ0M$`@000\0 0 30  P 3 P 0Ѝp^0H0/00000H0/^0H0/0H0/H0S0H0///0PT0/@- -K0PTX0S/0/@- -K DLXH  0_'0@-@LD #P( T? RQ CLlLD0L WD0L TDH0 H0000( J 0 H yp@-0SpPPT@ R\ @\` * @ R  :X p@S p@'0@-0CS 0 00  ЍL$EGGL@-@PI00@-PHPd `pyP v@P<0R8 0440 H 0` Ѝ L L$EG K4 Lp@-`@PH ? lH p@Np@-P@H ? _Hp@@-LLQ:L!D XI@-@P AS* @-@P AI* 0@-@0 L@-@X9* 0@-@0\ L@-@`)* 0@-@0~ L@-@P* 0-@L PD000-@L PD0000P/) p@-@PU  !I PPp`P) O-Ѐ@IAtCPAT0!03@p&*T` 2T@! `0U H IPPY R PX A) `aP`BOGO-Ѐ@IDAtPAT0!03@p%*T` 2T@! `0U0 fH IPPY aR PX A{) `aP`BOGO-@0Z 00 <PJ`0U0 4H IPPY +H PW AI) `aP`OGQA-P0@0` qP qJ+ 00G/ d+ * q)  PH 0S` 0 bP 0P10!0 C-M\1@p00006瓆ftP 0S00' 0P0 0  000 0jE 0S  06瓆f0!R 1P 0P0 000d0 0 30  P R  <,bQ ( * Ѝ^O-p-,1M@PH000L+00 00`H0 HH0sPPU ˺ 0DD00 0 0HpH` L`0L! MT0DL`Hp 0 30 DL`Hp) Ѝ^yLP/> 00S/ i_\ L@-@0 S 000S$ 0@0 R i_ Lp@-P0S@ @M ps@-`/oV0" 000R x70F@0SP F 00 SG 0 00 0 30 7 Ѝp^^EGO-pM28PZ<@0 00 10S 1 0 30o    )@@ `V 0KSSh @\8ȮȮȮȮȮȮȮ8ȮȮȮȮȮȮ\      m     0 803/ 0 ,03/ W 0SZ400S * Ѝ^i_ L LA-`0P@+p000G 0S 0803/0@S00Sڜ @  @000@`T0 0 30 p 0 `A00@XЍ^i_ LO-,M,2P0$000@  0 0 0 S@  (S0 0 a 0 X5@p0SF )SG  0S,S )S S[ W  S`Kᇻ p 0@,S@@Wl E 0 $0 30" S b@@Z E ( V0 S@ 0@ ``N,Ѝ^s@-@0`P 000 TDP@ @P 40 0 30 P ' Ѝp^O-GM M 4DL04X\04TH04`04P04d04h04T0(70t400t@040K>0P 080p0<0L0P:HԬ6 t4 30 e @p W0G Sꐴط  W{ H0 t040L0@Pw< Tp0GS < p@`@W[U/0S\0 [ S$ 4`DG0S @0Q0S D0l @l 0@`D0@0500,80 0 80Y00S 0S*$Y840$[` \^ V0S ڄ[80t$ 0\| 0xK WV[?37X4#T$0PP4倾   < p`<  @Pp@DP0 W$3@Pd0h00 P0 :0S@|   `0@峬U 0S0 WS W< pp`< p{80p@0@ 80V00S 0S ڈ"V820`P"   80S\0 X 00qP080U0SD PUL0S0S 10S $4 W @"D0lK@P`ᬫX0Tl 0`T` l0+ l0R 0S.\x +4LH`T `0 d 0( h 4, P 0 H0` 0 \0$XD 00P9T+ 4S< p`<`Yp@@QV [  ^Gލ Ѝ^i_H LJ L L L+SU Lj Lb L L LL$EGuLl L Ls LL!&L;LuLLLO-EMM804<@04D030L40㙪4P|0G> 0 L@P" H` T* Y0I S*<<ph((x((xLLYb x4 L0 P 0,@P82 L4 30 W  iHppH@@p \H0p @UH0 @8000hpYWY1|!0xx100 ) ` |4@`* & .H0x$0@ %Hp px44S HppH@@p`=0@0<  p"D0 0@00x4000408000=Tz ) wT ) $ EލЍ^``_d_h0C-@PQ L pl`6<PT(00 / 0-R ^0  0S0/A-@`P0 03/p0 03/ 003//`/`d d0`R\// 0R\// 0R\/ 0R SH4/ Sl/ / 0R 0R\/// R\/ 0 R 0@-2/o/ 0 R 0@-2/o/@-$M`@P@Dl0000 p@DeP00 0 30 0$Ѝ^P/8 p@-P0S@`p00a@0Sp@-P@0Sp00S @@-@ 00脈L0@-QHl R SJS 0S ] CyLL @-@0CS= 00S(  (  00 CB\   @-@0CS= 00S(  (  00 CB\  @ p@-@0CSQ*= 00S(  (  00 CLR  p@A @-@0C'S(q= 0(0S(  (  00 CB\   @-@0C'S(V= 0(0SP(  (  00 CB\ 0  C CC @-@0CS6= 00S(  (  00 CB\   p@-@0CSR*= 0Q (00(000A C\0 00p @-@0CS < 0 0S(  (  00 CB\   p@-@0CSQ*< 0Q (00(000A C\0 00p 0R 0  /  @-Š<X/C-`Ap1@DDA@D^ D1C@!0<1<: N PUQR :P PP:p Q pWqW'p P :0P0^P0!:  P P0*x0\` 0l0P0:\0e< 0H0^ 040 ЍuL$EGLaLtL2LLLL0 0S/i_L00S/i_L@-P0 pS 0S 00ƹ P@W0  C00 `#P (0 R P@p Ѝ$@Ӊ 圹 L$EGaL LKOL0O-P@0p8Έ`kh0S  @= 0` |v P  0囒)R ,03/0P :% ( (0_ 03/0 Ѝ̈LL-LG-P@pU ``+0$P t\> (1 `R`: h0W0 G 0/,03/LL40@-@0$0$ 00% Ѝh40@-@0)$0$ 00% Ѝh40@-@0$0$ 0  0% Ѝh`$D40@-@0$0$ 00% Ѝh 0P  @- ' /8-d$MP@0 0 30    K& P $Ѝ^(0@-@0= S$RᗞHᓞDp@-P@cE E op@-@L$1P0 00  }P$  R0R00S00R0R00S00!"!1010 0 30 L P 0! S` 003 001$LP 10Ѝ^LC-MpP8@0吐000`0S 0R0  S| 00d0 0 30 [ SL @ `0 0S100 Ѝ^i_,LLL0O-S`p᠀$MP @R԰p@а\@˥0S00S!ڬ $ЍO@R㔰@@̝0S 0 0  00pe$Ѝ0 0LhLi_L{LLp@-P& @P & @p@-,M41Pp0$000@ˇ`V PS 0 ̲ P#0CS:  4sG 4 004000004 SPP@,  8BA\ 40㜇(9 @ R= ,0 $0 30 I=  ,Ѝ^Lp@-`P @0CQ9  4G 00 000 0S(  (  00 CB\  pA-pRPK RC Q= R@ - R> P/ @`X!C C B > > > Ѝ R00@S0`@p0`p000 42<@`PQ $@`@Q`PpL$Q!gYL`Q\O@-@0`(Pp0 p0CW89 00pS(  (  00 CLR"    ЍA-R`@p1PV \ 4%> P 0 Aކ? WA-@ `pP40SP iP  0PP40Pd07@-@P000 P   4<׻ 0 0 30  Ѝ0^+`d07@-@P000 P   40ẻ 0 0 30 y  Ѝ0^+`A-d`@pPP00   & 0A-Wo@pPP00 ̣  `!d1 00A-PLX`p 0 @ 0eX L 0PP00L0X@ЍLO-MP`ЄH@Lp 0 C00S '%  0Q| 0DW ᰛ 0 H@00D0ЍOLЍ8,`L ᴆL ᰆ8L0 -SR ^S 0\ 0R\hhp@-P@= P P Q@op= opp@-`0S 0PST0!P 0LL0e @pᨢ0 000 0` P0 ЍL$EGaL}LA-@ Pp` c50P p A軅0 Ac0@-y0 0 1 HL$EGLaLG-`0@0pP04S! 0  0F0 P 0|F 0 0L“0000 P 0P P`00ЍU`8Q 8pp@-  MO-M@`D0P01L0000B?à0Zბ% PE_S0 0PC _PVq  YP 0E0PpG!I P p10(0 0 30 П ЍOЍ/^@-M N@000 !Ѝ0BG-? @P0$S  B/S0 0!`` C/ Qa1Q0Up*P00Bσ0 p0`Cp冑 Zp01a``@C-pBM@P`p\ #  F/\ 2,0 `p0L? UÀ 2 Q *0H?02 L 0X01 2p `ЍB@-ό@\ B/\    L/ Q A  SB PNqaW1Q Q00@-$MP@PEE"y$Ѝ0PMO-M@`  @P p UЍOЍ/ CP T  Ev9 P - R: @ @- `P @L V0:Ѝp@p@-P`@\Lp0P/0@-P0U00S  4$bQ 00P/p@-0` VUp R 044cQ p00P/p@-0` VUp R 044cQ p0P/A-@PU p`W0 *T  @8 p`d0P/0@-P0U00S  4$bQ 0P/@-M@pP `WЍ 0 P0 *T  E8 P60P/p@-0` VUp R 044cQ p00P/0@-P0U00S  4$bQ 0 0Q@-9 o/010/0P/p@-0` VUp R 044cQ p00P/~ss@-5"K 0P/0@-0P U P0 044cQ 000AMO-Mp<0P @0DA 0Tʌ0 0 30 N `P0 0 3/ 0 3/P`DP`F@ЍOЍ/^0P/ss@- 0P/~ss@- 0P/ss@-ּ s@-`/oV0" 000R x0F@0SP 7 00 8 0 00 0 30 Ѝp^^EG7@-@Pe> 0 t: Ѝ00p@-@PQU  R 7 0 0 000p P P 0@- M0000 0_S @0 0 30%   000C S@ 00 0 B R \ 0C   w Ι 0@@%7 "7   Ѝ^P 03/1S@P#0CCP*//0P @o/ 0, `p@-P@=  ,0p@`P/ 0/,0/D4RO-4@` @4M0,00P῞Pƞ00PP`@@pp F  0VQ$ `庰 `   D  B;R< 3 0 < R0,,   B A ^<  F7 0  YS!` 0  WQAV@ 0V_. _0]W<o 0W@@T 20S )1 ,0 30t W*B( `'B  B  0N0 @R 0 !(p t|(``V 0 00  0S 40s A0@A4@AX55*WW*B$ `*B  B  0 0 @R0 !(p(``V 0s 0s 1401801X 4Ѝ^jLLELi_LLL;LLL8L80/@-@0Pp000@ 0`@X0@0000 0 0 30 Ѝ^/ 0R\/p@-P@㪺 0000p 0 P/@- 0P/A 0 @-\  @\@ 00 00h0pS0/P/A-@`PVp0W*T  E@5 pP  W:p0O-@M8P<`P` 0@ 0@0'0 X 0  0 pP0U 0P 0PЍ 0ECB~tT ! 3@#*T` >#T@! 0 0`0  UPY PEP  A `bP`>COGO-@pP0ESaWFq G  ]Q Ae  E!P0ES ЍC2`僑  V E *\* V*  EV*@@ 0` \ : C0 BZ:V :pG P\*MO-DMd @`0$p20P 0<000FS#Á['0Hɐ1 0 00tY I0 0F`FS1 <0 30p  C2F胑0 P ? P(  !000 0PC H0PY3:l0K  ` P    P   P 0   DЍOЍ/^A-@pP0E@SCaWF1 Q A05   EB!0ES1`\ *P*!\* \* 0 ` Q: C0\:V :pG PP* 0O-0 00H2S1 !01n @pP`@"82 BS 0B<*D”40C\LC1H`0#0(H! @@0#tSl $2L@CPS+ 0C L0 Q Q 4 0,2~?020D"<2~?@2D~/ 82D2 0D"<2~/@"82 Ѝ Q @2 S  0yy  I D"4媠 Q   B 2 $  $L$EGaL}L L@-4M`0P0,008@P 0 @6 P0 0TPP0P 0@  0 ,0 30  4Ѝ^LILO-r`$M 0@pP U]H2D"0@2@嫬 `    ^P0i P 0  \U 1!01߼x0` 00 0 00 P00 0CS. 00S(  (  00 CB\ 0  000 0`D0!$ЍO`v+PE0UQE0 A0q 00 0H000  SL0S \0@ 0<0}v VV,0 00pL$EGHLaLqLUUUULL 0C- R ` Ѝ0P ᚌ 0@pP0S0S a` Pm (P 0 BRბ* T. 0 0S(  (  00 CB\  |2 0 P; 0WpPap P? l(P 0C?S@%. 0@0S(  (  00 CB\  @ M2 P000 0 R H0D 0@@0八 G(PC(PP 00 pgL$EGGL@-P `0X`S 0CCqS0 00a @T 0 000pLp,``QV P AN K 0`0 Ѝ0 0CCQC!:P, 1 <0 00X !xPRQX$EGLaLLXILp@-P" @ZJ s 0@0pLO-M@P8򐠙c0D 000 0P0!P&P 0@ S񟗫0DTl|l?PR !?PO ?P0 PS PzD00 0S1:!01孪 ` `0CV`- 00`S(  (  00 CBP D0 0 @`00p嫍 [ 0``00Ѝȍ Ẉ0@ PS P $00p0 p0᷈$00S$ i_4LL$EGaLnL LA-(M0Pp`0$00@000S  Df P0 00000(00S $0\000 !@0 $0 30 B 0S0 0! 0(Ѝ^C^8,`A-P᐀@`pȗ00Sl0h 0dd0 {H pv@0ppS 0 0S00ЍL$EGaL9LO-M␠@ 0P\p`,P(* Q0 Q !ᆗ!R0* p @0S00SU 0S0 0 0$p! Ѝ 0p 0Sx0t 0pp0~ ߌPP ὇0000 0S00e$P8,`i_LL$EGaLLLO-`pM@xP 0X u0S x0 ( vu P}xP guqxau0 SЍex2Pї Pܗ 0 Ju R !R&R 0B S񟗎(   @@@h   @h @ ,,,,,X h (  h p ?RD !??R? u돷 vP uRTPh ជP!PL1H0 t $ t  tt<7 2  ,  @  ឌP| xt 4LTLL LlLLL[O!gYGT3 LLLLLLL L L% L^ LS Lj LO-PĠ`p@T0 00O V 0S wlvtY qt0 @TV Ѝ ct L[O L$EGaL L LO-$MH` T0!@0L  PXpAP Q@T 00P +RP HQ@T@ӧ 00R= ˇƇ`‡`Fa`弇0ⶇ`ⲇ`Fa`嬇p`⧇@p⡇p`✇@$ p喇@PE(@,P0 0 30 $Ѝ^8,`(!LT!L0Gu8,`@-0 @ @-01SX0T 0PP0刧 @Hy01S 0x,Ѝ@x x?L$EGaL!L "L@T[O"L@-01SH0D 0@@0a @8x01S((x$Ѝ@x?L$EGaL/"Le"Ls"L"L[O 0`M !0CCQ*P//@-@P@A-@R`0pᤁQPEEQUE,x(Ax@P`|"L"Lp@-n0PaAV0p@Pp!0CCQ7#/@-@RP@@-`Pp@IP T T@RO P0L 0HH0ݦ @MO᱔?00 0 Ѝ#LTaL"Lp@-P``ʱ @1!@0CPC10pA-`Ppḱ @!0h0x0|010C@C10 0`dp0 01 P01@-<0@ 1 0Ѝ Lp@-P(`V 0P Rv0 43p@@  tD0pi_/#L4O-$M0000SP4 0 30 0@ 0P `000  L0H1QaP [40S፴ @ Wv 0P`p00VPW  W   BR񟗧 \D @+ PQ<*P Q 7*Q4XttB d R,*B 5  B G ` +      <20Saڅ@ u B 5 *B B   Rp! BB!P Q7:1 R  u T!ϠP 05Q7:\1 R  u DU!P  Rp_ B  RR*1" Rl B B    4 B  B 40B0  .0B!B  B  0B$Ѝ^i_v#L#L#L$LA@0@-<< aP Ѝ@-`R@P" uP"u P(u$P.u(P4u,P !SR5 0 00 uP !SR& VuP !SR Vu P !SR VuP !SR Vzu Ѝ$LTaLM$L- 0@0  D0H0 000  00-\Mp\T  0@0D0H00 00000    0 T0 30 ̏ \Ѝ^s@-`0@P -0 Ѝp$LO-`$M8'(X㐰P  p H LP@ -X5  H'R1 !! "0"T""<#p####"#` ##$0$$$ <##\%8%x"#P$$%8%8%\%\%\%\% ?X* ?XQ ?X{   !?X㑊 0  [0S0 " 0 0 @0@0  0儐0 0 V5 0_`@@@ 0 0 ፂP /0000S0 SXd0S00 *40SYs hw 0D4 0 30  `I@ 0@ 0@ق 0т@`%0@Q D0 f{0 0 0 (ӑ0 0>0  ` ᦿ00@0n`0 0ሂg  ᤿ 0i; ᇿ) $0 0 $E 0 $ 0 $ 0 0S0 S 1!01  $S 0 K !P0@ U 0@@ j@ 0  * 00%X0 &X@0 !'X 00S 0@ (X@0 0@$Ѝ^$Li_%L LFfL$EG*L$L0@-MP(@\0@@@ Ѝ0O-P0,M#@ $ `000 FQ R  2 $0 30 " R  0!R R4 RP:ʲ(P?PK  @'RG((L)`)(((($)@)((p((p((((((p(t)($)(p(p(((((((p(p((((((0[ Rd R* 帏/P P :,@ BR ǐ   R  `| R .  /      p,Ѝ^i_\%L|%L$Ll07@-P000@  P40 0 30 @ Ѝ0^00 R 0  /A-@ `pP0 O ,1#3 0$ 0 0 0 $  0O  ЍA-@ p!P 0 Pe50oO ,1#2 0$ 0 0 0 $  0xO  ЍO-@ᬢM`0S P"pg|ŸVx2( 0, 0 0Xem 往P<20S0"QP@#@0( 0@0Ѝ R00S 000S 4PX00SP&0Pc 8< $ Q\( R@PUP_oR %00! Ap4WpX "!0S  !_g0 m p00! PP1-QS(PDpH`4媆X0X S000# 堆 0bXA0PS`0 0咆X0400D0zV8,`!gY%L%Li_%L&&L s@-@!0A 0q0a0p`qP0 302 0$ 0 0$ 0 000c00P0U00 ,00S0H00,0Ѝps@-@`00P00 0<40P0P4PDPHP `P100S,P0(0@PЍpA-@ 0$P    S0 # 2s0000p000S`FpE 0A0i_S&Lp@-@P0 p@-0P , 0A- ӂ Pp@08 ``& 0  0 0 0@-@-@-0S@-4M,2@(R 0,002 `"$p00@&f2 !00@.f1 a0$101 @01q01ag1 $01p01`0(0@ @g1 $01a01@0,0 @gp1 l$0d1a0\1@00 @gH1 D$0<1a041 @0,1000]f 1 $01@0 1 @0101010Lf1a-a ~a za 0 ,0 30 4Ѝ^8,`\;`&L&L;`&L;'L-'L'L+(LxC_^tC_x(Lm(LF)Lj)L)L)L*L)*L[*LP*L+L:+Lb+Lq+L+L+L C_3,LhC_Q,L#-LV-L0 L LT LL L7@-@P0000 00= S  P(Q @ },0 0 30 @ }]  Ѝ0^ @-R@ P 0 0 0 0 @-@EH@ 0 P/0 @- @0T } >08@ @-@G60F40AJ@ p@-@0M `000P~01S0) 0000{ 00 ` P @ S,0 0 30 ̉ J Ѝp^ph3O-QMPp1P @-S0 V J RHT4V?00S;Jߍ^i_4L5L4L:5L1@-`000@0Pp^zP  (u 0S!00Q3 0 { 0 1 0[!0 j[d0!1 00 SS0^0C0\0 00  00!0200S101 Ѝ^(^0p@-S@P pw 00p p@-R0@P S pS w 00pp@w0p@-S@P pw 00pO-@2TMp0L00 0 P 0坲P0  (( `P P- l@p TB0@ B @R*` l d h@PR0Ix  pBA\ lh B B B/  0  1  0000 S$ruP yP t^uP tu 0S ttuP ut  0 00"52 S [P 0@(wd0 L0 30 P0S22S w TЍ^_5LO-`M0@p0 00 04P[0 0 30 € 0  000P 0 Wp`Ѝ^A-@dp`,0PS  ڂ 0 00Fa,6Ѝ8,`5LC-0l@`p,0PS  幂 0  00Gea, Ѝ8,`5LO-M0$0<7 0000 (0 00,0入`000$0x0,0|0800(00000@00H000  0P080X0 C0Sh0 Ckl0Z:X60S LphDvXBvW| 6 0 30  @ @pW 00S񟗤]]_^4_]p_4^00W:40 yPh40@P`K4  40@Ph 00W}:40 y40P`4 @ ް40@W0#03 RppWR P0g*40SŔV4  °40@iWP`Q:4  ᵰ40@04  ᫰40P`@W=:4  ᡰ00W.:40 ]y4pP`40p  Ty4@@4  ᇰ40@.WP`:4  z40@!H30SH<:P`0VU> 0Sp0S20S$h0l P`00 001S 20S d 0xS L20ST h@uX>u2 XP 0⧁ 01Z :10Sp }p0! p B⨡ b2>1<"0 0P0 x @PP0 x0 p00= 0 0[\hX&`0S00S EP0*00SUT X\ 0 hl  P0Sc!x1p00Sp$ $  xЍ^i_5L6L5LI6L6L6L7L27L^7LO-4M` @%pP ,    00 S900= S0S 0X (0 , $0 (0, 0  "3Q.L50S0 p0 Y`ḡ @'c0 4 ,0 304 0~  0 "Q1PS 1S0 S !SS 0CS񟗥hgfccccccchcccccXgpgS S 00 0IS *<S 1S 6SGv@{00= S 00tx?Sr GSo 00 0iq1 /S0S 00 0S1# ]jS TS USV!q0S 000( 0 SPF 0 0HnS  S>u:0 AS'S S S 0 0u *(0Cs01303tu0 0nu0SuPuP puP YKGv 00 0Av 01 001S0S0S00p0U0SX0S0%*  00Au@ 0@0 0=Sp1 /S0S 00 0S1"Tu 03R 05 03 05:tQ pUX`"QXp @a08 }4Ѝ^i_7L7L7L\%L|%L7LO-MPp@2`@000q1S2"020 2o  #T% IuP! 'p1@010@ x00儐k 0 S!x{ Ptq1 P S $1 @0A1X0 p@h00 01tP01rP.0 00N 됐T㔐00 !y & 6 k 0M0  r 0 0 30 \| Ѝ^dh(8L$EGaLf8LA8LQ8LO-|M04 80L500t0080 S 0005 t0 30> 4| 0CS!( n(0$ C0R $0 0 0( S 0$   B 0 08 40 00a4P 0S*000 00 00CS! 0n0, C0Q00 00 S,00 00 00 0 (0 2#0 000 A    (0@h@P00P 0l@T0000p@S0 0S`D0Ah0@@l0p0lh`0pHGBx`Vp20Sd 㶬d0Tp`F+VH20S@d 㤬d0p`Fp0l@L0T <0@0@0 0D00H00l@V @T10Sڼ<0D0@0H0h@DDR~u{hqk U0!03P>S#*~u>S# T<0@DH <  <0X@@ <0L0C <0h02l@p0XP   h~q P0C 1T @X@ P   0 0 004 00 00 00 0P|Ѝ^̄i_8L9L8LOG0p@-P00UpU@ kP PpO-LMpp P !P D !  \ 0$00(00`@S P 0S  0 H`0S  ,yp00S , 0C0S., @,`A 0` D0 30. z @DATp`0 03/0 3/PpD`pG@, 0000S ,0 0 0LЍ^\AA07@-@0000P0/QR d  @t m(0 0 30 8z mU Ѝ0^*)Sp@-@ `nPPd00Spp@T0Sp`tX0 40,00S0H0p@i_%LO-M00 40080H70000000S 0P 00000?o20",0(p$0$0Sm0 0 H0 0A0S \T/n@P  g u0$ `#R``V S\60SP@H4!0@SH`0p X @wPyhyyyzzv,z8z`$00VD `⯪D0@D ᨪD 0 pR0C@Swxx y00W <50S40S& @0p<`$0$0S4 0 306 fy  D0 =sD0( `@40  S,80H0   L0X0(0 00,00``V ` D D KD0D  DD@D <@=D  @ <0墪D 0D0t@0P00H0t0WD 0 DH@0LD 'D0P`@`00`0A t00S00;D D0H@1D D0@*p00#p0&H*#@0 00L&h0l 0 h00l X0@0SD @ @pNDp /R( % P 0  @I@@0 /SR 0  D;DP0Hp 0/S 0P 0 PH'H  PH@kDkT @k`HkDk@k 0PL2(00 000 0( P'0L000/S000R0,0000P rpP@`<@V   X0 R%X0X0@00Ѝ^i_@9L$9L*)SdLA-!0Mp@1`PH 0,000R0 RxQ t hO ⪸P\S@0 A  P⛸WPp p0 0Pp   P$Zk Vk0 ,0 30 w ,0 0,0P 0k0000;kj 7k 0ЍXp`^$QLi_@-@0P`0 0000}0S000t000S0  0 00h,0 0 30 w  Ѝp^Xp`O-M 7P0|0001Sn@$ !$00S ` `4@S4 L dd L 4  k  0S`-\ P &\V  ~ @P @00i 0S'5(0S 0%倄  00 V 0 !PRl0 !085 |0 30G v `J– p@```pA/ ` \ 0 aaaaa$a @y0pĔd`$V )0 !\0S :4$04匋 [l aItP `(00 AtP `(0(0(9tP4`(0<0` g!0R S 0S 㷙 1P岙 0 G Pc0pd0Z P\ QR:(3#$#0 034 $ sP ( HP : sP ( \d 1 sP ( px ( sPㄠ(    sP㬠(    sP ( X sP ( 蠄 8 sP( !R:1_!01 $ sP sP sP sP㘠(    sP sPԠ(  P }sP F}`G (0S 0!A (0S P `P 0 ll- 0Lo 4m k  Ѝ^*)S}9L8,`9L9Lm(LTL9L$EGaL9LtL:LLl:L,LLO-4MP 02, @0,00 0 @ C 000 0P$0(,00040 X s42,0S  0pb2` 0 RP 1F!01C cZ ` 0D` l`  t7  pk,ip 0,00 000000j 0,pS  0 00 0pX:0$00 ,0 30) =q ( OP s,0$ mh$0$0g00 ,0 0p  4ggg4 4Ѝ^8,`-P.>L3>L>L$EGaLQ>LG-p0@1`4 0 00 0S@ PP 0   0SP:l08 R8\ yP@ H0 0 30 p 0 00UЍ^O-,M1@ᬑ0$000! 0S 0!R!h1 $0 30S p p 0\@`P`` `XPPe0! `0  \0[0`0`F(F@0 p` 4  40  eu ,Ѝ^d_h`_s@-@PeP`P X0T 0PP0 P U0!0!0 03/Ѝp@h?L$EGaL>LO-@`0V 00` kpFP0 0V00C0Z JX` A `QP   OGp@-MP(@\ 0 ` 0i`1S MXT0 { @0S X0\T 0PP0僄 }e ` ye 0 0 30 o Ѝp^N$EGaL0?LC-`l1MP0000S 0p!R814!0001W 1S030m00ybp00 0000`( ) @T 000P@x0 0 30 eo p` P T 0e@  00 0Ѝ^?L$EGaLv?LC-@` MP2R0000j !Rg P 1 0 30 ,o  0ЍCzp0S 0!Rx1t!0p1p׃ Pd1P!0L11Sm&3ap`0x0 000tP @T1S `00P "P  0@ d0 0 30ЍAT ap`0tPx0 00 @^?L$EG?LaL,@LO-@`0V 0000` 0jpFP0 000V00C0Z JX` AT `QP   OGG-0MP@`p000W:0 0 30 jn  / @(80 <ipccm Ѝ^MO-PM@00(64` 000\@@ 0L@6/``V' 0 @@ @@@@ @$@(@,@P S\0x`t`t0H00<0 0D00800 1P `PdL5 0 30I n $0S  4i@P/  x 0| d  pt؄7/h0S) d `&X00T0 0L00@00p0tP0|r txc!18RD`@pL@ D4|@$0<<4倂 rtxci {c0 000 -T H00St 00$0X h0 00 10 10CS~<`d/pl L G  B 0t `{t@ttl@-c 0h000$00(00X d @tl t@2lpc0Smdsdl cd{P>cf t➏`0(0,0r@,0S(P P  0`S 0 0*10S ᐐ Pፐ 1!0CC1P:d10S\0 0$'0PP0  0$01 P100P 0((TtOA0P0T䱊 01t1AA t>d00b0 t{`ttxbqЍOЍ/^L8,`؇L=@L@L$EGaLs@Li_@L1ALO-`P-L1$MV@i000 i?p0 ,  Z 0 o`*b0S0 0 30' zl b`p 0S:`,  3`W 0 V 0 0  0@at $Ѝ^O-tMpP!t2@ᘐ0l00`2(0S n`n08"88y np0  W:1 l0 30w $l G p0?00$00eH0S ( $(0(Q$0 $(a$0 D 0   $ @ip?C0S, ,,&,$,`X0Q$`h0, $S  P 0 00哀 ,a$ra 0S`,a00S 6 3 0  0 D2$Ua}tЍ^8,`0LcALm(LBL$EGaLALi_Q1LA-P0@0 0000D P00A0qaVfD 0 1` P P000&m(0 0 30 ik  Ѝ^0 S 00/fO-DMt2 0<00 R2X2@T` L2 RD000803/V'`W PG !/o  b0 gU$0d$@P( 0`)WQ1 <0 30[ k 003/PP0 03/ pX P! 0 R0P04` `:R 0 00 000P 4`0P0 X  0PS 000P 4`j0 P@X 00@4P8$@( DЍ^4`\AA`Q\OK$EGaLBLO-IM @P 4 0100L P00Q0! T>X@0@ C x@C@@@24@p8@<@@@D@H@NL$LLD0$P@0 `C (1 0200 @S0 0CS9 S1 SP6@H0S` @D@0L ,u P"@P@P@ |P00C0 sP@mP@ 0S pW4@8`V PFE!/o b @U~@P`Vn0 VvP@14⧾LQb1 1 30w i 0s @4╾L?b 0 S03*Z 0 2Z!ᦉ 0 V v 0Y`` D 0 0@01D`H0l,@00S 0 03/0 LP3/P 0S 8<0Q008 4T3/P@ 0R %"*pXW HL13/PP 0 yIߍ^OG0@-TM@0d0000L00`0?o2 00QU a0$00(0$0,0(000x00 400@0 0D00H0@080H08<000000 L0 30 ?i TЍ0^0@-TM@0d0000L00L0QU& `0S000]a0 00$0 0(0$0,0|0, 000@00D00H0<040L04800040FLs@-@ P  UQ  0b€0S0S ЍpGS1S A-`PpP@[@PD00SFgPD 0`H0 Bi_FL@-$MH1`@p000000 00P P1 1PU :z UP 0P.S0/S0S000 0 30 c ᮿQ 0/SQ? 0S00 $Ѝ^KOp@- Pn`@P y@00= ST {1 P@pp@- @0PdPp vp@]A-`@%P UL 1Lp`W"  Q P 0=#=000000PHP P 0?0<<0000VW `[#P4PL @"PH,,|,,0 ? #   #100P 0 P 0 000000 00 0 0 00 UQ0?03000PPFLFL@-8`0@P0 00X RP xZ  P0 0 30 b Ѝp^O-@1,M␀pP` 0$00P  jP 6 dP01 $0 30E [b @ZP :Z0S! R*^ V   zZP  PPU-PZP U0S 0 0P ,Ѝ^@-P $M`@   pP0 Q 00 2 !  Q 0 2 ! 00= S X0 0 30 a S.S0 `V 0S$Ѝ^@-`,!4Mp ,   @P @P! "! ! 0 ,0 30* a @T P .P 9P P0 qp P 101 "R 101!0 q@4Ѝ^p@- @nPyPp p@r`2 A-p0000`fPP09S&@pY@P 08S> 5S0S!#41TP  U1 0 30[ ;a SS"tA4C@`1 0 30Ѝ8S@ (S 9S <S1T@T 6P @/PUPP Y@P TPP@ oT TX@ cT:p PT*0P:S@ЍAX ST ^5JFLFL@-0P Y04Sp@- P<@P YP  P p@Xp/O-M`" 08,( 000000 0000P/ ( P) {XPwX(0@p0SXP @ p 00 $00 00P $00@p(%[,@Tp 0覼( Ug@P X0P 0 S@(T 008H0L0D0 0p000t0(0x0,0|0D000P00p0P0 C0S`0 Cz{b0Z:H60S <`TVPRVD,@%*u@ @pW 00S񟗦|\(00W:40 Y8`340@P`M4  40@8`00W:40 Y40P`4 @ 40@Wp#p30S00s0S0S P0h*40SŗV4  Ԑ40@{WP`Q:4  ǐ40@p4  ὐ40P`@W=:4  ᳐00W.:40 oY4pP`40p  fY4@@4  ᙐ40@@WP`:4  ጐ40@3D30SD?= pP` pVU; 0Sh0S20S&`0d P`00001S 20S'D广 0pW D20SL ᩿`QUPOUD}UA P_0a01Z:10S Ꮏ긱P1 C cS\32P 00P 0080 X @`80 X0 00 0  0U\`P7X0S00SŭVP0*00SVT PT 0 `d P0SCx2p DU$0 0 30 ^ z{Ѝ^i_5L6L5LI6L6L6L7L27L^7Lp@- @<PPp GopA-P @|`PVpP10S 0PVC VQ 00Sԁ 0PBC 0 00Sā 0P2C \0P 0 0000Sᰁ 0PC i_FL8GL~GLGLp@-`P@ 0(Pp400Spᒁ 0@C p@萾i_HLp@- @2PP ^VP \ p8h00S" Tw0S0Sp1100Si_AHLH1C-p000@ 8PP VP )V0000 0 30  ЍU`P 0 0 30 ] ЍC虸UP P Y00(⑷`P00P0 00 00`00^A-MP@0p1 000P`1 0 30] w] U`P zP Q R #R ⛵P \0s  \RQ 0 @AOoBS@T0SS #S zP @ 0S Q 0S lP 0 001TN 0 0QP 0!"20S000 0Ѝ^G-P @ `P 00Sڰt`p|  pP \00Sذa`Pi 8GkV  Gi_jHLHLO-TMp`x0S(0|R04S,0xL   $L6SH&0D6D|q R@P 0 000    U `8 Q0S@0 S#,RS R#,00` 8RY#! * 21QQ TP O 0[ :Q ؼ 22S0tS?TP3 OP $p ^ K^ 000 0 00 00 00 0U 0#QPI  P @ 0  p 0S  ᐼV``` &0CS`1 l0hd0SP   x 00p CBP l `h  H048<0700O0000 $0RQ 2"0200 0(0$00  p0t $ ]^ 8R088Q00( 0000 @S0@U@S@0S@V@0,0U  ˆ0S PR0S PR0S PRV ˆHA,0S P ] 00A]<, 0 0[":0 L0 30% S[ 0 0 0 0T $0RP x0T 0P00 0 0s8  JP 40TЍ^QIL$EGHLaLi_ILILILGJL8,`5L@-@M 0 0 S 1' !01o |0PS0) 00P S 00 00pqP 08 00z  `U,qS,|4 0    @0P0$0Ѝ JL$EGqJLaL KL'KL>Lp@-@0S#  1PP00p5SP N0O-WM9@P 0T100@0t9Qp)  0P0( !1Q0S  =   @P 9(0S } P~ 0(Pg 8 T1 30) rZ  q@0T 0吰0/S@- U# 0  00 0 ,0S L0ML0S8(0S ( 0 g ⁱM800SL0 000 LMM y @NPPLPg0PdPL0pU0 <0\b WP P(00U WPP(00M WP P(0(0E }WP4P(0<0= uWPHP(0P05 mWP\P(0d0- eWPpP(0x0% ]WPP(00d UWPP(00H MWPP(00 , EWP P0 CP(00QP00S  0`0 0S0 00 d5(0S [P [0|%|<f 0 0D0D0 SxLP `0Ԑ C0@0B40<04 00 0040 ?, 0 0SP 0`PpX0S40S| ѹPzOp$p`8pP(p,pP0(0T0,000803(0S | | 0$f PYO$@ 000$0SOPLOON LY0SP޴P2P?<0۲$0`|P`0(0x`h0,0ppl0800  PP3#03m 0S a20S4V| $R| `O| $0 QpPU 2(0S t" 0%f 0  PL00@000S( !RP" P0 C= 4 ,6 8 h1P@(0 S | P| 0!00Pe hl1(0S { 0\!e K?$10(1,10S c $ Och IO⓻O { 0@$a0{ P@E=0 00P`l I@ I Wߍ^IL8,`JKLgKLm(L*)SwKLKLXp`L,L4LL3>LDL$EGaLMLML>LNL2NLqNLNLNLi_NL9hLLOLOLPLOL@-P 1\M`p0T00P0@P C @0 00S uL !0 00 ᣱ@0@ @u@LP@XLVL<0 T0 30 $V MLKL? \Ѝ^O-4M3P0,00 03#03j  @x0`S xxp0VP$0 kNP II@ 0(b$(($0S<W  P*0S 2"02j P0S 2"0||2j `5%pu `Pp L"0JPGM^PX$Պ2 ,0 30z U  W$ 0夀8  ]P0@<0(Aͯ렠` |0 30 L ЍOEX> |0 30ЍO#0p̨`P` 'P00-=R S| 000 6P DBP0r@P0 P0R0m*D 00 P hEP 0 0000 0S< 10 S R\(P` A(p0 0CX 00S(  (  00 CB\   0P?X 0S:< |0 30]ЍEP| L"P }0@0 <0SDo  壬L P 9 P 00 R R   0A0p S= 4 P0 7 D 00 0   A0p0= S 0  00 00 P@jd 0P P X 0`p 00 0 p} 00 0S  PY9 |0 30ЍOnp᫧`P^z(` pP DP > a09 |0 300  00 0儰pၧ`P4"`  mPp Cp 3cP C?0!SR 0P'  00 08h(0$8$` 0 X0 p0 03*P &YZ` PW 70Sڐᚫ0 0YZ 70Sn 0/ 8儫Pp`P 00S b6 |0 300 ЍO6 00S0 `02000!K!$6 |0 30 ЍO5 |0 30  pḦ`Pk 00S`0 0 55 |0 300  pᚦ`PM 00S000 `@0 Pp~`P1/0  0儰fP dH0S _ 0H0 oWP QP> B`PG pH0P, B0P&D@0  Pp` / V!  p0o` H 0 p0XB0P kB 嬹0 P00%@0P 0 00  . `0000 >6Vp 020STm . T 0  X0 `&ɥ`P| 0 00R#R R RR  B 0  0` 0 K@R 0` "PA 0  /00 `pP 7z00 PQ Xm0[j >`0>``V08`<[0 0 0S`` 0 0"V00Sl 0`.. 4忩^3yHIXLFLXLXLaLXLYL8,`CYLYLYLZLJZL|ZLZLZL[LJ[L$EG[LG[L[L^[Li_[LV 00S l 0`. 呩Z X00S l 0`- 偩 `PZ0000` 1!pC C!0cw6sb`vp[ 00  '> !> 0[ 00 0> 0>`p0c Q`P C@0  .pP^ V 10S #l 0p- 4"@0@P @BP0 P00 0`V0`0000 `X` =80080Z00= S =P  0eP @ 2 0 V0 000000 >ApPN :P @뀁pP30S 嫨 000 e P _@P  s@P, P- D40S|厨 0JS400= S/] P) P@P 0'S!d(Cp%C 1@P E@000p0d  t0phB dB [ 0Sy00= StWr 5 Pm P5%05ypsB dqB Z0 K`(Zp0  -0 z `W00C?o20S P P000 `" 0 R ! 0= S y`P :!1>!R0 ::` khpP 0Wa7 |0 300 t |0JS@@@@B`BB|BCCCCC>tC,B8C0  -,0  ,0  `, 0Ƞ00S3S:@Z5 X Z! 0  00Ꮶ 0S:W0 0X(p0  +`0J#0(0꒙ 0S`  !.R Q 0`ꂙ$0@Z X Z00`0J#08040v  -,0  00@p0 ڤ0W0==C?o20S ڢPp000-= R S00 R0Sp0   +f00-= S R0 0  +P: |0 300 0 |:0Sr J l9!1>!R0 * 9 00 S+` 0 - R   0 TpQP P@PRP( PW`0S @ 0(ģ`0 +0`0 +sp)`P y,<0SڃI@ 咦  P `b>p \>pA-P1`@0 00p9P @ 0 0 30%ЍP0 S8@ 04t00S P琀XI`Gi p*0 <F(0 0 30 E ЍA͢^i_[LO-M␐P83@[0 003Z#03gZ UP`q p(=PN N000S0S?#p0CS 400,0SP  P @ 008 CBP a04 0 000t80 S0 0000S00C?o20002 0 30 OE U8p8P~ p  =`P 8 7`P  gP00QQ 8Q`  !@P `=P4 t=p`5I=P Ǟ@ ] ү00@(=@P ᴞ@ J0070 000000Ɵ=pP pɟ`ᕞ@ p `%0<P 7 =@P = ePAHP BЍ^\L$EGaL*\L\L7LO-2 0  P  c  OhP > 0  P  K Y PM> 0  P   3 0S 8!4 0! ,! Q^00 (p" 0@S 00Sg 喤#0CS(? 400,0SP  P @ 008 CBP 4 0 (0 40 30 C <Ѝ^ |Mlh|i_\LG-P `@ p 00S 0\ c  0G 0A-P@p `ŸP`  0P <0 0w 0AA-Mh4`@0000p0-= S R00 R00S*0S8S0  S  R! @PP@PU 0I `30SڔP  Vۣ|S+ sP_;PPX 6P,3(#0$$3X : UP 0P:S0 @ B0 啠PP 2 0 30Ѝ0.S S S  0PQS S `yS S9S <S 8S0 @0= SE P P00= S0!1R 0S 0 SR0 p @WP` @PUz 0.S.hP) H0@03/PPP<6UdI@P  P > @; 0P@00S:S @ PP6뿿 00= S0.S P H0 0 30 B ЍAI 0 n f^i_KO]L!gYc4L$EGaL\L`QO-5M@P`000P000@0徠ZZ Z00 ST 4 0 30 OB P@00S !23 P d  4d0p0h00l0p000S* P 0 㱟4d45Z< P0000Y S  l R h000S>ST Pdd / BR|Sd I P 30Sdhb .0/S H"0 "8pd07/Q  Pl20Spl?P 0 000(00 `0e 0 H (0dpd07/+ R 0000 ᇃ00S VspDx : d4nX"sp04 V0dZ$z$P o0d[< h@P*0h Z,@d  0 d@00X 0 R0  0 0 R00  d%h0T44d \ [ 0.S ZЍ^1SVV@RNIi_N]L[]L0S!gY]L]LRG-p10 00P0P 1 0 30 A 0  ЍG00= S @@`0  %`P00 H003/PC⁁@T@000SXP ၤ@TP  P 00S0E>20 00 S 00 0 S6P 5 %05Y    ?gXD 0(0P 1 00= S 5 p4 ,0 30 O: |4\$0d4P BP Z  ?900= S0S 0S 0c1 2S YX`X P} 2Pz ~!0 {01SX 2P 0 12S0  01S  $$0S!00!0X`4V4X`0?00= S0S 0SXn2P;P 0t"1 2 S `2S8"0@2I2P  IP X`f4VX``4` 0 1 0X4$R $0S!00!0 P  Q P  0SB 64X`0 V0= S`0-= S R 00S  0V0A0 0 _P  X` 4V00= S 0 1 0C0}0400Sگ<L徙P4Ѝ^i_cLO$EG*LYcLcLcLaLcL(^cL dL0O-p0P` 0儐0Ss @ "D(@DP 00L 0P 1배 [\nPWM0  00 0P H10 20 P 1P tP^0 Ё00-1 kP 0Ё001J1P0 04P 0000000 Ѝ@04S SppK+pP  P  ?P 0  e0 P00100 p 0 qP000! 0P>Q0 R? R0!0P 0S n020 00 00 00M !gYpdLTaL6dLO--(\M@9000 00|h 2PP' Q!`P(p .`P q0`Y8  0  Q h `0 r 0 TP8 00 30' 7 L2M p04Pt80Sp\[ 0` D[0\0 X0 T0 0S !S P P PK\KY\0Xl0 S70S\K P+.[ 0P - l0PJ /P*P.J1hp0 p0 Sh0Y5$7 '07OL C00= SLP _% PH003/l 0`  !p`JhJz l 0`  !pJ` XP  R`P /P *!P:*50S巗P  000= S) P%`PP" H/P &*0S0 R0S`0P0 ` L0 H0 h V`0l0 s0MPK{-U0U 0 O#0!S&T h0S0PKh0 PKLp"( W00G pG     ` K@LP @0` K/DP `p$0DKF DKqp0P#6%0DKF DKe(`P0p0 p L00C#x0 1St0 `0 0t00YP7 ,(P 0 0 0 BRq0: 00S(  (  00 CB\p 0  !# x00C  ?001>h G +P  pPt0U: ]! 0 R <2P"0,2 K PK,\K⸾d   00!0  0P p P0 000P* +(p 0 0 0 BRს#: 0 0S(  (  00 CB\ 0 !r 0p 10 +!p & 0 p0(0 $0 l R.  $ 0 0 0   o(K^i_dLdL?eL$EGaLeL eLTeLܧGeLeLeLL`GA-P`@0)pP  ЍA0S0 S=(0pS0 S 14!01]J 0NP Y `Y 0P0t0  p`.0S =Y-0 =H 00000000000000000 0 吀   < -0 0=@S00 1210PS00= S]D  0=@SpsTP %(P0``F 0Fb 0CV %P 00`S(  (  00 CB\    B0BVB =:@S 0 4_D@S "04 0 r 0CC20P $(PH 0CXp $cP 00S(  (  00 CBP 0  0  BB\`"* 2 RPE  PU6 0pfP<PE 0 -@R   U 0 -@RT&  UH& R6Qm05#000P ,P PELP P ` Pp@PE}@W000U05# tP 6PE`FᬇFq0 0=@SpwVP $(P 0CV $P 00S(  (  00 CB\  P $0=@S0|(0*0CC1 SN $0 000= SE `FFq0z 0=@SpyP #(P 0CVs #fP 0 0S(  (  00 CB\  ,0=@S000*0CC1 S ,@@0 P02000!h00= S0S(($ S" 0 R RPP 9 P(P 2 P  0 0 R刖P 0@ @ZT 0S  S 0Cs0S53 *@P (@0   R P   P i PPU`{ 0=@S00 V40R0S<0P<0S|P @k H r`ꂉPP  P@T0 00  \P 0 @0S (S   P 0'=g-0  =B SR400= S.  0  ,0P0 O%P Y%P  00 R0@0 0P0  R8 04Q BR*(3 400 0S P , P @ 008 CBP 04 0  EX  00Z 0SQ0  00P0& 00 1 8 PP >0S=P ` $=$P $P 0S$Pꐀ` 0=$P?m/0?[A $P $P?n/0?LA (0 0v0p 0S6t&06;A 00$P $0#0CS *( g00 0$040,00SP  P @ 008 CBP f04 0 0 0 0S00 03w$P  00P 00$00$0P"000PE0U X5D%0@@5@  `P 00%$p 01 0U0 W00 1 0 10TP%  P0 A X X0S  D@px@ |@x`@ (0 0@0P E!@T 0S 1@!l 10 1@0 @T 0S  1 0 1P" x `dP @P x n0`SPU 30S O P 00SL 10 10S P 00= S 20S.  ]0 0 0Jd@  X@PN 0 /@S0S 0 0R!0PS 0S 10!S5 0  0S3縸P ᪸0 0S300w"00= S @0  p% I@P xP x  @P x P xPP 00(P@ !0,P2!0@ 1 P  OoUB@P@@T xx  00(D$a(ỆGЍL$EGaLjLKkL8,`i_lkLkLkL@O-,M4 P0$001P  Pp X0 0X0X000S S.R 30S 0N 0@N |0@0 0@L000 0T 0SF@`V F!/o b KX}ڀ'VsԢԲV0u0X 0S 0S@ *0 P:\ t*0qmSR P 0 !HSSY P` 1*P  `T] 1P00 S 0 SN @M l匊0 S 0S|M yM 0|h#-᪋ RP0S}0\M HYM  \ru 0WX0 " h0 $0 30 )  T ` 0R .SR 0S1M ,Ѝ^i_lLlLlLRlLO-dM1`@0\000 0儀NPp0 PJ PN  0 0 $0 0 $1$ 0 WY@%$(ↇ $0S$D0S $0 0$ 0 0ᆅ@ 0(P$P$,0D0PU 0S\0 \0 30 ?) 0P0S dЍ^O-MT6P @0|000R` 0儠0<0@0D0 Yp XPW[*=NP 50SuL y00 0(0sP ?PT50S\L !P < 5 |0 30A (  0 (  ,0000  ,40( 0p04W 0/0CS(8Mp0 ,000!02!0Z#pP H4D$0@@4_= <Q 빥 I#!pV0   jP  @P0 0Hw0 0R# P# 0 _XX 0S(8#0CS4000 SP  P @ ,008 CBP 4 0 "(l 0  }/0CS 0 HP H<!00= S GPH@H":S H tP Y 0SHvH T" 0 P 0$0 00000X000-= R S00 R0S!@$ 1 2(   S0S '0Cs0 S"23 P 0S30#Q` P 0S1 !  0S09S 2 0 00 000= S00!1R @0S  0 0 SR0`, 0SV08SS0  S RL PI L P`A : PV*0P:S`00 //` R# #0 ` @0SD0S .RQ H0@03/ P 00 0 0 0 H0 q 0 0 0  00 0 0 0 30 A# Ѝp^5J@-M1p`0000 (@@T 0@0P0= S09Sݘhb  00 0@@1 0 30H # ` R# #~0 `0(S P9P PP 2  U"P 0P0 0@8P .P.S 00- R00Sd00S=&`EF @Hꌘ` 0`LЍ^`Qi_(pLO-LM␀@\5Pp0D00 00 0G 0* cP" ^<w `P P$(, & " _ 0 Y `?8`P` 5P0 `P 0(  C  0Q030 S/S1 ###S'A0800pS <PDD<<``x0Cs R0S Y Ņ"  0=00P0 0 0 00= S  S@0S 0.S00ǮQ080p0s d"`6 c 030(0 0,00V03 0 R#O080 000⟮P  0R0\0S 01S 0 R 080p0s3eL!Hk6 R 0 080p0s!']6 3R0A080VC0Gm0?SB0 U0 D0 30" ~! 08000= `` Qp  < 6} PM @0   q0 $0 30 ` ,Ѝ^rL$EGaLqL!gYA-M,1@00001S@y@mi@v@`40 0@000j, p`W :P P0p p,0S @0 0 30  ( $], Ѝ^O-M`6@ 000P0 00d널Yd5 0 30e  <P AP# P# N!h0@0TA P0 P2  0?03 00000S 0  d   <PPU h0@,0p0 0 0 P0 0 0 4($04b2  [0 <0 ᳹`P X޹ P 0A @ 40NJ <"^<` =| d@  ᕹB` ˺@0H @ P"H$$L($R(* 00P00 040$0 (00z 0PL“ P@#?0 , d  0X PS00ӵ%sr%%0S%$%$@ D0 0KN0H P0N0L0  0?N0P 0N0p0\`ᧀPVH`F 0FaL0`C,0VJ0 P0 \ LLQL!: .!X !`P XP 6 0XOyPX⮒XQPP PQ@1(0S<< 00! 0 ᫢PQ<,d\Й 0܀ 000 @ `A 0$0 `0A0 0$p0CC10#0CXC1 00L ) Ѝ^nqLrL$EGaLqLLyX!gYXI8,`-P.>LerLm(L)rLs@-@0` PBLS:L0SC 0Q 400 0,,01 *RaЍprL$EGaLrLO-TMp 20L00[`~8pH0000405@00 @ m> 0  / P%p0S ` / p0S 8 ~~ ~ P ~$~(~ P~Pp   o 0g000,02# 002#$401(801<00@00P0 L 0p0 000 P80( C@H0 DH0(0: 0 P 0L0 8xhp,0H|P ZP"\0X 0$000T0 00S 4$ HL08xhH0!R 1PT0P0T00,0(@U= OP PP R  L<,bQP (@띗  pK P 0P K K P!@P K 0P@ 80D0<  0c  0X 88  00 R 0D0 0 C\= 0 4  \Ѝ^sL_sLsLsLLNtLtLO-MM`=`m0,107(0PS 8-88 t' 0@@9 (0S -  i' AT (0S , _' 3s0X0 1`N1AAu{ !10CCT:s0Xq@NsX1S (0S ,, ,' 9 <00X1S (0S + ' r0XL2S (0S + ' B0Xdb9 t`0@H0 5@@ @@L P@T@X0\@`@XJ@@@@!AA 1$A(Ac 0.0P00'000X00S0XPM:@z j0:`p0p PO <:(0S h*00 & rgk(0S  xPP 0x P0 - !1R 9)0 9- qi000  r0S  M 0 g 0S a10CSPDp`t 0T:`m~`(p040 00 0#><0  h尃0 0000 0x,ttPtthP0h00`000CrX `t PthtPi▨h@yhv`X.Е 00r;80t00x0500|1倀<00刀1匀00 @0<0Sa*b0P0t0`0N8 0 `@ 0x0P5ee`dt$0zP 0S@ 0$ h\0000弰 h0S l\ tx05eet0!R 1@0@d00`T4| |@ R  x<,bA| `tT⤚~@0@0; , 눁$1!0X:08g:40` dI`0P@S `1`< !0 R@H); 0``#; P; 0 , 40|p0PS@ @H; u0}, $ ែ0P0h x0@l1hat zP 0S@H: @`: 0 $0`L00FS @H: 00@ T PH: 00@0<00C1c00 @00< R *k@H: 4J$ <0@$ P50@ 00 00& 001S (0 @,0 P0ၽ(00PP0,0 0T0D0 H00uL00(0P,0P%890TtS⣙A0X0T衋 011AAr}d {=|J@1(0S !44s$ 6 410% )p1 `0d1p0p屨PAP 0(0S 8!U$ 0S000$p 0S 00 0 v H0 ,1 30  m Mߍ^8,`?ItLm(LuL+uLCuLȉLeuLuLL,'T':yLuL@L$EGaLuLAvLvL wLnwLwLBxLxL(yLT+`TyLO-@$M`PpE QAVpH`p2 wW pG w0EPES$ЍE  0 PB"* Z0* HR0:0J0C P : Y:`F P P *  P * Z0*  vO-M\8p,000WP@,L2S P5 8@0L20PP V,@0 0,0X05{7 0 30  'P5 `,`,X {,`|W0` 00$000(0S D'0@@V# >8001<0010@E0401S 6*&06* @P1S4 Lp(0S &+# 0@0D0H00q~w@PW xP  w@PDPRHP0!1( 0(0 S@PDpU`@ 00 0 Pp+0L  FLPUP`zp PFH0DpW0 pDp@GKR~u0U0!03P>S#*~u>S#7x     v v0Xp 0C 0@02DpH0GH"/o b  XwW0 W 4؀Q RS Dbvw 0LDO L4L 1010 0L040޼p0S LP 0 l LhA@LP @& 4 0l 8* 0$0S fLL67qQWSX R 0P0P  ᳗ P  ᭗ TRp(0S x"xD" (0S 1`"X$" (0Sz 1D"8" (0Sr 1("! (0Sj 1 "! (0Sb 1!! (0SZ 1!! T0X R00 \Lp^,0(pW( S6L2(0S NH!0! L˖0 8 /6@PU. @Ṛ@PLⵖY@P@PR@PQ W @PLZ=. , 0Ѝ^vP8,`oyLyLm(LyL$EGaLyL zL)zLHOG=zLSzLbzLkzLzLzLzLzLzL+`A-p@P`PnP00U CD0  CX0  Cl0  C0  C0#  C0(  C0-  C02  C07  C0<  CC?A  C>F  CM?K  CR?P  CW?U  C>Z  Ca?_  Cn?d  C?2025r  20dPHLPTX0 ᗟ%_S"2 E  }{⸹z yy w'v ⮹m⬹⪹i$ f두 L0dG-`ᆀ@PHqdP0 LPP3  0 PD3  0 P<9L t 3 `8 0P@0$%0 TH0D0@0<080,0(0 00L ph  D0H0P0T0`0d0l0p00AP0 RU RDPP r/͎ " Ɏ  8,`p@-@QaV$%_DS":   X}5{zc ywvtm ifLCp%6O-M0000S P`@n:PF y  0@ P0#  7 0S4 01S0 0S- P)0 0 6 &06W' (뱏 P 5%05I' 0S5%05?' 0P  f 딅(0S  (28"R (0S< Q4NT%0HL `P ̟@P 0 5 p5 4d p0Q 00 (0S:$00  5 4d 0= 0 0pL 0l40$0,\4& 0 S000= S 00= SቩxᏫ0S p0s#& 0 0|xP 0 0 PPS30n o 0 ᄠ 70 S0+0<S AS S 30P:5 @0 q& #00= Sᔜ00= S*0( Я 0 (  ,00ƷH 0  0s@ ذ: p r!D& 0 wP L_S0 0QQS301 P(00(0ʴ0,0 P(00(0}P(0 R(!00  00 0@02( 0CP ^(2 0(2Y,~ 42 04",2~/0" 0| D0 0 30 " ЍOJ0 0 30Ѝ^PL$EGaL{LE{LKLh8,`{Lo{Lm(L{L{L{L9hL{LJnqL|L+|L0p@-M00001S0# 00% @P`f~P@   0S  \H0 0 30  Ѝp@~ 0S  J ^?L$EGaLI|L@-}0 1P@p@-`}0PA1@DDAVp0 1`@-S`P  X00  ~@ PH0WD 0@@0F% $0S@t@T Ѝp@/ЍpI}L$EGaL|LO-DM2@P0<00`0 @p0(@0,@p0p0@8@(@,@4@A T$ P 42c0"0,,2% rp\  ,0( 0C ("4ܡ^`040QP(00000  0 t0@!!10CCQ:0S$ px}PT>" [  R R   B/o"RTS8 R 8  000000CS00X000\0 <0 30  S S$  BR$httDЍ^}L$EGaL[}Li_}LC-DMP`` 10<00|01S ph@0@ pla1`FFaT ,P ( l 0 t 4 | 8 ( | $ 0& ФP0 <0 30 u 1,@ PDЍ^ !0O-     A     X \ /@-@P 09 00! ЍjL$EG*LL0@-S0 S 0A 00! ЍFfL$EG*LGL@-@ZP 0I 00! Ѝ蕃L$EG*LpL@-@NPD0Q@ 0<0<u! 0S,0R 00ЍكL$EGL*LK@-@PD0Z@ 0<0<X! 0S,0[ 00ЍL$EGL*LK?0S PP PP/ ?@o//@-@P @-@XP$0 00! Ѝ^L$EG*L3L7@-@PCP00, 0((0! 0P190 Ѝ0^L$EG*LpL7@-@P+P,0( 0$$0 0P00 Ѝ0^L$EG*LL7@-@PBP 0 00 P Ѝ0jL$EG*LׄL@-Q!Q Q 0 00 Ѝ#L$EG*LLs@-@`PoP00, 0((0 0`3 P0ЍpL$EG*L[Ls@-@`PmP00, 0((0 0` P00ЍpكL$EG*LL@-QQ  QQQ,0 ( 0$$0v 030 ЍڅL$EG*LL1SAQ #$0C1Q*0! //᫪@-  ^0B0S0SG-@ᐐPጠ p`30S0 22S0SsSP 000S.  k`pi_GL  @-vp@- @PPopp@- @dy@-@,P0`0h0 Cp@-PP@P P ╦ PPpp@-P00@0R U ᐠ P 0``PP00P 0!P$P(P#8P3T@!^% `P0U C 1 IPPY , PX AF `bP`>COGO-Ѐ@IDAtoPAT0!03@p%*T` 2T@!#% `0U0  IPPY  PX A `aP`BOGG-`0@GA0T\oAT ! 3@P(*T T@!$ P 0Y C   ṟ pG W  ᴩ V A΀ 0㓤*@ꫪUUUOG@-(M0 0$000000@00 0S      (0 $0 30   (Ѝ^p@-@P p0 @-<a'fP@-@NN1NL^*nQ10* S1 ! O-@0Z 00 dgPJ`0U0 0 IPPY ' PW AE `aP`OG@-@NN1NL^*nQ10* S1 ! O-Ѐ@IAtnPAT0!03@p&*T` 2T@!$ `0U  IPPY ި PX A `aP`BOGO-`0@GA0THnAT ! 3P@)*T T@!#  Z  ᣞ pG W  ឨ V A 0㓴+@ꫪUUUOGG-0`P@Pp(0X 0R R@媜 P P(02l U p@-@0 11c P P^\ 6bS Q ^ !` `a 00C 0p\ >bSQ@-@P M p@-@PU (A pQp@-P0@0` P?c!PӞ 0St`p( 0 bP 0P10!0 $ 00! > _ G-l1Mh!@000 0p 6f0FP *0" P Th0 000 0 i 0S  06vf0!(pR 1P 0 0 0h0 0 30   P R ( <,bQ ᐝ 0~  Ѝ^iQp@-P0@0` Pb!P< 0S)`p 0 bP 0P10!0 ꍀ 00劄 맀  A-MT1 p000@06瓆fndP P' Y" 00P 0p 000 0ך 0S  06瓆f0!R 1P 00 0h0 0 30 d  P R  <,bQ  ~ q Ѝ^Qp@-P0@0` Pb!Pᬝ 0S`p 0 bP 0P10!0  00  8 Qp@-P0@0` Pa!Pv 0S`p 0 bP 0P10!0  00ă   A-M\1 p000P06瓆frcP @T 1 0 30=  !  @000000000 0  0S  06瓆f0!R 1@ 00 0 @ R  <,bA  T} ~ Ѝ^Qp@-P0@0` PPa!P 0S`p 0 bP 0P10!0 5 002 O p~ @-@P A} O- PHER~uDjk @AU0!03Pp'*U >3UP! P ` @0 B00 0W`pT0`Z  0 A| 0020 Ѝ>S @    0  0 000@0 0 00p00p0pOGp@-@`VP A| p(Pp@-@`VP A| pPp@-@D4(P `V P $A| $"pP]A-@`PpT(P0(@(0$0$0 0 p 00p00p00T0E!D!E00G-`0@GA0TjAT ! 3@P)*T T@!(: P 0       ( Vp A | (0㓔)p@333OGO-px1 PGQl1Udlj @AU ! 3P`)*U UP! P0 @  C   V`T 0"Y  0 A{ 000哵+ ЍP00 0J 0 0@ 0 0T  0J @!J0`0 0 ` 0 0`0 0T0JꫪUUUOGQp@-P0@0` P_!PC 0SW`p 0 bP 0P10!0 } 00呁 } | 0Qp@-P P@S A@D@DP pG-PQ0@ p BpCBUGp Yb`p  BR" AC{ W PQ`P\GQp@-P0@0` P8_!P̚ 0Sm`p 0 bP 0P10!0 } 00 7} X| Qp@-P0@0` P_!Pᖚ 0SY`p 0 bP 0P10!0 | 00 } "| Qp@-P0@0` P^!P` 0S@`p 0 bP 0P10!0 | 00宀 | { @- @Ѝp@-@PTp @֕O-(0S@`0Pp$(0YY  0S$`P`VOZz ~~Sz p@- @PPpp@8@-@Qx@ 40,00pSP  P @ 008 CBP 4 0  p"PPPt0T 0PP0 %=gP @  f0P ꫌L$EGًL`LLLL8LELA-@pP`ePPxw P0 Tm 0U` P0 0S腎LLLs@-`PP  0`2@i ЍpL@-@*t P@wMG P @-@nv P@/׺L/L@-@u P@SH P 0/Y Ld L@-@z P@L@-@Gz P@dL\lO-`3Mp<0|00 $00 P$48<sPb s@( ờ 0 ʙ  dd0l@4Sh R  h04 80d 0h0d0彖 <" P40<Pl08 <0dld@P'  Lt"L} d@0 Rd  l     R@ 4h 0000h d d⇖ L⅖  O4  P4 0 0 4000i6 0 S ύ 0S00 u@P 00`0 &0 000DY  T `0 00/ 000 043 1 0 |0 30 ~ d& L$ 4"  x QOy @ځ$gy ey Ѝ^}Q 0S/(Q/00/000/@-隗 oP/V h~ O-MP2000xy`By kp k 0 S|@- 2!01 0!S 1!010S 0S 1!01H`8PoP1l!0h10 S9 |@ TP0 C+ % ' ) , %(00孥00 l똀`p!0P0P0 (\>\ |0S| | |0 0x 0t00%SR`3oP 0 0 30 Ѝ^L$EGDLrLL֏L L+LO-M2H@`@34DPLPp  03P  j 0@P`0 @DT!0Е0!0Ѝp@-P`@\Lp0P/~ss@- dc" A-`tP @Pp  00 0@000W 003/,`da`O-,Mlp$`İP @U42 $0 30 !0x QPP᝛ P@[ P БqPP 1!0100{ P _#p(0C`S  4 044m 80 0CQ 4 ၞ 4 00400 0040, SP  P @ 008 CBP 4 0  m| 0PS SR 儠 @ 0 0 \I |!d00 ,Ѝ^TL,`ppTph|pYLO-\M<2@0T00^iP+wtk`)p 0{ 0!S 1!016 S !S&@|P 0U S 1!01!? 0PU 1d!0`1p+"0p%" +7"! 0  {09$0 000ᤛ 0ϛX0 `SR 0 00\ 0 p 0  pP0P 0 T0 30 \Ѝ^L$EGLrLL LHa`QL/O- 4M1p< 0(0 0q  M0@0  10$`80 80SS @0H0 0儀v0 @0KD0 00M0ⱱ00,SM  RI! < L0 L0@PHL0 {P: L00 S6 0 "ZP/D \^@P#0 000 03 P0@RP <0SP@L0 (0 30 | d A P @P` K^La`UO- 䀟MP0`0(0 00$@Y! pP# ܙ 00M⍘ z P 0S\0X 0TT0 V  (0 (0 30 1 @ K,`^a`БL$EGrLLp@-@PP*PppA-P18M`@0400p00 00 P !SR P P@1 40 30< 00)pT! 0!"0  000#~$"I* 0,0, 00 /P`"0 0004 0_P@P  0|8Ѝ^O-DM`00l0 (0 0儀0|0,044$00000 SDЍh0 Q0S 0S 0$13/P cP  p00 0S 4R 0 p0d@ T 0 0W:( 0W:@,0S @  @ܘ  0,⺻X3 p 0@3Wt 0S (0<S#@00.S 040ᷘ 40@ 8 <0 p`@(0}pP 0S 00 00 000$0S  ᷜ0@40 40P  S@ B/o" #R @@ <0`08 00@M 0TSq@t Pl0@401 40Pd80@ ` 0<@ 0000/ PU 00 00o00 0M0 `1 @@0 .R0LS: @$R@@T 0LS/-  @q@@m@k  @ @g@e ~ P  tyP  8@ <00 ` @(0 P 00$0S !gY__LTLU@-@(@Z0@輒LX^O-M8@,0000  = X0S |`4 ? 00G P0SDT0SAX0S>0S |8+T R;PPU  yP (00% P3 7 0 30)  dPgw弇U  V PPP  P PTP  J PXPP\Ŭ013/PP0@WW ( P  nt  0 13/PP0@WW  0  0\0013/P`$`= Lt`013/0P$00@WW Dg `00 $0\010 0F00800S |xP wxP  rx pPd00\\0X 0@ S 0 `a"6/V Q Q R# R! H0 "2 0Z0:( Z :W Z:( Z(p5:00(<0Ԗ <0 00 4ܒ 0\@H00HL0(0L 000000P 800 00 0͏ \@r PP.u @0D"!0U0 0\[^@0D@0\\⨯d30S m{\̫DM01XQ *FЍOӔPP0S`VlKp0S l\t+\0lQ R 0l p0 000e p0S(J'p t P `tl4Vt 40`00, 0l\b\PKlF UkX0Sh 1 0 30|ЍOpP 0`@0@00D 0D0S@\\Pt  IP , 0@\+P\KDP @P \Kl 7\KDPr @P 0  1(00S#*~u>S# F0 F  @0   @0W` A-o @0H20*1P0dPU00@L 0 0` +<  8 @ 4 <P RRRP`ZXBP8P B P\ P:^ pWPpp\8P \:L@^PR P B  R\ ^  P*^ ^ 8 R R B\ 0 P (00S0Z0S 0 0k Pm0 K^HOGRtdLp@-@Q`pV P Azn  p@vn P 003/@-@P jn 0$0/0- , 0/p@-PPVp@P pA-`Pp@4/@ 008/  P@P 0`06/@|/o0"ЍA$ 0`06/p0 kЍA-`Pp@4/@ 008/  P@P  0@04/@{/o0"ЍA$ 0`06/p0 0Ѝp@-@Pᬽ `00S 00CS!p@h$0 p@-@P05/p@0 p@-@0P05/p@p@-@P5/p@A-@`puP 0@04/AA-P@p 0`06/\` 0P05/A p@-P0@04/`wq 0C0CQS<D @3P e@' !p@#껯GO-@-(LM`0 P6T 000 0`0 S0``006/X ( `0C`00M0P0 p`` 0CCVCh :P p!p+C@X]( 0 #,5 00 30C 2  `0 03/0 LKL`V'@d \` 00 0p`'p0p` X <륵:룵``@\p(( 0#@!( 0#d 0\0 X0 D@ @0 0LKF#< +SA#8 @0KL0 H D 4 \ 0R H @0KL0 D 0'D X0 D@ @0 0L`K#< +S@K#8 pL Hp D 4 |\ 0 R L Hp D r0'0p- `0 000'P `P LKLPL P 00ST0SL0 L PD 00S- bT0ST` P`1 Pd00@`0S1)P 0T  0S 0P" 0T 0R0C?o20ST!U ۴@dh' 0 #@дP]' 0h0 X PP0 +S"P0\0V00L`KS I벴P0HP L0 @P0HP L0 (K^L/O=OLL(LYLlLwLLؓLLA-@p`崾 0 R0@000CS0 0A/P 0@jAp@-P@P ፾Pp 00CSPppp@-@y 00CS 0S PD k8@ I@-0 @ P0 ЍEbHp@-P0@0 4/@;P  ;Up@p@3p@Y&K-M`pL1 0 0 00 03/ 0C@00MP 0CCX :`V0 0 303 3   0 03/$ zP p0$ @@%@ 0SS,& 0M S Q   K^gHhH 0/ P/0S@o/@-@Ľ 00CS 0S S Co0@0|03/0p@-@P0 5/Tp@p@p@-@P N^p@R` 0@ 1 2 SQ\ p@p@(^eL0p@-`@P?P) 0 @04/l 0@0S* `P p@P 00 P 0Sp@!p@YA-`R@P) 0p07/93 0 R- 0 R0 80 0 p07/@ P!A  AI$EGy>IX>I x07@-0000  @P @00 0 30 {a  Ѝ0^x07@-0000  P @c00 0 30 Z`  Ѝ0^l0@-0000  r@ D,0 0 30 ;` Ѝ^@-M|0@ 00000@0@2@ ,0 0 30 ` Ѝ^ O-4M`@X0P\ 0 @10,00 CA\0  03/N  0p@ Rp 0CCT: b0 0000005  T0 0! ;/ 0 3/ 0@ @ ,0 ,0 30 2 O` 4Ѝ^G-@1@M`0<00P1`0S 00S |1 <0 30  `0 @ЍGs C(p 0A 0CCX:0@00$ 0 0 0    0 03/00$0 00S $ `000 ,00(0jɩ@0k(0 <0 30@Ѝ0`_ ^(y`O-@2TMP`$0L002x0S 00S 2 L0 30 $0x TЍOes C8p A@q 0S^ 0  |8ZP 0 *@_ 0Cs0S1!01'P @0 0CCY:@0W0,U(05 0( 000@04  008<@`   0 03/@0 0,0SH04$4 00<  ( 800 40@ P0C## 00 P0 *,P2^e(@@0 L0 30[TЍ^(y`aHI$EGєL&LLG-P828M@0400`0Xp(03/P00 3/ C (A( 0@04/ 09/@ 뗰 0SU g @(0 0CCY/: 0$    0x.S<B 0> i@ ?f0@ 0C !t/(^   0 03/(0 0@( 0 40 30 ^ 8Ѝ^LC-P`1DM(`0<00@ C0 Ap. 0CCW:0BP00$ 0 000 U  0 03/00p$0 00S $ X@000 ,00(0@0,0 <0 30  0 ^ DЍ^0@-$MP 000000 0 0>@&U PN C@00 0 30 ] $Ѝ0'L^p@-XMP 0`1h`0T00 H%P" @$-0S 00S 00S  0 P  0,0$    H @$Ur P @\0 T0 30 Q ] _^ 0S [b x^ v^ $XЍp^1LO-\MP2H@†`$ 0T00< CAC0(03/pGW0,0 3/<0 0CCY5:4< FL20 0<S(0L PH040,0H8PL 0 H 09/<~P  F   0 03/<0 0000(0S 804 0C #$8 40L  , H00GWP 3,0늤@0G p0  0D@<sd0 T0 30 Q] 0S a ] <b\ ] i\Ѝ^(y`1L'LG- Mp`St!@P@  U X x 0 0:/@n X V@T P@U !0 00 00.x0 0 30 b Q |\ ;] 0D@S@T 4a Q] O] Q-] J] Ѝ^/L/6/7//$/ / /Q/1/.////@-@Z @- @Z @- 0 喚 Ѝp@-@PuPpp@}0@-@0y xL@-@ Z 0 0CC10/@- 0003 ЍA-`pP@8/ 0`06/0 ЍA-@P`p8/ 0  ЍA-p`@P008/ 0p07/0 Ѝp@-P,0@0P AbZ %spL@-@WZ 0@-@0sbG@-@GZ 0@-@0s`cG@-@ 7Z 0@-@0rI$EGy>ICLp@-P@TpP o 0@-@0壞耞L@-@ Y 0@-@0哞kH@-@ Y 0@-@0踝L@-@ Y 0@-@0L@-@ Y 0@-@0ckH@-@ yY 0@-@0SkH@-@ iY 0p@-P(0`@3/ @!?  p@/<@-M0000Eh@  N]  H @ᒾc 0 0 30 _ Ѝ@-f^Q@-딥L0@-@:v @ ,`D0@-@/v @ ,`p0@-@$v @ ,`0@-@ v @ ,`h-MT0000D00D 3 0  0 0 30  Ѝ^l@-@p? 0SH@/D@-`  0@u,`@-@U 00@u,` 괥Ld0@- \0R R 0R0 8054 00000( 0 Ѝ0^( 0$0(g0(0Ѝ,`L$EGLL"LL0@- Q 80I4 0000}(P Ѝ Ѝ,`L$EGL>L0@-,Mt0@cc1@0S:ڌ1| p0S `!00p0@  @ow Xpjw (Xr @r (q(r 0D000S  (Xr @r r U sy 0 u B^ <ո=^uЍ^,`LLd_`o`"L1LQh0 @-@X0lpH@@'_P4 0D0BD0S@E,`L(GxL!gYG-M0Pp`0|00 0܀ 00 00p̠Y0 |0 30 0L 00x 0p0 0`S6BLT 03/L$@Ѝ^aIIV?I GP]`?I?I0A-P`pV 8s @P\0s s @ h< 0@ D0`3/A|A[ORL^L0 Q@-<Q, ^ 0Ros o!gY@-00 000@00S 3/ P:P j]_00000嘱区c]呱4K( @P?%B(0 0 30 9S Ѝ^,`$y`d^!gY0S/0p@-S@pPp@f -0s@-0000`S 0@S P  YN$0 0 30 Ѝp@Ѝ/^0S/000@-S S S<->00\X0P/a`(0p@-@UpX0\ S\0a`@-1uL@\@-\0@ 01 3,`LL -꽨Lh0@-@`r P Pr P @r P , 0(}0 ^VL2QLL,`A-`pP\L00 \ @Hꫪ 0P/( S @-S??UUU s@-`/oV0" 000R x?0F@0SP p 00  q 0 00 0 30 Ѝp^^EG0p@-@PQU  R p 0 0 000p P P 0 0 P/g A-Q2`M0\001!01pX @\p0G1C1S 0G0S2 HS, S0S   R , R W/\0 S\%R<D1P00 PU#,a,D R0 \` QH 0C0S 0S 0S ` PWTPP(0S  PU@0 \0 30 B Y/YR `Ѝ^H$EGL0L0`$^(00\ X0R/@-' @n/a`$^@-@M(P,`Pd!Q  \ R:( Rp*\p Up1R 00YP 00Ѝa`O-$M@`HpL  T d16`!0\\1P U) \ R㜰 T *PX02/0P Q: T Vp   YPP0$Ѝ  >YT*pQP T Vp   XPP0pP  #Y L$EGLbLO-P0@cФHsU 0 @ <0 80 ЍOw ЍO-DM|2@0<00.piX P``P0 370 8P傺 շ0|100T, 0P࡟00S81 <0 30d '   R tP:(P*PPEt 0 v 0WPK0 SPS7P  8p ᜰx, r & R  i T \X0 370X 8HPDЍ^hD_)LS2La`'KQw`qLALLPL[O0Q XF6a`LO-PPH1$Mp@000,Sz P H1`0\X@ T  00 m;+n P 0  du P 0S0 F0/00 0/W0 L0 0 30 _ @8$ЍO0 0 30$Ѝ^La`֪L$^G-0`pP0\X@@0DY00QQ P0 0S 0  \  Pa`0@-4M414A0,00(10S1!@٭偭 1!@QЭ@w0 30 $00 000P00@00垮0 $00A00 00000000?,0 ,0 30 ( ||4Ѝ0@-<^C_p9`L#!&L ?LP"[O C_hC_ LKEVdLL,`LЮLLݰL ^ȴL,"LO-P2#T@!00` U00 wh IPPY rr PX AI `bP` Ѝ>COG 0CH1@LP*@-7Q10* S1 !/ /᫪UUUp@-@,0P(a -p@Y!gYL[OoP0 / @-XLL,` 0,0/7@-@P 0 6 Ѝ0!gY L0@- 0  0+ ЍL!gYp@-P00 ,@ 0 ۓp@!gY-L[O7@-@P 0  Ѝ0!gY7L7@-@P& 0  Ѝ0!gYHL@07@-@0PS  0 Ѝ0C^!gY]L@-`P @00S@ @  0@ʲЍpC^!gYlL@-0  忲 Ѝ!gYLp@-`80@P ,@Ⲳ  p@!gYLp@-PD0 @@ᠲ 0Ȱ ðp@蒲!gYLLtI[Op@-P`0 \@ᆲ0SH S@ S88,,(p@螰!gYLٸL޸LӸLLG$XH[Op@-Pl0 h@a Xተ Hᄰ 8 (z p@I!gYLLLL"L[O0-  0/&///}@-@/H $!s@-@h`P0S 40S 3/P 0 00, 0((0PUЍpLKLT5L Lp@-P`m @m TDzh oppP/$0G 0P/( S @-S55$8q0P@-`0d\ 0X0XS L S @ S 40o0 00$ ЍL$EGiL5L<{PNLTLp@-PPPD@ P0@ Ppp pL<{PNLP/0@-S 0S,0( 0$$0 Ѝ/ Ѝ&L$EG5LL@-iHL// //@-P P0 00] ЍL$EG5LL@-P P0  00I ЍL$EG5L.LP/0@-S 0S,0&( 0$$01 Ѝ/ Ѝ)L$EG5LLA-`dpP0S 0S  0@03/ V` gH L@-0\ R P S D0]@ 0<<00S 0S Ѝ/t<{PNLT5LXLA-@XP H$l@p`P0S P lV`LLp@-@D`P000S 0S 3/UpPLC-M0@pP0 00`0S X 0 8/P P P Pl0h 0d0d`X0oT 0@0V0 0 30 Ѝ^L~L$EGL5LLTp@-@<`P0S 0S 3/UpPLO-P@`0p0S [ 0 ;/P P P 400 0,,0=Y ЍLLT5L!LO-Mp@P<`p0S TЍY 80 009/P LA-@.E 0Ѝ^$,==P]`b'Jd_`>S GGR R R000/L0/ 0CHC1@LP*@-2Q10* S1 !/ /988@-@P AC 0p@-@ 00 S   P3/ 0 000pD @-@p@-@`V0$0CC1|p$P98O-MP`   pn F@<0 080  $ 0`X 0CC1N$0G#P0ЍPE T@HI eE D OG98p@-P0`@000ჼsD pO-P` Xp#F@   $ 0`T0CC1$0G#P0 E T mI E AD OG98@-@\0(M 0$000 @0@DV(0Oo $0 30B  (Ѝ^O-p\2,M0$000!R' R02,"0((2 `!$0P0 00   0 Q00 P_ m0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 m ,ЍO^G$EGGL98A-(MP1 B0$0008aRBQ000|0> 0U0@q0  U   a P0BC1U:0!0000q G mL0 $0 30  0 P 5 [,C (Ѝ^98 FG0$0/0- , 0/0 0/A-@8`P4p42TA, )!_)H\DG[O 0@-0 R  -`bIP/W O-`x#MS8 A[ @ @e0SD300K$ 0 PUCЍ0DS0p0S0dS5 XS 0DS. tS* xSV`F @ PV0F0"0X0`XVf0ZpX!@0 @!`300 ` 0qV`F `M P Z `0?o2lVP1uV00S00F Pa0FSWF P?c&4 `0oTP8!PP  X T: 0M 0P@`0`0`08X$1 @?"`E R320Q 40AQ01@-@$ 2@LbQPEGVEG}M0P/ss@-C,0,Y@040S/p@- ,@P(p@-`!_dI[O 0/ P/0S@o/P0@/-SC0 @-\  @\@ 00 00d0P@-000:HD@ 8O(0 0 30 1 8 Ѝ@ ^lL-`O-@P0U 0000Pt YyE`0  000 PAAM`POGO-@P0U 00Pl YNE`0  0u qPAA$` aP`OGO--?MO M00040S x?xh0<00TOlpxPP<` ` !40S 0 40pS 0 0C0V9:`F7 R0P007 R00%  0f 09畉)   'f <<0R 40PE`PS  400C0Vg* >We 0=yz <0s40S j<<0S140<0[ 0 Y_0-0 SZ= ԝYl 0S0C040S -t {nP0<0 S$1<0l00=s 0S  R4-0ԝY 0S pPE 2}GWn40pvS S,0H%Ұ40S H,0 7* <0אSY<0s SH\,  R@0 0@034CSuh0HHpQE `FP 0>C SB B0>CSP0ȟ0Q90ԝ^[X*[ZlZUY I<0 3<00H S480(0,8,`0UnSXD oSX v  <H`0Ul0CS7'07<0X ( 0 y`0U0 0p7 0(0 H03T(Dv, 0 `00` U00,00,07( 0qH0T,(T<ZTM0  I0  EHB<0 3<00]H,T00< <040@080D00804000,00<0TS0,TH0UDS d CRe0CS````` ] -    5U%0p5Ox0UjS kS SB <5g8%0590  0  000 000$,S(S(00 00$0<0<0($,S<}S0{S(yS$wS(0S(0< <00(0,000,0dS,bS<`S(^S(0uS( 0,0< , (000<0KS<IS,GS(ES0<,0, 00<0007S05S,3So gINL4JGZJGKGL$EGL?LLMMLT!gYDMnHLcIKG -`+JGdI(L[OKGLLKG^<cR ;0C x`M<000<000NX <1R$<m4mmLmmmmdm00pU00pO00pI00pC000WX00p4X00p,X00z p$ 0 7R 8pU8Qp8pK8Gpp0E ~0 y8682pp~00>px008pr002pl00,pf00&p`00 pZ00pT00 pN00$pH00(pB00,p<00 ,p600 0p000 4p*00 p$00 $p00 ,p00 0p0p000 00  00p !H0ppRX# RSP! 0P40S *R:0SWJ00` pK P< r R(;0H%`40S PKP{ 0S <<0R  x; 0 30g ׺ 0V02=CS?0]O([O<O7 0VO,<OOO0KO<IO0GO(EO$AO,?O<=O( 9O<7O,3O01O,/O,O0*O,(O(&O$$O  O,O0O,O0<<`)U <O`U ۍ ЍG- M1Q@00004p0`400 00'800 0000008uPP  N  P%C N8 ~B@04p` 0 30 0 8 rB4p`J7  Ѝ^-`a` LG$EG?L&Lj/P/k//i/h/g/f/e/d/D/o/o/n/n/c/@-L@-@P`p7/i0  Ѝ@-@P`p7/h0  Ѝ@-@P`p7/g0  Ѝ@-@P`p7/f0 W Ѝ@-@P`p7/e0  Ѝ@-@P`p7/d0  Ѝ@-@P`p7/D0  Ѝ@-@P`p7/o0  Ѝ@-@P`p7/n0  Ѝ@-@P`p7/c0  ЍC-`p@P8/`0$0 9/j0  ЍA-`pP@8/ 0`06/k0 + ЍA-`pP@8/ 0`06/0  ЍA-`pP@8/ 0`06/o0  ЍA-`pP@8/ 0`06/n0 , Ѝp@-@ PPPp@p0p@-P(0`@3/ @0    p@$0@-@ 0$M"M ML@-@R4 <0@-000 F0 0 30 w Ѝ^0@-@0M8L@-@04 0@-@0MxL@-@ 4 0@-@0qML@-@4 0@-@0aML@-@4 0@-@0QML@-@3 0@-@0AMxL@-@3 0@-@01M8L@-@3 0@-@0!ML@-@3 0@-@0ML@-@3 0@-@0MxL@-@3 0@-@0zxxL@-@ 3 0@-@0ML@-@ 3 0@-@0M8L@-@ p3 0@-@0MxL@-@ `3 0@-@0M8L@-@ P3 O-MP1@p0000`P000000p `P6 00 0000 P0HPL0pU` HP DOD`pHE  LPAADHPLLK00 0 30 3  LKN4 Ѝ^MOGO-M@`TP8 P P0P 00P00P00P 00HP0L0`UHP DND`pHE[  LPAA3DHPLqKoK mK80 0 30 ׶ dKbK `K3 Ѝ^LOGO-00$M@] W0HP00000L0UHP DSND`pHE - )LPAADHPL5Q K00 0 30 *Q K3 $Ѝ^DMOG@- M1@ 000KK0 000 0(00000000JD( JJ JJJ Jd3 J JJJ J$0 0 30 3  Ѝ^xL@- M1@ 000JJ0 000 000000000JD JJ JJJ J3 J JJJ ~J$0 0 30  Ѝ^xL@- M1@ 000JJ0 000 000000000NJD HJFJ DJBJ@J >J2 ;J 9J7J5J 3J$0 0 30  Ѝ^8L@-0@0 009J0000P00d00J DT JJ2 J$0 0 30 o Ѝ^L@-0@0 00 J0000"00d00I D&IIj2 I$0 0 30 A Ѝ^L@-0@0 00I000000d00I DII<2 I$0 0 30  Ѝ^xL@-0@0 00I000000d00I DI~I2 {I$0 0 30 Ѝ^8L@-0@0 00I000000d00XI DRIPI1 MI$0 0 30 Ѝ^L@-0@0 00SI0000j00d00*I Dn$I"I1 I$0 0 30 Ѝ^L@-0@0 00%I0000<00d00H D@HH1 H$0 0 30 [ Ѝ^xL@- M1@ 000HH0 000 000000000HD HH HHH HA1 H HHH H$0 0 30   Ѝ^8L@-0@0 00H000000d00H D}H{H 1 xH$0 0 30 Ѝ^L@- M1@ 000}HzH0 000 000000000HHD BH@H >H m Q @ $0 T@\0!"@ @ 4Ѝ^G$EGLCLZLO-@-EM%?d0 10y 0d 0 t0d00 B0L B!(0X 3/PP luPt XuP `~buPT NuPD 8X0P00x0|00L0sX0S L0x|X0X0800<00000> 0S |P0U0|P#xpPEE1slS`!`3`b#* V `!U E WPP 0C3& x|P倰 0D0L0D00D x 0C d  PU -0& `P P 0p%7/_ 0p%7/S P 0P%5/F0P ھ) 0 04 0`0f (o `f`p40`panql< 0SD t /p` )\ '( H !8 $   40      gD ,0 S00$ 00( S0 0X f 0S$00(0 $Q? 00 1>! "3\00/+ Rh0@0?%0 Q$ Ϡ P! R 6l 5#w0 ol``0pPan1(00⛃({0p0 00Sp0$0 0S$0 0p ?/" R)4400!2 \0\0h00[P@0 U 80( <RVH000H0$9 0S2 ` ]\@SL WN< RH( LC G(= A7;p 15<80( RV,00, (2#l P"0/"?#<00R80< 0U<0( `0 P"E,00000(0 0`00P0\ 00@ 000D0X Skp P򈐝`Yh 0S  ꄰ Erw@W0!03p*W ?3Wp!r?s 0 ,0` `000 0(00`00U  PE[ PP 0 CU$ 넀凂P匀 I `0T 0P3/ 0P 0 `Ἕanq0a5 0S/ @創n僵偵 w{rvlp]k0Wlec Y]B 0U 0rP* ڼ 00 s 0 S$0 000R00S|0S 00 ^0S 0PU 0y'VP0p0P&rP 嫼婼0D0000H0 ᐀) ᠀*!ᰀ+0 000 x vP `en qB /H 3RH0S 0尐t  R0Sl ᐀) ᠀*!ᰀ+0 0 x _v pV I`P!0pp0]Wv!R0:00P000 00`2 0@00P0 `2 00  #DP 2m"0  20  20S&ZPa0`0p v!R0:0`0 000 003P!`bxu/@0 1 30> 屻A Sxf/$ ^LLLLLH\-`/LOGLpLIL^LpLLLLLLLL?LSLsLLLLLLL:LXLwLLf tLL@-\  @^ q0># R0 ,A-@M`p4tP0AT̆X 0SP<0'P0 80000`ЍLA-pP@`O0 AQ/0@-S@ $0 00嘸ЍL$EGLLp@- M `@P!! P$0 0 0 Ѝp0@-LM00D00P[P'% P$ @@PPPZ0DP@ 0R` `T @& 40 D0 30 v $唙% LЍ0^x-`L|-`^D60@-@07 > G@-@ " 0@-@077cG@-@ H0p@-@07`VP A pP7DG@-@ 0@-@07L@-@  @-@Pq00 000008` 6/Ѝp0S!gYA- p@`T$ PPUPSPU{ 0S S S@p0P0 W ЍA蠈@pЍcKO-@QM8@D P ppWpSpW `{{ 0S S S ЍS0  0 QZpj>mPQ+mPMkPB~kPEykPG 0 00S 0p 00X80@0  8ė0S.0 0 00S 0p 00WЍO;k0S 3k0S,k0Sb0 p ZY X/ 00p+ 08pqf000 87/W ф ᝅ 0 0!0p000080 0 T q Gb5 ?  GG> Q  > VT Y pWq @-\M<1`@0T00 p6P1!!0 1 勮T1# 00J @v P P 0 P0 00 P00n`0V0 0 T0 30 \Ѝ^7P$EG M5 M$M Mp@-P@l Pp@o@pp@-@Pc p@.p@-@Pc p@A-@Pac aAJA-@Pac aA+@- 0t 1 Q 0 Ѝ/ P@P ЍP0o 00(^N^HT5 M. M@-@os@-@P`!P8024 0000ʭ0 0Ѝp@/ M$EG5 M[ MC-M1p`000PX08@0H0P'`cPY @?@0 0 30 E 0Ѝ^8-MO-,Mp @o`~xg ]P R 0k 00Q`0Z/Z U,Ѝ`$U\ @@ 0T$ @  @   PE M$EG5 M MG-pMx1p`H@0l00< &g  4P7 P00((@$0  0 4P$0S  sH0S ! 0d0 l0 30 P  4PMpЍ^C-`PM8@000fPV P`$88b4(0080嚬PPr 公V X `X `X ԗbpX 01"Pa 7 0 30U cpW`P5 bp}`W- 0S3 `P& 0 P cpCpW`P 0!20S 0S 3/ QPbpPd`P0SppO_PP 80ЍC/20C Sud @ |L jP 00 0 xP`p\a 00,5 0 30jЍ$5`0S Mn!0 p hpp th A@p 0!0p  Np 0jP 00 0 wP`Ŀ w; $!0 0R Sp ` 'pp`n1h YAS p|3 0 30 0ЍC艐0@X0 0 0 @`;[ 0Y` !  0Q S Q``mg S Q 0pI7/ 0p 12S Z Pu `P!1!01]0 0m`qm0 J `V gm{P1@!0<1A hЪg@P 00  10S  @TU 00 Q 0L !0 n!d0 0 iP 00 0 vP40 0 30,ЍCtH^$M$EG M5 MQM(^tMMp`MM$MN^HTPWMlMMK-0Mh1@p0 0 0PUa먀P00Ӥ? [ $`K1P 0 00M(0K 00`2P P@0 0 30   f2 P rP@$P K^M8-M/Q@-p R 0 P S(  0\0#S0LS8 S MQ0 \@-P  BR/1R  S:/MRA P/!0#4 ' t<' \:' D8' ,6' 4' @TB @d0P' ScSP00- i' SP2:SP3P0d lPcT T0@P!t@@҇Ѕ@!@* >Nl@Ee& & & & & t& \& D& ,& & & J 0 0 30  Ѝ^.WMMM+M9M6MIGIkKvJ@MsLOM@-(M0H@@0@0$00t00S  0X XX@U & 40 $0 30 &  (Ѝ@Ѝ/^-`MMXM7QM@-(0P 4PЍЍ/M0@-M @@PU0 00}00uP d0jP 0L0P D800P0\0Ѝ0@Ѝ/M$EGcMMM-`4^@-M 0@00$iЍM0@-DMPh `1@0<00' 0@$ @"@-pPtPU  XP\x|PU  `d 0RPl@0@DOoB00S  ] Pp$Y@$0t 00ll@垘$% % @0 <0 30 / $% % J DЍ0@Ѝ/^-`MM7QH@-@0MX0H0ЍMC-DM`Px 10<000 S @10SJ  P$ 60S|p`&W@&^T#`, ptp吀`WY 0G 00唟oS@lSPT   R@@)@P@$0 00||@$]% [% @0 <0 30 $R% P%  DЍCЍ/^-`LM$EGMMkMM7Q0@-U  !@4 0$00Q`v4psp1 l!00d`Y\1 X!00D`YD1 @081p001P0(1 `0 1Z,0(0 w1 00 `000000000`0EYH0 D0 30 9~ 0S ,]v4^sN LЍ^-`]`1NeeP]`7Q>S GG-`hC_$M%M C_%M%Mx%M%M&&M<^8^xC_tC_\&M&M&M///R R R000/<,M0/00@-@0P P @P0@-@0T,M@-@ @-@ @-@0  \R \R   M @-@P 003/ 0CHC1@LP*@-Q10* S1 !/ /988@-@P AN 0p@-@ 00 S   P3/ 0 000pr @-@urp@-@`V0$0CC1p$P98O-MP`   p F@<0 080M  $ 0`X 0CC1$0G#P0Ѝ T  9 OG98p@-P0`@000ez6r& pO-P` XpF@   $ 0`T0CC1g$0G#P0 T mZ OG98@-@\0(M 0$000 @0@DV(0Oo $0 30B | (Ѝ^O-p\2,M0$000!R' R02,"0((2d `!$0P0 00   0 Q00 P_ m0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 | ,ЍO^G$EGG*M98A-(MP1 B0$0008aRBQ000/> 0U0@q0 U   [ P0BC1U:0!0000q G mL0 $0 30 { 0 P 5 [ (Ѝ^98 FGG-p00M@0,000`PTM P @\0Z (0 @ 0Pp$` @#0 ,0 30 { 0Ѝ^p@-Pp`=lP }@P 0S @S@ 00 $0@q Ѝ@ Ѝ6]KG-@!MpS, p Cg, T ,;g,0 0 0?,   ,g ,(g,0 00>,   g ,g,0 0(0>,  >0 5?P0 D0 30 (q ,  >HЍ^A8M5M:MPHO:M\.`C-@P24M0,00 P0S1!01必a0C0S  R N 0 !P~1 ,0 30\ p R = 0t pt!?~0(SP 0 00 P 0S 0 80} ,p0Y,P 4Ay @v 00u`dPUPnq t;pp0S P zP4Ѝ^2:M$EG5M:M\.`k:Ml6MC:My:M5M@-@ P0M(`pBV Fi ` Ѝ*0R07@-@Px0000X040@Q @000 80 0 30 Dp , ] Ѝ0^O-Ѐ0IC1s_AS@!@3@`p%*TP 2T@!P0 0000S0 0C0YIX  A QPB0 OG-1A- @000$000`p W `Fm PP   00 0V 0 0S(  (  00 CB\ ,0  0 30 o ЍAЍ/^QA-0 00hSp0 00`!P 0 ἺPPl@ U@0 ᯺D ;T H ЍT;M$EG;M>;Mb;M FGT@-@ᶺCꍹP/x  -Ur;M@-P! `P@p@@0S cT @DcT00ƗT0mP 0LL0dd @T Ѝp.`˄H;M$EG;M;M GA-ph`@hPUǒPP’d0 d 00p `0@Pp.`A-`,p᭒3 P03 0CS*5 0@?S(  (  00 CBP   /\ L3 d 00CSP$ * 00S(  (  00 CLR  : 0 (00p 0000000 4 L d p |"0@0,<D dd"80T0\00h0|000000l $"- "00L!"2T!"0X!"2p!"02!!01!!01!!011!! 11!!11!!11!! 11!!,11!!@10H1!!`2!!h2!!t2!!3!!1!!3!|!|1!x! 3!p!p1!l!$3!d!d1 "`!(3"X!X1H"T!03\"L!L1"H!43"@!@1"< 088040l0S 3NЍ]kN$EG;MMp.`1>M4/@-@P@0< 0880\40l0S M8Ѝ]kN$EG;MJ>Mp.`n>M8/@-@P@0< 0880?40l0S nM<Ѝ]kN$EG;M>Mp.`>M</@-@P@0< 0880"40l0S QM@Ѝ]kN$EG;M>Mp.`?M@/@-@P@0< 088040l0S 4MDЍ]kN$EG;M"?Mp.`A?MD/@-@P@0< 088040l0S MHЍ]kN$EG;MZ?Mp.`?MH/@-@P@0< 0880ˀ40l0Su LLЍ]kN$EG;M?Mp.`?ML/@-@P@0o< 0880宀40l0SX LPЍ]kN$EG;M?Mp.`@MP/@-@P@0< 0880呀40l0S; LTЍ]kN$EG;M2@Mp.`S@MT/@-@P@0< 0880t40l0S LXЍ]kN$EG;Mn@Mp.`@MX/@-@P@0!< 0880W40l0S L\Ѝ]kN$EG;M@Mp.`@M\/@-@P@02< 0880:40l0S iL`Ѝ]kN$EG;MAMp.`?AM`/@-@P@0B< 088040l0S LLdЍ]kN$EG;MbAMp.`AMd/@-@Pd0S` 0\0\h0sL0U8 04080l0S$&LhЍ]kN$EGAM;MAMp.`AMh/s@-@P|0ex 0t0tl0Sd0fP 0L0P0P`l0Sx4Kl0 Ѝp@/]kN$EGAM;MEBMp.`kBMl/@-@P@0v< 088040l0SV KpЍ]kN$EG;MBMp.`BMp/@-@Pd0` 0\0\t0SL08 04080l0S0$KtЍ]kN$EGBM;MBMp.`BMt/@-@Pd0` 0\0\hx0SL08 04080l0S $KxЍ]kN$EGCM;MNM;MiNMp.`NM/@-@Q00 000b 00{0S0ct 0p0t0P`l0SX8G0 3/ 0 0 30 2f Ѝp^]kN$EGNM;MNMp.`NM/@-@P@0s< 0880z40l0S  GЍ]kN$EG;M OMp.`5OM/@-P(0$ 0 0zP Ѝ]kN$EG;MZOMO-@P- MЄHpLX0 00z0S0l 0h0l0P`l0SEPFX LHp0 ЍO/]kN$EGOM;MPMp.`/PM/@-@P@0< 0880rz40l0S FЍ]kN$EG;MOPMp.`yPM/@-P(0$ 0 0UzP Ѝ]kN$EG;MPMO-@P-M`HpX\00 00:zP R|0h 0d0h l R 0P^F 0\0 Hp0ЍO/]kN$EGPM;M@QMp.`aQM/7@-@Pt0p 0l0lz0S\0H 0D0H0Pl0S0+F0 Ѝ0@/]kN$EGQM;MQMp.`QM/A-@P 0 00yP0Sp0\ 0X0\0`pl0Sx@E 0 ЍA/]kN$EG RM;MWRMp.`}RM/@-@P0 00yP0Sl0X 0T0X0`pl0SG<E0  Ѝ@/]kN$EGRM;MRMp.`SM/@-P(0$ 0 0yyP Ѝ]kN$EG;M1SM@-@P0 00fyP0Sl0 X 0T0X0`pl0S<E0  Ѝ@/]kN$EG\SM;MSMp.`SM/7@-@Pt0p 0l0l6y0S\0H 0D0H0Pl0S0[E0 Ѝ0@/]kN$EGSM;MTMp.`@TM/7@-@Pt0!p 0l0l y0S\0"H 0D0H0Pl0S00E0 Ѝ0@/]kN$EGcTM;MTMp.`TM/7@-@Pt02p 0l0lx1S\03H 0D0H0Pl0S0E1 Ѝ0@/]kN$EGTM;MUMp.`9UM/@-P(0C$ 0 0xP Ѝ]kN$EG;M_UMs@-@Px0Jt 0p0px1S`0KL 0H0L0P`l0SA0D1Ѝp@/]kN$EGUM;MUMp.`UM/@-@P@0[< 0880vx40l0S  DЍ]kN$EG;MVMp.`@VM/s@-@P|0kx 0t0tYx 1Sd0lP 0L0P0P`l0S4}D 1 Ѝp@/]kN$EGfVM;MVMp.`VM /G-@P؂00| 00*xp1St0}` 0\0`0P`l0SDMD,0( ЍG/]kN$EGVM;M:WMp.`]WM/A-@P 0 00wp1Sl0X 0T0X0P`l0S<D0 ЍA/]kN$EGWM;MWMp.`WM/s@-@P|0x 0t0tw1Sd0P 0L0P0P`l0Sf4C1 Ѝp@/]kN$EGXM;MZXMp.`XM/s@-@P|0x 0t0tw1Sd0P 0L0P0P`l0S94C1 Ѝp@/]kN$EGXM;MXMp.`YM/sC-@PЂ0+| 0x0xlw 1Sh0T 0P0T0P`l0S 8C 1 ЍpC/]kN$EG1YM;MxYMp.`YM /@-P(0$ 0 0>w$P Ѝ]kN$EG;MYMs@-@P|0x 0t0t+w$1Sd0P 0L0P0P`l0S4OC$1 Ѝp@/]kN$EGYM;M2ZMp.`VZM$/@-P(0$ 0 0v(P Ѝ]kN$EG;MyZMC-@P؂0 00vP(1Sp0\ 0X0\0`pl0S@ C(0  ЍC/]kN$EGZM;M [Mp.`*[M(/7@-@Pt0p 0l0lv,1S\0H 0D0H0Pl0SY0B,1 Ѝ0@/]kN$EGG[M;M[Mp.`[M,/s@-@P|0x 0t0tvP01S`0L 0H0L0`l0S-4B0 0Ѝp@/]kN$EG[M;M\Mp.`6\M0/@-P(0#$ 0 0av4P Ѝ]kN$EG;MT\Ms@-@P|0*x 0t0tNvP41S`0+L 0H0L0`l0S4rB4 0Ѝp@/]kN$EG\M;M\Mp.`\M4/@-P(0;$ 0 0!v8P Ѝ]kN$EG;M]Ms@-@P|0Bx 0t0tvP81S`0CL 0H0L0`l0S42B8 0Ѝp@/]kN$EG*]M;Ma]Mp.`]M8/@-@P`P"|0Sx 0t0tu<Qd0TP 0L0PlQ ~8B <Ѝp@/]kN$EG]M;M]Mp.`]M</s@-@P|0dx 0t0tu@1Sd0eP 0L0P0P`l0SP4A@1 Ѝp@/]kN$EG^M;MW^Mp.`{^M@/7@-@Pt0up 0l0luD1S\0vH 0D0H0Pl0S$0AD1 Ѝ0@/]kN$EG^M;M^Mp.`_MD/s@-@P|0x 0t0tYuH1Sd0P 0L0P0P`l0S4}AH1 Ѝp@/]kN$EG)_M;Mn_Mp.`_MH/s@-@P|0x 0t0t,uL1Sd0P 0L0P0P`l0S4PAL1 Ѝp@/]kN$EG_M;M`Mp.`C`ML/@-P(0$ 0 0tPP Ѝ]kN$EG;Mv`Ms@-@P|0x 0t0ttPP1S`0L 0H0L0`l0S4AP 0Ѝp@/]kN$EG`M;M`Mp.`aMP/7@-@Pt0/p 0l0ltT1S\0H 0D0H0Pl0S_0@T1 Ѝ0@/]kN$EG?aM;MaMp.`aMT/7@-@Pt0p 0l0ltX1S\0H 0D0H0Pl0S40@X1 Ѝ0@/]kN$EGaM;MbMp.` 0Ѝp@/]kN$EG2gM;MegMp.`gM/7@-@Pt0p 0l0lr1S\0H 0D0H0Pl0S,0>1 Ѝ0@/]kN$EGgM;MgMp.`gM/@-@P@0< 0880ar40l0S  >Ѝ]kN$EG;M$hMp.`NhM/@-@P p0| 0x0xCr`1Sd0P 0L0P0Pl0S8g> p 0 Ѝ@/]kN$EGrhM;MhMp.`hM/s@-@P|0x 0t0trP1S`0L 0H0L0`l0S49> 0Ѝp@/]kN$EGiM;MPiMp.`riM/@-@P@0< 0880q40l0S >Ѝ]kN$EG;MiMp.`iM/@-@Q00 000 00q1S0t 0p0t0P`l0SfX=1 3/ 0 0 30 \ Ѝp^]kN$EGiM;MjMp.`mM/@-P(0z$ 0 0qpP Ѝ]kN$EG;McmM7@-@Pt0p 0l0l^p1S\0H 0D0H0Pl0S0<1 Ѝ0@/]kN$EGmM;MmMp.`mM/s@-@Px0t 0p0p3p1S`0L 0H0L0P`l0S0W<1Ѝp@/]kN$EG(nM;MenMp.`nM/@-@P0| 0x0xp`1Sd0P 0L0P0Ppl0S4*< 0 Ѝ@/]kN$EGnM;MnMp.` oM/s@-@P|0x 0t0toP1S`0L 0H0L0`l0Sx4; 0Ѝp@/]kN$EG0oM;MkoMp.`oM/@-@P p0| 0x0xo`1Sd0P 0L0P0Pl0SJ8; p 0 Ѝ@/]kN$EGoM;MoMp.`)pM/s@-@P|0x 0t0t}oP1S`0L 0H0L0`l0S4; 0Ѝp@/]kN$EGTpM;MpMp.`pM/s@-@P|0x 0t0tPoP1S`0L 0H0L0`l0S4t; 0Ѝp@/]kN$EGpM;MqMp.`DqM/@-P(0$ 0 0#oP Ѝ]kN$EG;MlqMs@-@Px0t 0p0po1S`0L 0H0L0P`l0S04;1Ѝp@/]kN$EGqM;MqMp.`rM/s@-@Px0t 0p0pn1S`0L 0H0L0P`l0S0;1Ѝp@/]kN$EGMp.`bMD/7@-@Pp0l 0h0hiH2SX0D 0@0D0Pl0S,6H2 Ѝ0@/]kN$EGM;MMp.`MH/@-P00, 0((0iP2T"0 Ѝ]kN$EG;MM@-@Pl0 h 0d0diP2T"0P0 < 080<0l0S[(5%Ѝ]kN$EG:M;MeMp.`MP"T2/@-P(0$ 0 0iXP Ѝ]kN$EG;MMA-p0M@Q80000$ 00wiX2S0% 000`Pl0Sh5# X 08/ 0 0 30 T Ѝ^]kN$EGՂM;MEMp.`oMX/@-@Pl05h 0d0d=i\2ST06@ 0<0@0l0S,c5\2Ѝ@/]kN$EGM;M̃Mp.`M\/@-P(0F$ 0 0i`P Ѝ]kN$EG;M'MG-@P؂00M 00hp`2St0N` 0\0`0`Pl0SD"50 `0ЍG/]kN$EGUM;MńMp.`M`/@-P(0_$ 0 0hdP Ѝ]kN$EG;MMs@-@P|0fx 0t0thd2Sd0gP 0L0P0P`l0SY44d2 Ѝp@/]kN$EG@M;MMp.`ɅMd/s@-@P|0wx 0t0thh2Sd0xP 0L0P0P`l0S,44h2 Ѝp@/]kN$EGM;MOMp.`vMh/@-P(0$ 0 0`hlP Ѝ]kN$EG;MM@-@P0| 0x0xMh`l2Sd0P 0L0P0Ppl0S4p4l 0 Ѝ@/]kN$EGކM;MWMp.`Ml/Ms@-PP@ |0x 0t0thp2Sd0P 0L0P0`l0S8A4pЍp@Ѝ/]kN$EGʇM;MMp.`KMp/@-P(0$ 0 0gtP Ѝ]kN$EG;M~M@-@P0 00gpt2Sl0X 0T0X0`Pl0Sz<3t 0 Ѝ@/]kN$EGM;MMp.`Mt/@-P(0$ 0 0gxP Ѝ]kN$EG;M:M7@-@Pp0l 0h0hgx2SX0D 0@0D0Pl0S9,3x2 Ѝ0@/]kN$EGbM;MMp.`Mx/@-P(0$ 0 0og|P Ѝ]kN$EG;MՉMs@-@P|0x 0t0t\g|2Sd0P 0L0P0P`l0S43|2 Ѝp@/]kN$EGM;MRMp.`yM|/@-@P@0< 0880/g40l0S ^3Ѝ]kN$EG;MMp.`ъM/@-P(0 $ 0 0gP Ѝ]kN$EG;MM@-@P0 00fp2Sl0X 0T0X0`Pl0S<"3 0 Ѝ@/]kN$EG%M;M`Mp.`M/@-P(0#$ 0 0fP Ѝ]kN$EG;MMs@-@P|0*x 0t0tf2Sd0+P 0L0P0P`l0S[422 Ѝp@/]kN$EG΋M;MMp.`8M/@-P(0;$ 0 0fP Ѝ]kN$EG;M^M7@-@Pt0Bp 0l0l|f2S\0CH 0D0H0Pl0S022 Ѝ0@/]kN$EGM;MnjMp.`M/@-P(0S$ 0 0QfP Ѝ]kN$EG;MM7@-@Pt0Zp 0l0l>f2S\0[H 0D0H0Pl0S0c22 Ѝ0@/]kN$EGDM;M{Mp.`M/@-P(0k$ 0 0fP Ѝ]kN$EG;MƍM@-@Pl0rh 0d0df2ST0s@ 0<0@0l0S,&22Ѝ@/]kN$EGM;MMp.`;M/@-P(0$ 0 0eP Ѝ]kN$EG;M\Ms@-@P|0x 0t0te2Sd0P 0L0P0P`l0Sc412 Ѝp@/]kN$EGM;M̎Mp.`M/@-P(0$ 0 0eP Ѝ]kN$EG;MM7@-@Pt0p 0l0le2S\0H 0D0H0Pl0S$012 Ѝ0@/]kN$EGEM;MMp.`M/@-@P@0< 0880Ye40l0S 1Ѝ]kN$EG;MǏMp.`M/@-@P@0< 08808 ]%hL W%,h` Q%t K%(h E%h ?%h 9%,dg 2%]g +%v %%h % %8xh0 %nD  %4lhX %Hfhl %0`h $Zh $Th $ $Hh $g $#R $g $.h( $(h< $"hP $d $hx $"R $"R $C $= $ $g $P $g $, {$@ u$T o$ h i$Hg| c$g ]$g W$g Q$Xg K$g E$g ?$Tg 9$g 3$g0 -$DXfH &$g\  $4gp $@Ef $d>f  $h7f $ #^g #"R # 0Spp@/A-@P 0K 00WP,3Sp0L\ 0X0\0`pl0SH@# 0, ЍA/]kN$EGM;MMp.`M,/C-@P؂0\ 00xWp03Sp0]\ 0X0\0`Pl0S@#0 0 ЍC/]kN$EGM;MWMp.`yM0/7@-@Pt0mp 0l0lGW43S\0nH 0D0H0Pl0S0l#43 Ѝ0@/]kN$EGM;MMp.`M4/@-@P p|0~x 0t0tWP83S`0L 0H0L0`l0S4?#83  Ѝ@/]kN$EG M;MLMp.`jM8/@-@P`P"|0x 0t0tV<Qd0P 0L0PlQ 8# <Ѝp@/]kN$EGM;MMp.`M</0@-@Q0M0 000 00V@3S0l 0h0l0Pl0SYT"@33/ 0 0 30 A Ѝ0^]kN$EGM;M3Mp.`WM@/@-@Pl0h 0d0dVD3ST0@ 0<0@0l0S&,"D3Ѝ@/]kN$EGzM;MMp.`MD/@-@Pl0h 0d0d\VH3ST0@ 0<0@0l0S,"H3Ѝ@/]kN$EGM;M%Mp.`SMH/@-@P@0< 08803V40l0S b"LЍ]kN$EG;MMp.`ML/@-@P@0< 0880V40l0S E"PЍ]kN$EG;MMp.`MP/@-@P@0< 0880U40l0S ("TЍ]kN$EG;M=Mp.`MT/7@-@Pt0p 0l0lUX3S\0H 0D0H0Pl0S|0"X3 Ѝ0@/]kN$EGM;MMp.`MX/@-@Q00 000 00U\3S0t 0p0t0P`l0SLX!"\C4/ 0 0 30 @ Ѝp^]kN$EGM;MeMp.`M\/@-@PP |0(x 0t0tuU`3Sd0)P 0L0P0`l0S8!` Ѝp@/]kN$EGM;MMp.`M`/UR$0@-`V:0 00AU(pP@1S)0S 3/ (01S0 00 R R Q`0H 0D002/004  U (0 ЍM$EGM;MM'M4M0G-Ppp@W@Ac0p㤡`PD @T@c0`PVpp.`M;MG-`@pᇡPP p0Sl0S zP_dl0 c0 00< 04TQ0 0p.`CMM;MM P/0 \  \ \ 0R/M@- 4Ѝ^GxC_tC_MKMhM.`@-@PX0T 0P0P S0S@0, 0(0 0L 00x 0p0s} 0`SL9}7} 03/L$@/}Ѝ^aIIV?I GP]`?I?I00/d_0@o/@-Qh03d 0`0`RpPL08 0400S,0 00 ЍM$EGMM.M7M @-@0C'S( 0(0SP(  (  00 CB\ 0  C CC @-@0CS  0 0SP(  (  00 CB\ 0  C C7@-@0 P0000S0 0 30( c= 0CS  0 S 0 0 S(  (  00 CBP 0 0P Ѝ0^00S/岝i_UMP/<  "mM "M "MG-`DpP@@<T 1@S: L#}QR~YQP@o/@-M op@-P`* @* TP0@px* l@* TP0@p@* 4@* TP@ppbiKTiKG0@-0 0 QL$EGLG0@-0 0 yQ/M$EGMG0@-0 0 mQL$EGLG0P/ss@-M:c\0P/ss@-B/X\P/0@-S @0< 0808EQP(0 00 ЍLSL$EGSLGsSL/0@-S 0CSHD0@ 0<<0"Q1_, Ѝ" Ѝ"OMMTMYMQCMA-@ Pp1`1P0W C C  ' @0'@-`@P0S4S PPT P1Eh@ 0 @ 0000 0 0 @040!P! Ѝy1(v1ps1W 0 0 0PM$EGMMs@-PPd0` 0\\0P(`4@Q0 00& 0  @Ѝp%M$EGM M7@-PPX0T 0PP0P@/ & 0  @ Ѝ0]kN$EGM5M0@- !P 1@11@0@- P 1 0P$0 00YP1 ЍM$EGMUM@-@? s p@-`PP Qp0SpQ @T@U 0`@tP00 !?! 0<<00Tp!! P P0BS@-0 00P0RP`pP Q' 0S# @T ` `Qq@V 0W``P@s(P00!?! 0p@ T Ѝ!! M$EGMqM p@-@Q` PU6?PT 0 `!050400VP% R0(@ 0C S  0 0S(  (  00 CB\   0ABpqC0@07@-@000P00 P t P  P P4MO0 0 30 : Ѝ0^IGRMp@-@ 0pP{P p@/pIGR0 S4<06A-P@`PTD@@Q@S pW //X 804 0000Op UЍ3M$EGMM Q Q_ Qs@-P@/`/V 0# 00N 0 R$0 R l02X 0T0 0T 0R$S4R ,0; 00ЍpM$EGjMMMM@-@`; 0p  a @Ѐ 0s@-R0PS%v8vdvdvdvxvv/`@/TVЍp 0CS $@$T S P$0 00uNNMTMMp@-P@PpP 808 0#04 040RPp @- ^ Q`P @p@^T?00Q00p@-@ 0P 00S S Q@* 0 0@00p@- 0S 0Cs0S   P h0d 0`0`N   P0 @0, 0(0,0( 00 ЍM$EGjMM"KKTs@-P `0S 0Cs0SL0  300= SH $1- !01M0 ' 30qP- m.(@ 0C S & 0 0S(  (  00 CB\   0AB 0= S0` P03< 080V.@,07( 00ЍpM$EGMM"KKTp@-@P`k 0  PP00!?!pp@-`P@ pp@-@PL 0  P<kν?0pp@-P@pA-@pP`/ 0  pP 0P00S0 00 0!0@-P0M@000000 00F# 0S T!"R U0M0 0 30 B8 Ѝ0^(^MpH- Mx0P@00 0 \00M `l  i 0 0 0 30 8 Kp^ӏJpH- M0P@00 0 x00M `G D 0 P0 0 0 30 7 Kp^ՏJ@-M0@ 00000 0" 0SH  00S 0L0 0 30 7 Ѝ^MM@-M0@ 00000 0" 0SH  00S 0bL0 0 30 7 Ѝ^NMfM@-M0@ 00000 0" 0SH  00S 0;L0 0 30 |7 Ѝ^MMH-M0p`P00 0 p@ @ @@M@ 2 / , 00 K0 c" 0SP  00S 8K0 0 30 <7 K^NIVMM@-BTP R : ^(R  ^ 0P/0S/M@- P` qP0 00Kpe,#@0CS ( 400, 0SP  P @ 008 CBP 4 0 p 0   Ѝ@Ѝ/GM$EGM M 0S/-P 0^Rp@- `P030P ,(@ 0CS 00S(  (  00 CB\ 0 0 p,@ 0@- R @0< 0808?KP(0 00 ЍM$EGaMMM 0@P/s@-`P@1i " R HPR1 0000.` O-S R`*)p` 40000  U<R(Rp )R>RpG R W)R,RI m P  g P 0㓦#00040P0 0NQ J (d b $MMMI Wxx`s@-`P@` H0HЍp@-0M 1@0,000 $  @   -0 $00 @00@0000000 $00 @00@0000000 ,0 30 3 0Ѝ^(.`xC_tC_MiMM=M C__MhC_hvMMH^C_-PC_hM8MI^@-M1@000 P0 S S( S= 0"S S ((0S#(( 0`p 00S 0 10 Sp`8,p`00'^0\0Q0ҥ00¥`PVp0 S* 1  0C30c0 0 0 30 2 Ѝ^@-,M0Pp `0$00@T @T  ! + +,0 $0 30 `2 +} ,Ѝ^0@-M0000 0 0 PT0 0 30 C2 P@  P U  T  Ѝ0^h2p@- M000 0 R D2@"0<<2F0P `P 2 0 30z 2 e'0S0S 0SPP 000#BM'80 Q 6'1@ iP  00`  R0  R T5 ?$?C!201>!0 0 R   000  ^P  0 R0 0 R 000S23# " &00!2 Ѝp^G$EGMRMA-`S p@P 0S`&qT@ 000P0P4 &(P 0CS 0 0SP((00CA\0 V CC 0   @P 000 &cPW0200 0 Ѝ0@-0 Ѝ@- 0 A-`P3M00027"02EP@rUT 0 R*  Br R ]QZ@QQ QOM|QG dQCpWj02 0 30  Q* R 1 0 30  0 X 1 0 30 ЍA 0  0S 00  0 @0S4 0000P9 0  } 0p p 0 R R`P 0 ! U!!0 0 30ЍxpP %%X@ Q;@T RpW{ 0 t 0S p^-P$EGMwMp`$MH^@-M1@000& P0 S S* S= 0SQ S 0 00B%0S%o% 0`p 00S 0 0 Sp`)p`\0 P0PQ`  0 S* 1  0C30C0T0 0 30 / 010C3SϠ  0 Ѝ^P 0P /A-PpU`1EP PE0 00 00 S 00U 11!01pD P000 PP) %(@ 0CX 00S(  (  00 CB\   0 0 UЍ$@0M$EGMMA-p 00 S2"02!D0 `01!01PPP 0 `    !! P. $(@ 0C?S@_  @Q(00(000A C\@ 0 00 " #0 0 0 R V$-@  R   0S:$Q 0 ӵ  õ 0 01Ѝ0S&$Q 0ҥ00¥6M$EGMM\M@-b(@`gTL0H 0DD0CP$ $80, 180 ЍM$EGMyM0@-P`04M0,0000@0$ "0 A90 ,0 30 . 4Ѝ0^p@-Pt 0Pp 0@#$0T@P  t =C MMM@-@[ 0 R00u 0|0|4C0 S :d0vP 0L00! @@!`"3 10S 0 00 ЍM$EG`MMM7@-@P( 0 R00 0| 0x0xC \ :`0L 0H0!L L!l10<p P0 Ѝ0#M$EGMM[M@- 0  BRD0@ 0<<0B -@R0$ S ЍI$EGMM$M7@-P 0  BRT0P 0LL0B @-@R 00R 00P Ѝ0I$EGMM$Mp@-P `0=@S 0Rp0 309P( 5#(@ 0C7S8 080SP(  (  00 CB\ 0 0p@ C   ##¿@$M@-s 0  BRL0H 0D0DNB -@R 00 000 ЍI$EGMMM7@-PQ 0  BRT0P 0LL0,B @-@R 00R 00 P Ѝ0I$EGM0M$M01C-`000)P,P2p!07#  @P"p"W3V000 0 30 Ѝp 0 -@R R R@V x$0 0 30 -  ЍC^$MC-PU@ 0 R@P 00CS ЍPPP 0SP 0  B R8ܪXXDDDDDDDܪ" 0RP 0S 0P R @1Ep R sP@P 0P$PSS4P\ 0 P`6V R 00Sa $4 R0 00CSP@ 0 R@ 00CSꈶhhhhh 0 Y0S ^(E@Pk0 0`P 06P0@P`PP P00 ^0*000d0 0Sp Sd0000d00 0  BR񟗀(8(`(00 \@: ^ :P 0 s00 000#zP00 0 RF4132d00i 00S<!#0`Sd00\ 0 R/0j R)  RK:P R  3E 00 Sv S 00S p RV 0 R 0 P @0(d0&.`MH^GiKTiK 0 0"@-@ 00 S 0@o 0@@-@PP 00S 0Cs0S 08$M@-@P 00 S0 @-@{ 00 S u 00S ,0w( 0$$0Q=i 0@ЍM$EGMM@- O-PQ? 0 0  6oc @T pO# ?00 1>0$ Sb3 00C 00 0 1Z R.. 0`$@ N`@@`0@0@0 `I)00!0+C V 0S 0S 0 00+S P T T0 ,0 30 ! `0J ?o20 0@4Ѝ^dMO-p !$M@PH`   R @prT0 0 30' !  v Y@    Y 0 B@ ((R 00 0  $Ѝ^O-M9pP@000a`}PS P 0 CeP 0 dP (0ЁS 0(0 00S( 0`  (0S "!9@P 0 rd 00CST|hT@d@h@`d@Ph@  xP 0@  ``  p qP m(@ 0 0 0 BRჁ*! u@ Q (00(000A C\0 00@ 0  0!w 0 X@00`k   l P0 0 ) 00 0 0 T @1r@P 0Sw 00`0Zd0h0l0p0 prqZ@p0pp@p` @d0D0J h0`P p  B  Y` 0hlpR S P덲#`H 끝 `0 pS0 0(p 0 0 0 BRბ* s p   Q(00(000A CP0 00p 0 0 W `H`00`D`  0@@ 0D0 @ D ! 0 㒚.,p nP j(p 0 0 0 BRჁ* rp Q (00(000A C\0 00 0 Q  !u 0 D0HoPh  R( j 0h`0 000000`080000bP 0 0000 R0 01>! 0 000  D4& e 0@0 ?XP00 1>0!@T P0 0  0 1:!01&4p "2 801V`1 0 X  R `  a`  2P `P !Q Qs! @W 0 0 30 % Ѝ^dMM$EGMM4`@-0M 0@Pl00,000  C 0 000#! q0 ,0 30  0Ѝ^82C-TM0L00 00 S 2"0  23@p7X9 0 bP2 00!"(X-0(0"8`XCP080 0 0`Ѓ P800 (0@800801 L0 30<  000 aP !#(80 P(`P`PU`(0P4`0 aPP 080!$`!P>\  P "3TЍ^ZM$EGMMM@2A-M000 00S S 2"023`P4Ppp@Wp 0 gaP 0 00ppP@@`T@ 0 MaP 0 00@@ 00   0p0P 00S" 0`P@@T& 0 "a@P &010 0Yh0 0 30   ` 0HD0Qz20 000S2Ѝ^M$EGMMdMGMO-$M@PL0000z0PA z Ϛ Zp `P  BRG Ah VPP QP\1 W W p!0H0[,Q WB:$ЍOЍ/0 Q0^F0 0`0V`) 0 PF 0U  0PP CR  PZ  A 01P0p꛸HnMvMOGO-@`0V 0 `` Ѝ Ѐp0F0}0P 0V  B YIX  AҘ QP0 0 OGO-M4P0000(0,000 Q4$041P T 8J |4 40(q0C  ,00 490Sd $P@TP[ 0 `Q @4(3 0 30  P ^p\,)X\ PWsQW\P,Q\QPqP V`P  0PS"S@ 0RP 0  X  p0 0#! 2P 0 S, 8 0RPn,`00 V # `,`P]0 PW RS P M,!04 ( !(z(p,0F 0N 0 0VL` Q0AW` 0 Aग  0( !,`0 z 00S  @ Ѝ^M$EGMMxHMOG@-M01P0 00x;` `P p4 @P ` d;400@0 0 `Q `00 0 R x0t 0pp0C0  `,0 0 30 o 6 님 Ѝ^.`LSL$EGGM 0 QB 9QQ/Ѳ # ! /Q/p@- P# P. (@ 0C S m 0 0S(  (  00 CB\   0ABpQ Q/ - b # /;@$M@-pP`@ D0@ 0<<0/U10 0` ЍwM$EGM@Mp@-@P  0U A   # !p@-@ T 000p@-@P  0U A   # !pA-@`PpP 0Nq 0  0p0 @-@0  0@00@-@ T 000C-@s8PP#0C_S`(ⰱ 400,`0SP  P @ 008 CB\ 4 0 ` ׵ 0P `2O֯/o2"g 000 2] 2WK2 OCt2 G XX2 ? P<2 7$e 2 /]2 '(r1 j1 , !0<4!;x!008OiL!0$< 01D 1H1  L000H0 !P 0T 0X 0\ۮ0 @ 8 Ѝ.` WGGGbiKYiKGiK>iKTiKKiKqiKhiKLgI gIMMMMM8MeMMsC-@ `PPЂ   0 ЍpCE7@-A@ 0 Ѝ0@-A ? 0@ЍA-P`p@ X0=T 0PP0.UV1Ϡ0 g 0ЍwM$EGMM@-@ T 000@-@ T 000@-@ T 000A-pP`@ᨫq0 0  0p0 @-@0  0@00p@-0P` 00000UP# Q(@0 0CU 00S(  (  00 CB\   0 0pD@0BS@-P0L 0HH0s-0@ M 0 @#   Ѝ M$EGMM$Mp@-@Ὺ P0CS¯ 00S(  (  00 CB\  $5P /o4"7 000 4 4'`4 X4 mt4  eX4  z<4 r 4 $ᇫ4 L3 PΫ`#0,`#00~`ᘫp#0(!`;H#04P`j #080}<4y@ 2 {D 2H "T@"X"\ 2`` 2d l2Th X2Nl D2op 02Bt 2cx 26| 1W 1* 1 K@ 1 1@? 1 |13l 090p 090 @1% 41 `/o1" 0 0p WGGGbiKYiKGiK>iKTiKKiKqiKhiKGRLHRgI gIFM?M$XHINMYMdMpMMMMMMMMMMMMMM>IGI6IMMO-$M6` P000lP g V 6V&06+P00 ᘙ0pS@T(6 #@0CS  400,0SP  P @ 008 CB\ 4 0 P@  0P - 00 S4$ !! 0Y5 00 S P ( 0C?S@ í 0p@0S(  (  00 CBP   0 Rp PV (p0  0CSႡ* Ꭽ 0 0S(  (  00 CB\  㵱 0 Z 0  0 00 0Q Q  $ 0 000P  000 0 00S+\ 7p 000 000 000 000  j 00"*l H 0Q p e 0Q p  0S3Sy`4  030-P3 ) (` 0C S  0 0S(  (  00 CB\   0AB 0 00    1 0 30=  뫧` 0 0 # 0 #  cB 0=0 P _ 0 D0@ 0 0Z@$Ѝ^ M$EGMM/M$M|MWMT/00Q  "1 q bRQ 0C0/0@-S 0 00) ЍM$EGGnM@-Q00, 0((0) 0   ЍH$EGGM@-Q00Q, 0((0) 0 ! ЍM$EGGM@-@P Aఐ p@-@PU   ᤐ pp@-@Q`pV P A  p@蒐 P@-@NN1NL^*~Q10* S1 ! O-@0Z 00 PJ`0U0 ; IPPY 2 PW AP `aP`OG@-@N1L^*~Q10* S1 ! O-@IDAt~AT0!03@`#*TP 2T@!4P0 0000X  B  S0CW A QPB000OGp@-@1M000PHS-  0  Q 0 Q !0 QPp0 0 30  !d00 Ѝp@ 0 0 30Ѝp^TIM~X7P/ -3@-P@0 00000[ 00 Ὦ 00 [ k (0 0 30  Ѝ0@ Ѝ/^0@-,MS00 P@ $  00   80S V ! B U PD <0 $0 30   7 6 띐 ,Ѝ0^0@-,M0@P 0$00  r 0S0c0% # 0 /   K   P0S00c0  ~ P0 $0 30 G    l [ ,Ѝ0^p@-(M@<`P00$00 00 0080 00kY  v  (0 $0 30   , (Ѝp^ 8  G-MP⨠`,3V0003Q#03'Q 2 0 30   ЍGJ q$ 0 Z4 0 0 $0 00 0S l l $l  lt  0 lm 0k $i Џ 0 - $T@m P <@G $ (0 0c(00Y PN  1Z$ Q<`Pd0 Tll0 T00.'l  < X0S l(  lp l C l @0 > 0S 0 00'k e 0 $ <0 0 30TЍl  yw^'M$EGMM7M%H%H;MMMS 00   Ѝp@-@MPT`@00<00$M $  $  $00 00P0 00 $ 40 <0 30   $  @Ѝp^@-@P 0_S /@-@0VS0TS P0_S0_S vS0tS0vS0tS_@oO-@ 4MPp\00`0 @P 0d0dŸ(00X`P đ 0 $0$0X@ Th:&0 00 00_Q[vQE _PvPbP0_S QI 00 0 0SC P?Z ,0P7 Q3 ,0P/' 0@0  0_PP0Q^ 1h8P  =bQ,0v,0P > 00F4Ѝh0 `0 00(0 000`P  00$MMMC-$2MPQ@0 000`0R  X009 0p0S @1 0 30g  PW @X00 I9: IH 0X0S @T |P l @ᑬ 0P  @P 0=@S000S&U 0S V w 0 0  ?00P1 >00 P003:00UЍ^$MG-pP1`b0 00D9>p@pGPǟ  00S (  , P,9&@0 08H@9 00S99 00 00S1  0p@ 9 00S+ 9p8I9P<9D'I@8L0P 0 30   0& S $Ѝ^Mp@-P@u ұ op@-5K@-@0_S 0_S00A S 峫 PMM@-@0_S 0P 0_SMPP00L00H00D00@0 0<0080040000 0,0$0h /` M'M+Mx@ 0R   P/P///A-Z 0 R RQ H1D!0@@14$ P-@R0(1@@ DoЍap 0=@S00Q P @U'  !0S 1104# P@ 0=@S0\0   Œ\ ^   I$EG\M=M$MC-|1$Mp0000 `0P P@@ 0   XP@PP0 0 306  QP P 0  Q !0 @P90 1000H0@P0 }0!d0A0P @P$Ѝ^jK40@-+ 00LH ?001t/`0@- 00$t/`A-` 8@P7`P8p@7@V@3#A-`7P@7`@7pP7PUPp@-@7P7pP/t A-@0`pP6 00S l0h 0dd0#P  0E@` T?ЍA!Ѝt/`M$EG\MsMA-P@`p7 iE 0P`0\ 0XX0"3G? Z@ᘸP  @ЍA M$EG\MMG-@`P6 00S D"pKW  "0G 0CM@-90O-M0p}묰) j s`P mx 0@ ex\0P@˰PP`0`P ЍC-MH1@P000YD~6xCH`w6q 0 p0 Pf+` YX Ѐ! ^ ` `0 0 30 f 0 ЍC* 0 0 30 ЍC9@^O-p0P@ɏ0`{@ P P  3x   -x Ѝ  &xO-lM3`0d00@Pq(0 p7 `$ 0PD3 d0 30  ,lЍO=@S0 30 0 0Q=@S0 2 08# 0 00 S@\[ 0`V h dp&= c~,PU 2 d0 30lЍOzw1 d0 30lЍO>j1 00`Q_4^#1 40@0 0w1(`,P0 XN` Pd$& 1 d0 30qlЍP !  ^ b 0g 0= 0 0@S00R0S 11?001>V| PVu*0Vp`^G$MbMEMcK0S!gY VC^OMO-|MP@0夐 0$2p0t00㬀y` 0娠 -@R !0 R    001 t0 30^  0  R! 0PH0(P0,000H0 0 0 0#00@( OP80@ 00 0O@@0AN`P @d0   pp  0 0LPH0D 0@@0k D? B|Ѝ^$MyMM M$EG\MMp@-P@ x op@-5K@-MO- M@ 2`p0(0 0V4P 00S @1 (0 30n h PP T003B 0P 4@4 0K00P @P/ 4P+ @@ P2@P LDPBYP l4 u0SR0 '40 \00#030V u 0tp0QT \P@0 0M 0ᣡ᧯ @! K^iK"McI\MA-`-M먀pH1 P.$1@ 00G0 000$P( PQP@88UP X<#P0!0P0U>$0T 0!E 0D  @# (  ЍA"qM{MM|MMM$M@-M0 @000 0 0S P0 0 30 u <0Ѝ@0 0 30Ѝ^ Mt/` 0p@-@Qp0$0 0QP.sP 0PpO-4M`3@P0,00 P0PP0CSPP0`p0?S P0C?oP2 00P`00 0=@S02 0SQ0 00"~PY l2h"0dd2 i 0=@S0$2 00 R000 嗎P @  xP Z @ kVP  3`0V0Z0Z0S00Y00Y0000Z0S00Y0` 0 V 0S 0SP0 ,0 30) `F000 ;P 00 0  0 R_$7'0S0(0S0$0S0%0S0&0S0`4Ѝ^$MQM$EG\MM0/s@-`/oV0" 000R x8s0F@0SP ޣ 00 T 0 00 0 30 8 Ѝp^^EG@-Pp 0`,0@ 00000(  S.  p 0 $`! 0  ( @ #   ЍvMMM$M@-@da000 0000000000 00(00$00,00000400800<00@00D0|0H0x0L0t0P0p0T0l0X0匎@蛎1t/`8MMMH88/l//%,(&L(&B<h3?:!x4A-P0@0 001? `0@,pW 0B@P  m P t @@[ P 0040 0 30 l :Ѝ^MP 3#0 #10 0 $0P(0= p$X `H2F!/o b @Vڴ"@`3rX$0唲0 000 00 S U % `8"0p00S 0S`002/, p// 0V?/0 pWp{/l/ 0p0 Lb'@^5? 0\ᚰP N=o0 D00! B`p0S 00 0ꤠ`pQӃ T,|o0 , 0 U ᙇ |Ѝ^'N#h#t##[OcI[NNNXE_@-@P A O-Ѐ@IDAtoPAT0!03@p%*T` 2T@!r%`0U0 F IPPY A PX A[ `aP`BOGA-@`PpP  P0  0P 0P 0 0 0P 0p@-@`P5/P`p00Q/A-@`pPU P U  Eٟ PO-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !P  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p; pXPpK pGOP X:I0 P0p  00$0/0- , 0/0 0/A-@8`P4p4TA !_)H\DG[O 0@-0 R  */`bIP/| O-SM@($P8` 0 Tp0SW fP8  lP08 @D 0oPЍ< 00S0bSV TS BSP DSTP@D  XS  xS 0dSTP@D0 0p? 000CS20['A O*Q. @"`"@4215052k 0@0@" `"@4CB5@5C0@4!0@ @!`04B0$P _TP@DþA0NS l^u^000  00 C$70@N TR0\~ R' W ࠣ࠳ ^Z W 3 "R Xja@NT@@ Q@T R_WNl^ u^X\U  p0@嶖!0@ @!`04B10 P- Y 0 @@  P3[t 0Җ@P?0̖@@ 0@ `04@ 0PPL ^bIO- g4Mp7 З0(0 00P0@0@H0  . H0P @@0P0h7 (0 30 4 0S0H0  87 H0P@@,0(P00S@X0`X\ZX _X$XX A BRS[ HRSHQSRHQDU@XRHQHQHQHQHQHQHQHQRRHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQRRDUHQHQRRDUSSRR4SR`SRSSSSSSSSSSRHQRRRRT{ HR@P@v 0S0 Q 0pU 1Pl@@W(0$  $ )0$PU` PE$P00S $PUV @,P@R000C S.00 0S00.0$ \0S00XS 0  EP6 ^.R0^.R- S QEP+B 0B P A BR#`H0  1PP0 0M0Q0  p!0P`P P<  P P _PUPPPUQ@0^(0D@ S0(0 㟙 2 0P2ۘ D0D0 "D0SZ! "Z\SDKD mPZ8 <QH0  H0$"8P80D00D0 4 'Z00 Q10800C000U U00'X0SA@J0UQ| 0$S_SPP 0 C R 0A0CSZiX0fSg D ባ PP 0 S S 0 S S 00C STZ 000@K @Ԡ 0@K Т P 0P1 Q0@K 9 X0$SG_ 0 0S 00S0 0Q K/`^NNpW>0S5 0PE>cX0ѠvS KS0>>ЀӱX0S '-7( pW r KR00#>>210S0,00t9h 00c0\,X0SD0G@S`eeffffffgg g,gpggXhdhphdheiiiiiej$j0j1gX0圅S H%x%0Z*\0hp0QE0P`FZ: D B0>00qS*0 Pm>px :pt> i٘娘I勗Z\BJ>;C \7 \\2 J>;C H \$ \\\D\l#w 00 0) \ \\\Dsdqa<0z 3 <0mg   !PX夘 T 0 S BP@ ב0\ ` \00X0T0P0H0d0O \"đ \\\⠑$0 0\嘑Pߑ0   000 0<0C1h0</l \ᙑ0 \+[\ᐑH \FR"ԓ冓8園Ngΐ5圏j΍倍2^/`!_GGHGyeIAHGN^HGJGNNN`0`(^/`^KGJG>gI N4JGZJGKG!gY FGfINTNNfIⷕ \♏\ڏ叏P֏\∏P↏Hℏ<₏8‏4\|zHx<Rݍ$ЍA-Q0@0 00p0 00'0 0XRX000 0$0 0冂-PP `fP❃C40Xp 0 30 Xpw Ѝ^/` LG$EGNNa`,0`p00@- 0 ^0 0 @P^P00000  0000GȈIP/ p@-Pᝌ @0CGSH㠑 0H0S(  (  00 CB\  H ȕ 1@  1# 1(ht1  `X1 B<1  $1 1 0  0@$ 0( 0, 0 0 0@4 0 8@t0p <8d@<XDp WGIGiKͪKJGGGGGGGG^ N^ N N Ns@-P.@`Y PD0@ 0<<00.000I P@@Ѝp N$EG N NO-M`@8 80P@@@<0@@@ P0,2@0Ѝ PQ @P s P  m P@_ @Pd.Z pP . W 0S 0P.S `PpUPTT 0T.S 8 00<0P @yUV0E0 @) R,NP,W* S.R S% SpR" S.R 0I ⼚  0R0S.S@E pS@EP X0!T 0PP0  R _R`P`@x NLO NޯQ* N N$EG N1 NC-Q$3TM0L00@3 L0 30 0 000 0;PP 2  02 0`,X pW `FV |",0 ,00,0\ "@0CP , p ,00 0S,0 ,0.  ,``,`> 00@0CP ݏ , R ,0W0,0 0 S Ώ ,0) ,00,00 ,0R ,0. ,`p`,` 00@0CP Ⰿ , % ,000,S ⣏ ,0 , ,0($SH  H 8 000 CB\ , ( ׍@ R p `Fڙ P@ { ,  ,00 0S,0TЍ^s N@-L0L0 000 ,0P0 0 30 % Ѝ^ NA- 0P R 0 R/ 0 $`@ p`@T 0P P 00Sx(G P 0S00C0<7 PP. o N NG$XH 00@-$M0  0S 0e| 0xx0 0 0000@P 6P@9 0 0 30 $Ѝ0^ N$EG N NP/0S 0p0`@- 0sp0`@-M0@Q00000| 0xx0E  000 @S 0000 0 30 o  rЍ^G$EGjGvG@-M1 000@ 00  $(,048<@D 0 Q 0t 00 R0u 00  Q 0h 00Q 0i` 0l0RT0j@ 0L0 H  0 0 30 Ѝ^G$EGGjGGG\GGI/N/ N0@-@40 3/P/@- 00S@oA-a PV@ڎ 0 R0 00S$Ak0p AS$XHO-2lM@0d00`prl 00SfPhPa"0S^0Ѻ   00,0(0@ 0a#P8 @ 00 0U#P 0S "$ 0R0k005@_0HH`@sl0 d0 30lЍ0"`00 d0 30  0 lЍOw^NN}QXE_N@-P 0S -N_NA-0Ml1 h!@0,00XX1Xa'TqP0L P&@1 SR 0  0 V0P 0 0S4 7`P0 h 0 ` 0pnjP- R0*<4-0p p=V0*< -0H H=0 0p`mỏP -ɏ ŋP h0l0<8  |P̐0l0P P/ +t hmP;c,0@ ;Z0000 \0 0`000. h!l1ZR/ᇌ P H1ZffE?1101\00Cd0\01x0%1t0h0d0Sl0SI i70 0 Q QoPQdQӵXpdQ p01# ph0 W  `:00S `S A`  00CSKꌪppةpة$ppppppppةة0 000CS 2B 0b;0p 0Q \`1\*`p0St80S 040 P:\ 058`5s `80|03/P 0 @`h0W Zuk1S 0^hl1S 0Vh1So` 0= i; 0ni1,S h0:# 0he! io R000 00K?00 娑`HP 00` 09j1S'  ` @\ RP  0p ~R q` ,!` br 101,1h 0d00Cd0h00C0 1$1(1l0S~\0s EV0S .P0d0h0\0S ] q`$! BRᤆ (Ag Wx0 a$a`(a堰&$q(1\W00$q( %q $1 `Gp03\0V0 z 0`` CR\ p \ `Y ( Ag p0 $a(`0t $aS (1x 0CRt `R$!x0 $!W` G 1`0` $10CC1\0}x0#C%p  >t `.$ 6` P (AKg $a(d0 0h0$0l00`0 0\0|0t 0 hZRPn[? C2e 0_ a c f h1 tR00P0aq l1Kh!,a00|0S <2L"02 P |0 |0S|`10S $Ro0 0'0S 0@000V?1 \001B?` 0p00x0dp0 T!`T1 | 0 Ў l I RP  d p h 0$ (0h  , DPd ( h1l $ l1p1t1t <D0$0pp>5a Q pAqr^^'N'N1`(N>Iy>IX>I@(N Nm(N(N!)N4)N_`JuJ)NG)N4`)N7*N*N$M*NHOGfIa`Z+N3N_`,`y+NtN$EG^+N[,N0`0`^EG,N-N0`.N/N0`0N2N]3NT`N(N0t $ l0S `0 Y dQ0X l00S0K_pu))ch1S(0S h0ZN0]*$B? Q -h ZyGh TqUDP<q]*EPP n.4Q*Og (0R_VSb 1S 1!010SG @A00M.(P003/P 003/\01K,Uh2l"0002AElATtP $.Q6*2 1 30 h0l1 @003/P 003/\0181So/ @00p.81s@!0 <NohP o/ o@00X.X3` cQ pQ0x S o/ U@00>. o/ KPk?1 TcS0S h0l. Ph i h11 v h1!10S 40S @00-i 0-$(50S @f00r-\S0-xiՃ 5%05wߍ@- 000000 bЍ//0@-m0 0 NTNN@-0@d @- R 00C0S0* 00 Ѝ>I$EGy>ICLp@-@P 1Q Pj f Pf Pf p0sf t3NO-P-qM`41!000 0< 00p00ࠟ%(Y<'0 0 30" 0l 00 00(00  RRSl'<'e ( ;/l$@'ЍaIIV^ GP]`?I?I?Ip@-@TpP=d @-@NN1NL^*RQ10* S1 ! Q0@-@A   0Q0@-@A   0/0S00//00S/1`@-X(0S3N@-ƊP"4N0S 0S/KI0 @-@P .@=p@-P@Cp ]4NA-@Qp 0S000} P0U&SPEU`V000u PFW00S}@-M @B00 aЍG-`Pz$nMhpYP@P 0 ЍG WP 0 @あ`VT(ЍG_`Ѝ4N4NPp@-`P0@hPsY@m0 p@苂4Np@-@PHpᘖ/_00Spp@/tw`@- b@r@4NDfN[Op@-@P T@dPP \Pp@H<,P>@i@@Pp6pR[O4N4N07@-P000@o'@7|0P| G @LP "y T 0 0 30  Ѝ0^DfN!gY@- @EP@^m @!gY5N@-0@^0`@-@P Q@@7 BP@@^L5Np@-(PU @P kYF1 =pp@-P`@;Pp៚P  p@諚io5NR0$   R R/LfNR0$   R R/TfNs@-`/oV0" 000R xYP0F@0SP  00 u 0 00 0 30 Y Ѝp^^EG@-pP1$M000! =+ @ ' 0P`0T  R T0` R V@F2W T00S6W崴T2 0S2  0` S SPP W  0t S S 00U I x @⭀ P0 0 30  ⡀ c @{ @P$Ѝ^5N5N5N!gY,,@-P U(0S V0`5Np@-PPx U`U P@ P@U@pq(@T 6(Pk66NT6Nb6Np@-pM0@0l00vP0 00`0`@cPW8  T%6V/ 0P l0 30 pЍp^0`6N$EG6N6N@-$M1`000)P 1 0 30 f $Ѝ@1@ R x1Y0 0d$PTP D d% `(0@S S 00'P봦-zn0S iV e0 0 30$ЍU @pUUPPLP " P  <@^6N1`0` VV7N/7NH7Nd7N|7N8N7N7N7Np@-Mp1P000m\\P PLA1^@0S$1" !01*00B`?E.P 00S V 003/,3/1P 0zx 00i>0a R?>00 0 30 Ѝp^ V0`66NԙN>I$EGy>IX>Itw`8N8NQ8N@-(M00$00K@PP*q0 @ 08 i @ t00SmP X  (0 $0 30 S ~ pa (Ѝ^ V0`66N8NJ^8Np@-@P PpEp@"G-`M2p@0\00P `<Ⱟ1<<0H0@00D0H0X0!<#@P OoB 0|00 SC?x  0 +0<00 0`T- #<<!0 0< 0c)<❯0 +0<00 0DT 00@ #< 0 +0<00 00@L<(0 \0 30 <` `Ѝ^1S4`9N[OC-M2@P000tP2"02^ 0SD:a`0S0SAZP= PP0D` C    "00w\}Za`TP0P 0d R PP  00C 0H1 0 30K J @HS 0 `p>_ZPtZ 102 S0 R$1L 0T0H00 00S 0 $$0T0P0P 0ԯPh P\JS 00Ѝ^0`6N$EG6N9N(^X4`R9Ny9N R 0 B R@-6P//p@-@P 0P 4@p@- 8@-@P0i@+i @9Nr:NQ 0@-T13/Po':N0@-LM0P0D00fP`z0@U@@T X,X00D0S Xp0 D0 30 GT-<0 D0 30 LЍ0@c9 X_ LЍ0^66N1`4,`A-@poth`D 00 S0 00 @ @P@0!P  @R  @= 0 0Ѝ ;N$EG6N:NJuJ0p@-S@P% P 0000 0Pl Uh 00 S P_ HP ep0S00E;N6N0@-@tM2P0l00] P԰ 00 SW 0S9 ߯0!fׯH0S Le1 LL0X0P00T0X0h0p  00 L 00 L <Ჯ#0?(!0ᘰLM᢯  0 0$ (00L 터ᒯᏯLF| 0 l0 30 @LP׫Q ^ @LP2| e_ @g }_ {_ tЍ0^q;N;N;N6pR1S;N[OXE_;N;N;N$Q;NO-PȠİ`Tp@T Ѝv00S  P zP@T }z0S wz G0 PPO-4 P aSX@g0 { Ѝ P$ 'V4 Hp/Pmg 0S  0P$SP` PVP`PH Ѷ`PwP`  @g0 {w Ẃ pP  rP (g0 {pW4N;N iT 8 Q ,0o00# @ݙO1`1TWTЍG  P 0 p{@ЍPUN0` ٗQPtn>N?Nd?N0`C_@N8yP @N-QANANDBNIGCN zXC_YENFEN>SC_' QGNHNܲO/IN|K JN8MNMNEOLQMN*OO NNɰONNNNOWONNQ5PN :O -PQNQNQNLհO^PXRNN_QsTNvTNtoO{TVN<VXN4[N [N߰O[N2U \N]N]NIy>IX>I0`/@-@P /p@-@`Px 0   R    Z 000pA-Pp@T0SL?0`3/00C0Z KP @-@d00 00P0 P40 0 30 k 0S Ѝ^0`@-@P0dM0\00 0S JnP`pt@0P 0S &NPFP :@iJ(0 \0 30 & `JCQ dЍ^gNDhN%hN hNA-@P0`M0\00 0SPTJ(`p开.@~0P 0S MPFP "J(0 \0 30 JP `Ѝ^chNDhN%hN hN@-@Q0M000t02p 0ll0h0 P40 0 30 0S Ѝ^R$EGgNhN0`M Ѝ@-@t00 00h0( R P40 0 30 (0S Ѝ^0`@-Mt0@000\0 0 0000S00 0 30 g @Ѝ^0`@-@_E(@y@-P@P%`TPPU! -023/ `P p D0P23/0D s Ѝ60 $ Ѝ@i  Ѝ@dhNhNiN@-Q`0@ 0 00 000,0 0 30 Ѝ^Gp@-(M0P 0$00t00( ` @d T@ 0 L@J m (0 $0 30 m P (Ѝp^0`2iN;iNG-@D`-<5M (P000p,YW4 0 30 dP pm0UP1Zm (ЍG( u0 Fm d tj?m O H( b0 0t051m t/m  tS( O0 0t0"m tm  t@( <0 0t0 m t m  t-|( )0 0t0l tl D t8( 0 0t0l tl (p :Ģ PU (2 0 30`Ѝ Ps MU 8  00 00<"Ġ ?[ 0 0 00 ˠl  0 0 00 (0 R 0000L<አ0S0S $ᯟ᫟0 ?ᡟ0 ? Ql ᛢsIl tFl s9l ტ(0`^aiNNnNAY!gYOyHpiNziNiNiNFHiNFM[OiNiNiNiN@-@W@p@-@PIBPHP00& p@$_`0p@-` @TpT @V IU P6IPPl00P00 003/ R00 00R0000ap@L0`4_`0@-,M0P@0$00x00S @00 0 0P @, k (0 $0 30 k N ,Ѝ0^^jN0@-PP1,M0$00!<10S01),!0((1( P @!T@ 0 yk 0 $0 30, @D0Px R S JPlPC\0 $0 30h,Ѝ0@H,0 $0 30 Gk M ,Ѝ0^0`EjN$EGgNjN2iNTjN hNxjN_`@-@0Q000 0S e00 H0 0 30 u ,0 0 30Ѝ@Ѝ^@-\0000L0 h0 00$0P 0 30 N Ѝ^0`0@-M0@0000 I @@ PUd0 0 30 0 P0`( R0S@Ѝ0^0`@-Pp@-P@\00 P0PPhdxx@8r,pp40`A-`p @TT `@.HU PPP0VX0 0-(+P (PU dK AK 0`D_`D0 P/@-S 0S 0ST0`@-P0M000 0SZP `p (P t0 0 30 @ 0P R0S !Ѝ^jNjNjN hNd1d!A-P000@p0@PP0 000PPPP P$P(P,P0P4P8P<0|P0P`& PPPPPPPPPPPPPPP C0 CP``Pg(})X0 0 30 + ;)8,>L Ѝ^0`0`p@-P@X 0S @  0S@4YU pJ L 0`_`p@-(M0P0$000@0S `U P00 0 0 T i <0 $0 30 , ui K (Ѝp^^kN kN0@-4M@dP)0 (P@$00!$0(0,0000 0َP 00, 0((0_dcJ K 4Ѝ0XkN$EGgN3kNO-\M1`0T000pQ0pPp@ 0┪@ㄱPY9l1 M-Q(P j PP09K oP j P  j PP @@Pz Y   *X 40 T0 30 $  \Ѝ^kN0`|kNmkNkNkNkNG-P1PM0L00J БPP ġ`@pWW9T1@ g Y6 p h1 L0 30S 0-S 3j P P069J P !j PP`TpI@P}{`P`dp&0 (p$0`00TP (dgI  PЍ^|kNkN0`mkNkN hNkN@-0MT1@0,00n818 4140(  $ $!喪 1!太1!坪 1!嘪1!00&0 000 000 $00 @00@000000,0 ,0 30 <  0Ѝ@^a`0`NnNkNlNT#mN nNGnNXnNH%pNC_( (pNC_ ppNC_PpNC_qNC_l-qNqqN^qNN00C0S/0@-*0 0 >I$EGCLy>I@-@P 0@- 03/QR 0Q / @-@P 003/G-M0Pp`0|00 0܀ 00 00p̠: Y 0 |0 30 0L 00x 0p0# 0`Sj7L  I 03/L$@ Ѝ^aIIV?I GP]`?I?Ip@-@P0 Sp0Sp p@-P@Up`@FH P/^ @-@-M0h000س pp0 0 30 ^  p hl0RP`d 0RPЍ^0/ 0`Q/@-@m Q܏ P/$0G 0P/( S @-S55$8qp@-08`@<0PPpG  p@ 0`p@-P8`@PP@  @p0`0@-lM0P0d000dl @  zp P80 d0 30 lp @olЍ0^qN0A-@0000S) pP0S$ z 봀`Eoo bR00S ̺ 0S``V    㺰P }(0 0 30 tH Ѝ^0`^h`@-D@P ᘰ㎺ 0`p@-S GG@-@Q@D @-BM0@010p00S c n   P 0 1 30 ' Bߍ^h`0@-Mt0@000d00S PU: E   0 0 30  Ѝ0^h`0000/00/0%P/P/@0@-0S 0 00I(0    1`(tN@tNBH^0 S!00@-~a@1` ርUtN000S S   @-wy1`utNtNtNktN qtN mtN iuN eJuN aeuN ]uN YuN UvNp@-P@T Y@nU 0ីP@@@0S OP@p0@-@T0P0S@< <<S 8, 00@d81`vN6vNBHAvNp@-H @Pb @p@-@f7n7@u7P/NY (00$ R/ R/D0S/k,`p@-@PP 0 0  0"0R 0|0x0l 0{% 0S X0 U 0H00pp@8EUp,1`qvNu^U^{^h^y^t^@^,HvN2QA-@`D901ĀPp`!` p0 )`P!SR ЍvNA-@90ĀPp`!` p0 '`P!SR dЍvN@-YP[vNp@-@PPP  p@^ p@YQwNwNg p@-@P,10 p@NA-Pp`h @`OṬ0 |x@峬t`@pQTQ@@QoA 噬` <` DЍ@$5` B $1` ^1`QwNBHxN8-MPxNp@-@D00S P#0 P,0(0 p@2 p@.^2Q,HxNxN@- 0P     1`qvNh00S/S@-@ DWvK0qP CP0 a#P^@-P 0 00 Ѝ8G$EGtNAyN@-~X0P @Lfa P<04^a P 0   ^N1`#N|yN@-P0  2^+NyNd10@-M000$0S%@ 0P0000 (0 ᡐP 10S  8R 0(,S Q  Q*0$00 0 30#  Q : S P040Q *e(0, 0 (0, :cP "HcЍ0^C^ 0 RP//^A- M @`8\4qW 0d 00?P)pP 00S 00007P  ЍAp" 000 ЍyN$EGtNyNx3`P/$0@ 0P/( S @-S--$ 8qP/$0@ 0P/( S @-S--$8qP/$0? 0P/( S @-S--$8qP/$0? 0P/( S @-S--$8q 00S/1A-(M Pp@`@"P L0PPc=@P(ЍA=` `$` V1s@-S  @0Sd0` 0\\00CP0go`6 o Ѝp @ ^zN$EGtNzN@-M\1`P000LAV B8a@T@ P0hp C& ( * , . >Xx08P&>3P"0500P R0 Q0 R PA@0 0 30 W Ѝ^C^0@-M<@P P G0S0 Ѝ00`@-@+P HH2P qP q@  Jώ@ V0`0N0@-M0 @ 0 0000P P %Pd0 0 30 2P  0R PPЍ0^@-P0DM@0<00p2P `P 00S  $ ` p2Wl0 <0 30 $0\ 00TT'$k] i] DЍ@W5$b] `] ? ^0` V1`zNzNBH0@-dM0 @P0\0000 [2(0,0"0D0@H0S0 \0 30 (0S$0S#3P 30SPP08P%P,0dЍ0^T0$ R/p@-@@P$0S 0 0,,T p@[p@ \^1`zNzNBH0[1`<0@-@0S ( (0<0gP@1`zNBHx0p@-@pPT@ d00SX @T L R@@ 0S 00T,,\ @ @ph^1`y^{^t^2Q,HvN0M0000Ѝ:H2`A-M2`0|00PU 000R@007 0a<4H"0( $pR$0(0  d0 0V LHd 坧d~\ AHd ($pE1( 0R4 1!01V pd~`"0(`$00 000754pdj`0(`$0(0 000(007@0S 0s 70S70 7d0 |0 30 o d\ > d0= d,= 7Ѝ^^zN {Na`x{N$EGtNN{N1`{N{NBH8Q 0@-M@@`PЍ0/^00Cso/^0/^C-$M0@̀`Ȑp000PP00PU0 0 30  U `  ` P[ [ [ > $Ѝ^sHsHp@-@P0S 0p0 0R QBoP0RT 0"PSU 00P 0P0(1`0`^ NVd07@-@000PP @000 0 30  Ѝ0^0`@-00nP 03SЍV1`01/1`MA-@M(A\0 10<000hPS/ `p$E$0 00$[ 0S d\0$e2$0 00$[ 0S $-$0h XX$Z <0 <0 30 F $Z c= @ЍAЍ/1`^{N|NBH |NHMp@-0M`<P 00,00P0k 00@c;X>xD00T00$0 ,0 30  0Ѝp@Ѝ/^0`6N$EGtN3|N00000/@-(Oό 0Ѝ1`P0( # Q \0/1`$4`04`$0 P#σ ? C/1`V00  Q/@-P@1`0@-$Mt0@000ōP 3P0P C ۴40 }0 0 30 $Ѝ0^ӟVp@-@-,1 MP000ឍPP 20`0 Vd0` 0ERo0P푴d0 3P@,0 0 30 H , Ѝp@3^ӟVr|N|N@R|NNJ|NA-XM1pP @0T0000`$ 0000W- 9P v2P D P 0  < 30  000<0@0$0]<Y $Y 0 T0 30 P H2Pp D "T0 č  $0 <:<Y $Y ; XЍ^ӟV|N|N|N}N@-P@2@-$M000.p]׌P*1P7 P10` 0ቍ `V-`P ᐌ0ӳ0 u|჌UᦌP \z81 0 30C 84nᒌPP 10`0 J0`훳 0=Jg0`퉳 0+LPyD`VP  +VD$Ѝ@*^(}NoOShMSN1}N:}NӟV|N@R|NNJL}NG-1hMp0 0d008D`p-0@0PS"pe|eff0SP;@I9@h0X0p2P P嗉Z{> ; P0 HX -P l0 d0 30hЍi0S 003/P $0 d0 30 hЍG^q}NtN@-PmPPY@}Np@-@d+-P pP 0U0S (0S 0# RPp0`1`00/1`00/1`00@/1`0@-0@+1`0@-0@"1`0@-0@A@1`@-0@@ R S  00000 Ѝk2`x3`0@S/@-}N@-@h~T cPH@8q0DTS@T@dO~N[O~NO-@P5M000墋P P~X P!p)100S0@p R P4`` 0`Pz^ 0 0 B RZ @ ^ @P , ^ P0 P\0S*0 0S:\ ^ P0 Q 0S*Zm  ^ P h0 \0S*H ^ P 0 P 0S*ZJ  x^ P 0 \0S*y g^ P 0 P 0S*iZ'  U^ PP0 \0S*(0 0SR:\  <^ P0 Q 0S*?U V 0@-S`M T`0@`PYP@ `ေ00T?0S T T T 8n'49 `P0DS@U0SaP &0` 0(0S 10S @TC'80 0 30 [@TЍ^~NH2`x3`RĈN1`1`~NJ~N~N~N~N~NTN~NNO~N(/p@-M@+P`00S  40S   0Y` 0 0L0 D0 P 0000/Ѝp@b7 0`0`p@-@Z( 0  P000 0$0 BH    Bh0l0p0t0x0|000000   C0* , 0D+Pl0` 0`  0 0040`P y8 ,000000*p0`0`0@-S @ |x0S  E@7 @- @JJ0@-@00000p0 10 00*P *P P `W P P00 @0 0 30  8  Ѝ^1`0` V@- x0x@0 00p0SL0 0 30 ޺ 0D0S i[r7 Ѝ^,`O-EM8P0 108 (0" 0p0 Cx8`Vd@ X00CS`kD6*Pm`*1@SvSv8 0B?o2 00r 0XP@0p$0D0(0H0,0L00000004*ǟX  *01\W@0B/L000 07,p=*X047*B/dX@:6 R6& D R1  .SU`@ 6 1 30 ? >0XPUp)P 5, S L&H000,000$0(05 R Wg X550S @000E|@5XP@00 ğT X(0pp 5 @0V5P 01(5 R L0J5~,V6 p@)0X00$0@0(0D0,0H000L00000040)@0P 00 0& 4P 40 0& 1j@|0P|000,,00d05X (0(0$0$0\P00 @0",R$dH$(0 0 (( ,0800<000,8⬯j430S X0,d0(?0X"020 S S Q@F|0P|000卷̐(0X0S x2t"0Pl2u0S X2YH"0$@2P0@p0W 10S 400000}?0400 4ȞS  CY d0 4X00PS 0($0+$d$K(00 (  0000匐 pS d 4 =5 8cS ^S Y dv4 dHEߍ^^1`VLN8-M0`,`oNNtN^QH]HN*NuN$EGONNN܀N0@-$M0P000@T z(00Sx0 0 30 s > @@ @@$Ѝ0@_(5 0 30$Ѝ0^1`&R;NBHM0@-dMpP@ 10\00!(00S 0Y 0000S (႓ 000P0x  XX@0X0'0@X&00 \0 30  X05 dЍ0@Ѝ/^ H$EGtNLN1`ŃNBH@-@P 1M0000w 00)P|0P C) # % ' * ( 0Z`pb'xX5pX`0P00 'n0 0 30 Ѝ^/N$EGtNNM0@-\Mh@P0 0P0p  G\Ѝ0@Ѝ/@-M01PP@0005`0+P0 00D5P0P C/ ) + - 0 5 0Z`p*bw'p5pp`0 )0 0 30 L Ѝ^~N$EGtNDNA-@'`BIn=p80 P>'82 Q4 P00@-@P0(v98@2 @-MP&@I`I=p,0We@ 0! 00 P (C@Ѝ@@- 0P`0 00p0Sx0 0 30 ޶ @D0S i$0S <@PhQg3 Ѝp^,`]`C-|dMx4$  @0003#03L4 # R44 $ P$t)&P 0P 0PP40PP C@0 C&P  R 3p4&0< 4 #8 0HpL00$@T pW2LPL%P, "430S 8&  'P T TT r٥P0ST#tt ႜtP Qϥ Trጂ彥P0ST0D0S ἥf020S ᦥP0ST4&w%ᣥP D3S %P6 %.10S 313p%P 1!016X53c1D;Pd @4%0 0 306 ص H#&&H#P0 TS % @tfP TY4%2 Q 3 p< 3 3 dЍ1`^ VV0`@)@4`0`d]`N,`‚N0`N$EGtNNT]`N@-@#@)p@-Mt1tQ0000S>\1` T1R& LL$P@ @w0$0 3%( $4&Ph0$  C " % %<p0P M40P @P0P0S hh$P 0S %.100$0 0 30 ( $Ѝp@^1`^N V0`V^`@-D 00`@4`@-M0@000P+ ѿP&$P $0 0 30 0Ѝ@/0  $ *&PP0  C    $$X0P(0 0 30Ѝ4/@^ V0`Vp@@-@@(0@-,M0@0$0000S 0 0- R0 00fP-PU|  P%0S40 $0 30 0P,Ѝ0^1`:NDNBH^N$EGtNbN0`A-M1Q000*a0!⼁0%$pW*1 0 30[ ` @0SJ0S 0SD YP!0LL<0 0 $ 0%Pd0#  C  ! $ #80l S % R 0S!0 0<0P S $ 0S d0` w00IH*+1 0S  Ѝ^V1`0`NNNBHNTN$1@-(M0$000S,0@000S 0 H -0S 0[ 000-0S 0 $0 30 γ (Ѝ@M  0%0SL0 $0 30(Ѝ00S H0l0 0,0^1`:NԂYBH^N$EGNtN0`N@-@p@-(M @` $ -  R 0 P-P  P$0Sh0 $0 30 v  0RP 0S H0KD 0@@0*(Ѝp^^1`:NBH'N0`N$EGtNEN@-dM0P0\00)`0 p0$ P|)|0 \0 30 9 @0Sm0S)/0 0^)A0 dЍ^1`N0`NBHp@-@PP-  D R 8 044n-0S0-0p^1`:NBHEN@-@MO-dMP`p 4ᘐ0\00pᶽPn"PG 0@$0(@ v$Z'T  TJ ` `{Z 30S #0z 0$00(0 U$@T3#03o 0P@$0}P U0E P0$0030S D_D00#0D4M  -@P 3#030S 0P⸢0CSPqD8X@-SR 0S= D1D0 0-ᦍ 0 ᡍ00\" 0D(嵿0 UP#0S DD0 00ᅍ0!囿DL 0S DD0!县DL  0S ,D,D0t!00L0wDL ,L 0SP D58SRP ? ?I@%P K0 \0 302 @ P00X 8/dDL . DzL ,>^V1`څNNBHQNTNtNhNNL$EGNN N3NRNpw`dЍOЍ/@-,M0@ `0$00p0 Pd0    00  $0 P $0 30 ,Ѝ^V1G-M0000S00S-d10S) @1P%oCp7Q0 Q?P  0P   %P &|P  0 ᡢP0 0 30# G ┕000 000z!P  0? P 0S|. SRtD. Ѝ␇^1`A-pM1@P0l0010S T0!0 0000T0kTK `000S0SB>pPh7'#P0P P 00'0 l0 30/ ذ PP P 0P ! 0PP 0PP 0TWK - &pЍ^1`wNNBHA-PM3Ps0L000S 4@^40#0041K /K  R R`J032F  P2 0000@T$3 #03(0S 04,40"彽4K "00VP+Q2 L0 30 D +@P0SP,@P +@P,@崂Tz0S "0S Q 009P0S 0440!h4J 000PU 0`S 4e0P!0 0$00040K4J 0SP0000S A=0 S Jq-0P44`0 ```4aJ yPh4\J ZJ , 4PЍ^1`\SNBHLJ$EGtNNهNNN-NO-|5-UM0L10 P\5eX%0TT5KP0S D%DD%T`@X0T T`p0S %0ϼ 5 @`@X0T TX4 $  ~q)5 @PhTT0p (@\0T(W V`4 D 9PU] J 3T ,X0SU# 0P$0   000!3 P* $ 0R) !RS 00D#((]I 0 01pS 00"II 1S QS 00 6zI 0%0̰[0 X13/P 0S ]H"0T0優82 P00d00U 5/50S d00 0 X0d0 S  S T ,@T 0X13/P 0S 0`13/@q T> P020TM(00 xP1y 0S- ތP W%T`V$\0 L1 30 I TC$d+ T>H Uߍ^uN$EGtN]N1`N;NBHNVN0`NɈNp`pw`NO-Mt;000@K40@0001S 0;,+0( (;PP ;*0 :0zS7 0S 0Ppbp`0* `IpH H 0 00%00S 0P P pvH 00P  gG0P0S 0SP ;) 0`S 0 09n눐 0 0 00x)00XX 8H  0᧞PH 0R S ()  0000S+r000)0SP8(08,x'S (ź X E;U` P 8#<(08880 zX0P000S 0T00S U1 0S.+Q.(PP 0 SP 0S?PF3pXPx7q0'0,h7P0SP7t'0870T01S $7~&07 7 0R S 00&FG kS 00&6zG 0#i:$( XP6PP 0SG 004&$$;P0S 0x0% MG `*P 5`%0\5ZPpF0 qS  0V0  0$0ʇ"Ƈ 0P%44۹G 0"U&40S; %͹6PpG Q ?* 0PSS 9. P@T* Q r) PpF 0" 40S 0t$0p 墹h40S0X0 0* 003 0 30 ( P P :3 P l30S P% PP _oR>9`WP>P _oR0PS [P 00S)0000 P00S 2`"0\\200pS d2@0S U  0P 0S 00X"[F 003R_oR챟0S* 0S' NP# P =1 90 #0S  0҆ U0!00 L&F T0S  PP1 00/000%0%04Pp@ F F P@4) dP $,- I) U<m Ѝ^yN$EGtNN,N1`PxNONBHXNzN0`NΉN N=N[NNvNNN+`N.N5HKNeN|NN܋NgNNPN^/NNN܌NN Vp@-@@P0S 4 4u0<00SpH Ppp@m1`NBH0 @-,MP@20$00ŵP2\"02寿%0S 2]"02<P9P0S 20S P  0`"``1 uE 0 -P/ @0$bS 0Sz1 $0 30V $P0S P w 0! 0 m 0! BE ?E <P@`pV  WP P W `c80 1`p `P0 ` p `0   ,Ѝ@ E w' Q2( P0v/[$0 $0 30,Ѝ@?( >( ^0`KN$EGNtNtN1`NÍNBHNڍN^G-M4@d0003#03@03PP0LSLS #0t@0㜣0T 1S |3vx#0tt3B00S _bp ,#00 :(0S 0S  P 0S%0S$0S 0l $0"0%0x000l0ldD B& 0S 0l|l04"  lQD 0 W00S\; E \0SL% 0R S 0lXl0!|pl-D "P 1`!0\\1;S 0l@l0 ѶlD  P,1!00#P 0S0 00xP 0S 0S0 00@6Pz80 0 30 5 PutsvЍ^1`OBHM@NPN%NyN$EGtNN0`NNNN,N-NN;NO-iM8 01000O7'0707t3P<$P 7'7:"/0,070@0000P X7T'0PP7垽I0P/7p00#P00S '`p`p`00S z{0 07GSjP! 0 00P`0S 0  SV >[ @Kl!<L[ A 묐0 S&  T P P (4o$03ɼ0S 0[l1 ][B f0S 6<IKP Q0S P<%0SqP 03["0$30302380H0 L HpPr0 C3 - / 1 4 cxP0U[#\P 0S: PIg$1l" .%0S 0S 0IW$10"I,B $0S0S2!018W0P S PI7$1!`PȴI B pS 0I'$1 帴IA J1S<Pk<1Sa<;0X0VP@OhX0 1 30 # [A XIA [X<iߍ^OBHM1`P0`@4`N$EGtN~N0`ʏN@)NN,N7NBNaIIVNpNfNNNN0@- M 0000R#(0@S$0S1S0S00S 00l ll6zA kF ,0 0 30 iA # Ѝ^1`ːNNBH@-lM1@Q0d00(0S 0S |!||D0P 0S H!<<;,8u4 /$0` RP0, S g.āPg-0 ֳpp\P- P0%0p0@0 d0 30 T S 8 $$岳KlЍ^1`N'NBHNANjNC-$M1`p000PPPt p@T)T T @T@ (0S 0S3S0 V0SH0L 0 0S  oRP (0S" 0S3S0 R0S0S 0S ` \N1P P,0 0 30 ޥ $Ѝ^1`ȑN NNBH0 R Q    @!R 1`0@-$M1@000P P1 0 30[ H0L 00S 0S H10S l0(!((A@ P@0S 00S W0 P 00S 00E0 ֲ;P0`  @!R !PP @ x" $Ѝ0^1`8NYNBHwNNp@-ML1HAP0000`0 $000!QH`40L RP-00 00 :0I@40T (0S U( R$ R% R 0S 0FHH+0 0 30 Ѝp^VO-@?-M0 20"00圀S/00凔"P0`0CS6d|0S D/)0XM $P ` d0WG`dЀ40S >.0>h@P 0S .<<p.@P0S  0\.0X 0 0 0'Q01O4P!  0`1S%  P 0`S d1 0-0嶱?00 0Q004PoP `mP !00 X- u0 f  `Pa0`S ,04 |00 0P00Q! " jvmQ! ! a<0S 0, X40S<+0=P ; 2 30ߍO: 2 30wߍOT;0S *TT 0 0 R 0Q  )P Q8< 0RP :0S p* 0 PP0j0 Rb 0S$* hZ0S *hh ɰ0 R  R^0(, Q\ R Y0S x) 声 0H309 2 30 4 Y0S 0) 吰0 H30 ߍO890S (88 }60 Ru  $ 0S(m i Pp  oP9 0S$ 0S 0$:~0P$5~0((ppK0 @T D0SPB(,0SP= 0S: ꠀX0?P0Q 0 R> -GP9 0SH' R vP 0-G0S 'DD0 Pu? C } y { 葍쁍0v 1! H0L0C0y8 0 -zGP~r x0P x0P 0x0P0ؐ܀0S P%呯00Su 0S 0F(0, 0 P{00S0S"S Rj Pu A y { } !1i00CSP}0SP$S O0 R| -F0S $DD@0m Pu?  C y { } L葍쁍0v 1!0P YmXx 0R؍: 0 f-F1 T00nqS㰱崡‘J800G0S "P3Sl>yP 0 *0PZ0 $F0SP>X00"\ ^ ` b d Xt1SK 8PFPA0S}Q0 ~P p P "N0 -0!~`R Q@D d!0 2 30ߍP u?y{}퀋"!1A00S 0S"S Re uy{}퀋^0`ǒNvN$EG;NtNNNNNN;NSNvNΔNN NNN N8NONgN֕NN+N N,MNNNmNN8-MȖNԖNN%NAN1`NN1`NNBH0 }P ;p P "0f0"Y!1 (,P ^ R"1`@P "n@0-QPr u?y{}퀋NK4,0v 1!0P3Sl 0S  0E(0, 0 *P %P Pu? C y { } P-P!mgX>P`X~`V00 R QB `kP t30S #ttRm1!Q Q- R*)P$ Q! R>>PZyP4` R0T S Y 40S$ cnMX>4P`% V % `V0@DT0 q 1!Al50S x%llԬV po % pˬ50S %¬0S PA-M3pS000q3Ѓ c  PL0  C     @T0T`3 0 30 + 00S 0S. @0$#$"W 0S 00"n(0S 0S0S @0"[9 f%0S 0S 00T"DG9 $0S0S,2("0$2$嗳sP 0S 00!(l9 %0S 1!010S 0S 0}0!`R9 0%01S d1D!0@1 P @b0(!R)x0P S 0Q0 &9 S 0A0 tҫ9 dn 9  Ѝ^1`VPNNȗNBHN'NUNN$EGsNtNNNɘNyNN-NC-Mh2hr000<0@X,000040|LS0$00(000UR0s0S/$eX\1 0 30q  0`S P>0St0PSx!xxc#P `P0S08`<00@0剢^1`OBHM.N,`@^,`p`CN0`RNvNNŸN$EGtNNV@),` V0`NP0 CD > @ B E 9|P0U8P 1St81U  003/P 003/P㗡{z0SP 0SdVa <1 S00]i`\24Ex ,DV$w 10S P Ov(0SBkߍO-MT1P0000P00S (!((j$a0 08@1p$0(04H a0 00彐0L000 <00800Sz<0Ht0S L00 0 30 ǔ ЍO  ^1`N NBHV@)p`A-@-PpT0`0̌00 0S  pp 00$P$@0 0 p 00p00p0RA-@-PpT0`0ퟌ00 0S  pp 00$P$@0 0 p 00p00p0YA-@-PpT0`0r00 0S  pp 00$P$@0 0 p 00p00p0BA-@-PpT0`0E00 0S  pp 00$P$@0 0 p 00p00p09A-P0M@`0p000P`H  0 0 30 ޓ Ѝ^A-P0M@`0p000P`  0 0 30 Ѝ^A-P0M@`0p000⚼P`ᔼňÈ  0 0 30 Ѝ^A-P0M@`0p000┐P`᎐ʐᛈ♈ █ 0 0 30 ` Ѝ^C-8-(LMX0D00,(gp tmpp8l(`qpdm`80ST8 P(0LL8mDD8@ 0(08 @0$8$x0 8 h080807n8 (07p 07`070707n t.  p.  l.  h. EABA@@*@@+@@$@@'@@1@@ @@,@@<@@5@@4@@\@@@?A@W<7 8(007a 0(70$70 707o7 (0 7P 07a06@06n6 (06a 06@060006 n6 (06a06 060600E06m6 (06a06 @0|60x65nt6 p(0h6a0`6 @0X60T6&nP6 L(0D6a0<6 @0460 0Em(6 $(06a06 060 600E06m5 (05a05@00 @m5 (05a 0505050 0Um%5 %54W5(@405,@@0|50@<00 @S$  $@P@(00 40 +4 0(%00  r(04 000$00T(-4.4 "4$404@04<00(0,000 00S P@(00x40 0: 0S , 0<$08247(04 000$00T(44 3$403@03<00(0,000 00S P@(0040 . 0S l 0P#0L1H(04 000$001`NhH%ONiXCp9`C_ ĈNNxC_tC_T? C_NhC_ĥNݥNP]`D?QHNfNN1`1`1`H2`2`^4?רNTCNNީN\4`$?NN-NhNXN?NNNJNdN?{NIN[NNpN>NаN N>N4`>nNxNMNnNX4`GNNPNN>NI̵NN-NN|NmNN߶NCNB&NN#N_` V0`V$4`LPX G>S G^`Rt^`^00=4_`<>^`NdN>@mN;NtN1`R R R000/ԻN0/R R R000/ḻN@-@@4/Ѝp@-@Tp P@C @-F p0@-$M0P@000PP PP\0 0 30 \ P00PP 0So$Ѝ0^@-@pnM@-@ 0@Ѝ@Ѝ/M@-@ 0@Ѝ@Ѝ/@-@0   R 0p@-S@P05/p@-@z R/  A-MpT1@P000㬯`/(`0,0000>P >m`к0p 0 p WX p{0S 0 ,PP 00 p)L0 0 30 q 0(Ѝ^G-M0Pp`0|00 0܀ 00 00p̠Y0 |0 30 y 0L 00x 0p0 0`S&L 03/L$@Ѝ^aIIV?I GP]`?I?IG-M0Pp`0|00 0܀ 00 00p̠Yt0 |0 30 / 0L 00x 0p0 0`SL[Y: 03/L$@QЍ^aIIV?I GP]`?I?IO-M1P`000p 0$ 00 00аaZ$)0 0 30 0T 00| 0 t0J 0aST$ 0 3/T$@Ѝ^aIIV?I GP]`?I?I0@-@0 SЍ@-@ 0 00 0S/0@-0ZA 0CHC1@LP*@-Q10* S1 !/ /988@-@P A@  0CHC1@LP*@-Q10* S1 !/ /988@-@P A p@-@ P r0 00S  3/ 0 000piY @-@abp@-@`V0$0CC1 p$P98p@-@ P >0 00S  3/ 0 000p5% @-@-.p@-@`V0$0CC1p$P98O-MP`  J p F@<0 080  $ 0`X 0CC1$0G#P0Ѝ T~ OG98O-MP`  2 p| F@<0 080  $ 0`X 0CC1\$0G#P0Ѝb TxNZ w OG98p@-P0`@000Ċᕂ pO-P` pFF@   $ 0`T0CC1+$0G#P0 T  2 S OG98p@-P0`@0 00P@ pO-P` pF@   ~$ z0`T0CC1$0G#P0 T   OG98@-@\0(M 0$00l0 @0@D(0Oo $0 30B Ԍ (Ѝ^O-p\2,M0$000!R' R02,"0((2~ `!$0P0 00   0 Q00 P_ (0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 : ,ЍO^G$EGGN98A-(MP1 B0$0008aRBQ000I> 0U0@q0 ګU   u' P0BC1U:0!0000 o L0 $0 30 0 P ]  (Ѝ^98 FG@-@\0(M 0$000 @0@D(0Oo $0 30B (Ѝ^O-p\2,M0$000!R' R02,"0((2f `!$0P0 00   0 Q00 P_ U0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  xP$ rPH lPl ᐠeP@D  ^P$  XP$(0$030 " ,ЍO^G$EGGN98A-(MP1 B0$0008aRBQ0001> 0U0@q0 ªU   ]& P0BC1U:0!0000 y L0 $0 30 ͊ 0 P g  (Ѝ^98 FGp@-`0M@P0000 00 0S 000  P0 ` 0$00h0 0 30Ѝp H0G 0S $0 0 30 Ѝp@^P]`>S GG0@- `S6 S @P @  9P  4P @W P6`V P PkV@1 D0 30h G @ P@@` P0`@PE P @ P @P @) PW P  P @W   50j@ P@@` P0`@PEU@0G@S `S S P  P @ P @LЍ^M$EGN,N`4`VO-$M3P0000000nu`eP@P! LPF 0S R SR9 ,PP  V00P- T OP& /[pW0Q00  j wP 0S0 R1S 0Tp0S@0S ]O0P 1!01'j qP U  P     ` 000PYP N E "r`nR@!@3@*T ?3T@!?C0 E E ` ` U [  0 A 020  H  ` 0      i 0i0 0 30 $Ѝ^N$EGNkN`4`OGp@-@`VP A p Pi07@-SP@Q03 0||0剛0 AP000 0000000000  0@@0di Ѝ0H$EG5H¾N 0@-S@Q 0,`p@-P@Tp" P @@-P 0 00A ЍJ$EGJJ$0@-@00 0N@-@P t @-@' s@-@`PP (0$ 0 0 00@Ѝp¿N$EGNNA-PQ@0S `@P@0W y" P03/@l4`p@-P 0@0S0p,`@-@tPW" o@-i0 P0P$0@->0 0幚0 0/N$EGNN0@-$03/A-Pl0`p000E0@  P03/,0 0 30 Ѕ  Ѝ^P 00H 0D 0@ 0< 08 04 00 0, 0( 0/w`w`w`w`hw`|w`lw`pw`w`$y`@-`@ pVP W 1 00\0S 0 00W  S003/pV@@PU ! P   0S003/0 0003/P P0 0 Ѝ@/KN$EG,NNyN,9`00@-@P@,`N@-0@-,`(0@-0 0_ Ѝ_C_DJN(OHO-0M0 00@& 0p@[0 0 30    & PP  0 gP0 "zx`vx Ѝ^l4`0@-@P`000S 0p000007/ O|(0 0 30 ۄ F| Ѝ^O-4M1@0,001P. 004 0 05 0Tq圁0CS700 `lP`Xc(P1@_PPQ@ 0S ;( ތ܌ (@V ͌ ˌɌ$0 ,0 30 ] 4Ѝ^l9` 9`&N?N,`nNN@-P|`@pT 0T 0@P0@ Ѝ P( 0$w 0 l4`NN//@-@P AO-pЀIqBQ0G@!@3`@)*TP "T@!0ˣ0P 0W  B  S0CXp AQP ЍB0 0 OG/@-㛣 @-LoO- M1@p`0(0 0YT1|!0x1xz0Sh1T!0P1!0* {\@P010S  0^!0S GGQNlN NheN /0@-@09T,M@-@p@-@`VP Ap(P p@-@  P3r0P 000p00O-4MpX  ! ,  @B !A!TTH!3`@*TP T@! 0(ख़ 0P   o@0  00 0 0 0 0j X(0( SW A}(0T# 00 ,0 30$ y  I( "Iq00 H ( "He00< pU 6 k(O4Ѝ^333OG //z/Ip@-@0SP003/| -_PpPp0Sp00Spp@00_P003/ 4`NaNHN@- A-@P寫4`^0 Tp07/ A^mJJ0@-$M0@000G 0G?PQ D҈ ,0 0 30 y  '$Ѝ0^N /Q 0W. 0 @-@ 0P@ @! "!07@-@0T  P 0#WPTPP Ѝ0p@-P@0S 0S SdP ` '\zXPT x^003/ 0Spp@(I   4`2QN N,H5NNoNp@-@P0S R |01@@p Q^@T p@T&P LCD @DOo0B03/Tp4`\NN@NN N'N@-D@0S003/0S003/ 4`p@-@P P  P p Pp@T 0PQ 00003/ 0Spp@Ќ4`,H2QkG~N NNp@-P`n P i P d @P _ Pp@t 0p ˌ@@0T0p@L塌@@DOo0B03/Tp4`,HL2QkGN N@NA-` @0CZS*Z 0PZ?S(  (  00 CBP   Z/8 0Z 0     QXp@PD0@ 0<<0u 0R"03/@TЍ4`N$EG NN0/80 \Q/`@- \ X0@ 4` N 00@s0PS/@-bo-0@-0000@0S S S t p,\T0 0 30 `w O \$]Ѝ@Ѝ/^4`JuJ N[OA-@P`Pp003/ P0PU o4`AW40@-1 P 0 00 Ѝ4`PO$EG N!Np@-@0Pp4`A-P@``Y P0`0003/`pN P0Q 2P 0\0 PU8 04㪋Q -4`AW4`kGMN N@-0@0/G-P8p`@ 0<09/0@T4`0P/040/P07@- 000@800P5/ 0 0 30 v  Ѝ0^4`/dNp@-Pd`@00S,0S20,0(0 00p@/004`$0@-@d50  4`@-Q|0M@000\0 0 30 ev 0 sa 0S P 00SЍ^$0@-@d50 @ 4` 0A-  1!0  1 p`[ P0C/S0^ 0@00S(  (  00 CBP  0 P?0 001 0 P9P< 0 0P0$P0(PF2Q<`A02ЍN$EG NNA-`W@@ 0 07 P@-Ps@-0@U`  3/P Ѝpp@-P@P 0S@p,0p@-P@d050  p@4`0@-MP@  0d50 Ѝ0@4`0G-@ᴐ`dP 50 '0S 003/d0P }V 0@S Pҙ  mVЍ4`r`NQO-\M3Pcsԓ0T004d 0#Pp尃vP묣@p0 ,Pp0 &P# 0d rP@0P PH0 P83 4,0,30$3 03 P0003P3 ,0202p 02020002lPD h@ 003/20 P003/ 0 R $0 2/$0[Z E42 K!/o b @[$"L@ 9U P@003/Р [@T4N@1440@080<@@@P@O@ @ |! 0'`@0S@TD1 @,081001p080 @010h0O 003/P003/0 4@4>0`00000 T0 30 xt \ЍOV4>^4`hC_C_}*NeV C_C__Q+ QTN,{J|NNPN|zN@|N$NXNdNAWx1SN NwQL'N4`kG/3yH/kG/N/M/N/0@-03/FN0@-03/IN0@-03/ڈyN0@-03/҈N0@-03/ʈN0@-03/ˆ N0@-03/庈@N0@-03/岈wN@-B 0P @o7@-@P? 0R 0t 00埈S0u 00 0w? 0R t0h\ 0h0 R X0i8 0D0S,0j 0$00 Ѝ0G$EGGjGGG\GGp@-@`P5/P`p00P/G-@`pPU P T  E+ PO-p(0BP?@ð[  J/T00!C!!@C`Do`X9/P 1@ 00F?`` `1F!P`F11@pO-@P`pE@WGYpHp1 `WpG05 pE G!`W Ѝq !x P rP04 k0P   0aP 0 p VPGpH MP[:I0 P =0P! 10  0 0R 0R\//0P#3/0!0 0//p@-P@9  opP/ @- @ @0P @- 㢀㟀NNp@-P@I00`I000V:0P#3pppPp@-P@@qVPMVPVPdr0$S U H0 h8 dU $0  !gYQ <P<V @>P>V W0S 0S0!@5Kp@-@PP 0S:Spx0P PO-0PM0`p@Xz PHHpti P7 pP0 0P$00S"W >P PЍ|Pxp0S!000 R0C0C00@@0ppQpGPp:Q0:Spp GX GP X/S0 Ro1z!010S2p<X700SI0GSF0Ss 0h 0P0IS90I 0  P1 0U Y h o_YP% 000<Sppd P P f(X) 0P X PQ00 RGPx> ,X0pG0SGWE [P@ P= 000.tN5K.NNN$EGnN3N@-M02`@0000SV~P 00MP0:S&S Sg "S[ P0;'0CSꐨ   Ĩ  p P00000+0C000% 0p0 G RW Kh :W,W00P00S > PP 0@ 0 30! Pm  0  00:S00 PP0S P 00000 P0000Ѝ^tN1p@-M0000S0 00݁SP@` ``V`x R S 0 0000S0x0|000>0S 0 V 0t0,0@ 0 30 l Ѝp^N$EGNnN NO-P@t0Mx `0 00|tp 40x|tp 0 30 l Ѝ^p@-4P:@P P@Tp`Q0@-@00+S00 -S000S 00C SLy :NA-`-PPPpD0@M pPtPxP|PP0 6\0X040LPx 0,000`$040P(080P40L0P 0@0<0 4 0` p0<@PЍha`LS@- 0:Y Ѝ0wB4 @-  R 9z  x@ea`VN/tNp@-Mx0`t@000Y0Q CSR @0 (z~_$@ z^`NNN@-h00 00  00 00AF0 0 30 k Ѝ^A-`p@PZP p@-@ `PV P `V P A,p P Fp@-@DPH\PU  k`PU ? cdPU  [hPU / SlPU ' K<:8p0@-@P0M000" 0S 000 0 P P$P 0S 00SS$ 0 B00(0 0 30 Ik fЍ0^4`@-h00 00  00 000 0 30 &k Ѝ^G-P01 M,`(!@000 0 000V(0 蠟p@X 000000000 0, N0 0 30 j E0S jW 00800 _W  Ѝ^d_`_a`7@-@0P000 RNPNPLx8 x 0 0 30 j  Ѝ0^V|1 40 30X j TT0SL1 $`X 000(00 0m"`0T0 T000(0 0,0000(000 0S"p 00S P 0U 00 0CS P PU@<Ѝ^a`a`O-M⤁`0 1 Q$00000pt_00 T$aL1 0 30K i 0S0   000p 0P$ M0 $B.0U0 U'0 0K0S 0P 00~$ars0 $p0  0 0C[0 R $ @Ѝx^xN$EGnNN@-P`W Ѝ` 0}@-@t00 000PH00 R @40 0 30 i PЍp^A-PM0 @0L000p0P000`P 000 /F0WV A<0 L0 30 h  PPЍ^0@ 0 12 S 00S @-/(^p@-`t 0 12S@P7 0 0Bs0RS  M0S`hp(^O-@0Z  cPJ`0U  IPPY  PW A0`aP`OGO-S5 @ሑ 0=@S0p1``FV^TaP 0 -@R   R6 1 0 30A @f  0=@S 00 0 03/P`F 0=@S 00 0 0PPEU 0=@S 00 0 00" 20k05#Q 000 PR^Ѝ^$M0 p@-@T 0P@0n@pp@辨@-Mp0@00000 0001@(0 0 30 e (@Ѝ^G-0M1P`0,00Y@0@0 ,0 301 e @ @@ 0C1T: R?  P @A 084! 0 ?0Ѝ^m۶O- @ (0S)0Z" .[PJ`U  IPPY  PW A`aP`OGO-@0Z 00 +PJ`0U0  IPPY  PW A`aP`OGp@-P0`MP0\00@0p040(  Ct`00 00\   0 ,000 0` $IB (0 \0 30 d 9 `Ѝp^\NO-cM✦1Pap060d@01000ptPS|`xp0d0 h0l000^B&R  pp0  Z 0R0 R00 ሀ0⌀0堀夀PX<:0Xh5 1 30R d Z0W 0 0  0  4$04儀00 p00t0 x0|0Y디 [t4 \tpy 804@0TN40Shp d  0 00 hp0d00 0000*000S 3#03xc\tp? )p0d0 hp0d0 h0#00@0D0H0L0P0T0p0tPP00xp0C|`100C(0K q3;000S 2vx"0t2x@Pk2@00L0 :(0W$P L00B 0CU0P0,0@XD0XP p\P`P$0$0S+$0C R%R+XL p`H0S  :000X0 S R;0 R7@qL0 p,$`0dHH0$0dh0lXP\P`PX@ PLuY@U/0S +H49@0D PPSD0L0PEEQL\Y@6'cߍN^`_d_hĺxN$EGnNNX$NuNXI?NO-4MPR2pX@0,000\0` 00000   9  Y |Z, @ 0   P 0R!R qF ` 㪂P? P 㤂0 000000000Y 0 0 0PP & < $P兂P (Pd0S@` RP0 ,0 30 b Q, p ?4Ѝ^NA-p0M@`000 @0@@Pἀ@0000 @\000Q <0 0 30 hb QEbЍ^O--0;CM010$0S- P @ B6 8 : < > @0DU0S ag90 0pP .$eP  30  0S  `V 0S **0 `  `0FR c900000SP0 C6 8 : < >  P .$#P R 0\ 12 S 0S P 0 0 000p00 p0GR  00S!0 :@P0 00S0 000尌 !d0A0P @P0 000@P 0 UTP v2 0  ~ 0 P 0SB 0塤P pP 00S7003/P0 C0s0S6 8 : < >  0 0S0000)&C 2`W@ !0 :!d00 600.$fP  2 0  P0S 0 0CSK0SH2Ӻ r Y 0P@  B ( R* , . 0 . R2 pPW`PdPhP_ @PPP`V`/;&R0 S n0T@S0@T@S@d0@C0S 4$04su ;`; ;00ǣ0 D4P 0 `00000P00008\p\0 lU&R \ R \0xJlx|x:&0C#SQ0U000 +Pl0p t BR1P匀刀P{ S  `Ѐ̀`&0C1S S&0C"1S$lV800I 01l00 ( P S P1S X 'l8000S 0? Xl000 0 00`0 tpm` `::0S 7L@l#MG) 0P^ 0@S 0 0S(0 R 0CS 0' 00qt0%(0S ^@_ R 0S  $0 1 30 _ Cߍ^X(^X^a`HN$EGnNdNm۶ FGN#NNO- MpᨀK2`P0(0 02@h xKl0 ` ` ` ` ` ` x` d 圐K` 0K` K` ` ` ` ` \0 < `0R  K KdU1 (0 30w =_ KlK00 0 |0 )KR)KRR  F 00M 0 `10  0 ~p wp ~0 0000000 xK0 0 xKKxK[90S P KX T P K  R 0@Kn@KXKq@KX`x`  xKK]K[K=XKKXK29XK~K-9K q"KT K^NsKO-`L:AMP 000p0@ S  iP  P  P GPP00P0P(tP$p0L`0S0D | |0R ||8̞D9 0 30I u^ |8(`D 0+0C0S  (0S(,00$S 0S\||0 0|(0|PT0X0S 4|Q|QW S0S S 0p0(0S/fp @pM\@@m0S0 p p0D X\||0p|QLP00X0\0`0d0h0l0: R CSRd\0|0|L0PSp0nSS0 S0n0p00t4L0~4040_48QT0L0S0 S S $`$0$0B$Q0S& x0S PD0L tLZP tAm!0  H0xNfd00L0X\ %R&R -} ` '}0 LP0$S% d0d0h0H0l000l0h0d00h } l00PT0X0S00HduXP0S`0Sh0SX0Sd0S0SjL0SX x0S0p0SL0P TS0 S0n0p00t L0 0 0↝ ^P6hS0Sj 0Sfp0x0S 0S 0 S Rt00p0|00S  QmT0L0kM&PX `0P h i|Xl00PH|0pS0t0cP^\L0S `600T0GEMdX OⵜDH(0S S 8mbmt0p00SD |Q'000 000 00|00 0农3pS 0p0 Aߍ^tNz7RO-M3P#`000000@08 8`0x0 P0<`8@Hb60S 0S 0S 00u,00 ,,jO0H00S0 ,  p$0(P,04p {P6P {,08000 040004000,0cAFpS| 8  00H0S/XP%p/ 0WP* 0C RPIP } PPEuX 0Y SPp0p0QPP  P0P0q|0 8000S0SWPP PV *0U SB0 98\0 0 30 I[ Q&C<,N8_Ѝ^4``NA-pMt2P@0l000000YP~ t0@0Y0 Tk51 l0 30s [ YY0p`S 40p`S BZ4lN0 000@9HpL`< 0X0&80$0(0,0 0 $0 Y$$$"5 5Y 0`D@ 0000  0R00\0X 0TT0goL08 0440_oQyxpЍ^NTnNyNNp@-PM @   l d0 `?ᔝ40 0 30 iZ ቝЍp^4`a`0@-Q0\M 0T00 o@P 0  z\,0 0000 0S Tn4U$0 T0 30 ,Z \Ѝ0^N4`/N@-Q0M 000nP@ 0  B\p0P `0` u00 0S TnR4TQ$0 0 30 Y Ѝ^N4`/NO-QM[Op<T $(7'07nW U 7'07nU ǟU UU\7h'0dd7nn` l7D'0@@7enh00H'p@ 47 p,00]"RCY g8Q 0S6&06>nȖ00@8@<@@@"0C1SU&"0!1St64&0006!nx<@Q0<8O@003/g'P W,]I0(P5U 0@D@SH@L@P@T@X@5_%0|5mG  ,_*"RpI|50%0,d5m먀00p1無pSㄱ<5$0 5m  CZ[   0  ᖵ 0 IhIvITX0\pX% C<480X00HTC@"0C1SP@TpT" G04H!$4/o b \0C/00P X# 2ГW  4 Wt3TpUpG-4W+\m 4x# P Wh W4  W 4aWT P  '44W* 92PGq Ђ4p VRh 2PU 9`P 0S&\ukF\kP`mP,_G@[<;40003H`L0VH`&"DzDH0PF0-Up  0PPCZ  PX LA0DpqHPLp00000\kP19P D ,7PDN8,T2pC Nl0 <1 30 W CPDN8,;2p* MQߍ^zN$EGnNUN;RN;R;RNN4`a`NNm۶NtN$NNNsKN(GNNGTQGG]YNOGN@-@P Au@-@P Ak 00  0  0 /@-@P AV@-@P AL 00  0  0 /O-Ѐ@IAtPAT0!03@p&*T` 2T@!$w`0U  IPPY  PX A `aP`BOG0 S 00/O-@0Z  uR5PJ`0U  IPPY  PW A`aP`OG @-O-Pp@0W 8pp ㍙G ` 8 X@ A`80i&@`OG@-@NN1NL^*Q10* S1 ! O-@0Z 00 PJ`0U0 0 IPPY ' PW AE`aP`OGO-Ѐ@IDAtPAT0!03@p%*T` 2T@!$v`0U0  IPPY  PX A `aP`BOG@-@NN1NL^*^Q10* S1 ! @-@p@-@`VP Ap4Pp@-P@_\000 S0 0 pO-0J$1L !\ PA\ @!@3 @p)*T` T@!4u`0 P  0-0 0PY4 UX A40@d&` Ѝ@4P  44PNb'vOG@-@0T @ Y|Ѝ^NC-M`AP 04V1p0|0004Fa@FO@T!H 0 0H0PHT @T:t0 |0 30 T @DH  P 0 4@Ѝ^N0@-LD0800<0 cރ_U DuDtWaDY|SR`Ѝ^NVN0`N3NÁQ$EGINNNzN5`NNNNNN00Co/5`@- p@p0p )h0 d d)`0 \ 0T0A'P0 L 0D0:'@ @@Ѝ@)*NN"5NVC_d'NC_ NN#Ns@-0`000@T j@00\0@ 0 30 KL P 4X  U0S @Ѝp^5`@ 0-  (, V@-@P 003/(P ( 0@-$M0@0000S 7mQ x0Pt0 8` 0 0 30 K $Ѝ0^/Np@-P@Up`8@@-@$0 0S/l0Q,5`/0@o/l0Sh h h Rl00 Rl  /,5`0  /0  /0S 0S s RS4S0 0 0H0/q0SQ@o/0S P// 0SL P//// 0/^0/a^0/^0/,5`@-  Ѝ7@- o-M0QP0 0000 0!000 0 30 ?K Ѝ^,5`@-PЍ@-P`Ѝd0@-`@000 A4 PpK 0S 0 0 30 K Ѝ^^p@-,@,P U4 pp2 0S p^I@-Q o7@-0P@HPW 'r0P*00S W @AT Ѝ085`A-p0 M@P000 0`000 08/80 00X (0 0 30 J  Ѝ^^p@-`P @00 < 0&Sp)[Ns@-@` 0P0 0S Px p0h hhW00 D< 0S P( p0$ WЍp,5`5NaNNNNA-@`p匀! pP 0S d0 WT u 0 S ,0( 0$$0_Ѝ,5`NNNN$EGNN@-@- 1@-,M0$000S30@S/p0S  r 0 {W F 0P0_0`S P o0 ttcW00 0S d0` 0\\0^,0 $0 30 I  ,Ѝ^,5`8NNNN/N\NN$EGNkN 0@-RL1$MHQ@0000"S r0!)Wm0S0S 0 W0 0 30+ I ~00S 1S0 S lr0x hhV S ar0P <<V63$Ѝ0^,5`NNNNNN@-@(U PU  @I 5` D Q@-@0t`Pp B033/0R5/00 ` 40 Ѝ@,5`p@-8M1@a0400L0 S3 P PkpPU+ ᪋0PCS8 q@1p)P@P $0S0SPP4 P  %0 R0 R 0S q0 ZV0 SV0 40 308ЍpS q@o0h XX:V~80 40 30 H 8Ѝp@pq^,5`)NFNNXNN@-(0@T`0s`l@,5`Ms@-P@ `|0V0000 VP L X80 0 30 H )Ѝp@Ѝ/^ N=G-p P@0 SaH" -]00@Ct Ra CRW@CF FT  FT  FT  T PE `UNp@-P@ 2 opT0@-@X13/P 0\13/@R@-2s0PP PP 0SP/ @-@ P(` J`p @00h0 0 30 H P`p  p@( &`Ѝp^p@-P P0@`0S V 00 03/U00s `p,5`N^ -NH0@- 0000 00 0 30 G Ѝ^p@-@Pp@ _pD0@-LP00, 0((0_\4@o Ѝ0`M$EGNNL0@-@3P40Z0 0,,0F\$8 PЍ0`M$EGN.ND0@-P00, 0((0-\4@o Ѝ0`M$EGNnND0@-P00, 0((0\4@o Ѝ0`M$EGNN@-@Q `&P7@4C-,MPH1U0$00 @PP 400CSP 1$030; G p"`PSR 0S!  o "P" 0K" 0 `T 0S  o 0\ PPST 0P P  ,Ѝ^,5`NNN3N@-M R@ vrP 0 00[$Ѝ8G$EGNNH0@-0S 8 88T4R 000S|P@賫,5`eNyNN@6`d^@-D@0S 14 01,0(1S1 01Ѝ,5`N0QNO-p-1lMQ`(0d00@1ᘠ娐s#!$0@ DV `p@60S  Pk0H! D 0@S 1 d0 30? SF 1P 1s aW " * p@ 0S o Pk0 0S00S 0ppS + P0S L 000ySlЍ^,5`NNNNN6`NIN 01S/],5`0@-M PQ0e 00Zpi@d  X 0L00`0p0 l Rh@ @P 0S 40 0(0@Ѝ0xN$EGnNN,5`NN@-0 0@033/Ѝ,5`p@-8M1 @0400R0P` h7 P+ PU 810S 1 40 30A E UPP %Z k0 PR `0S SN/N^NNFNQG-@M3@p 0<00c@X0\0P0 6 1S! p08d" P/  ;  XP 0T X1 33/UP0L0 0 000?MP0 0L02 <0 30 D  0 P|x" 0s R d"`X33/ 0L00S 08"0000EQ00000 000P0007PgJ@@ļ@< Q4S 0@S 1!0dx1sX0S @$"$0X!0088Q$K 0 00S 0L0P0S 0 P0L0P00yPn0S0 S 0 ||P0hS 0| XXPl 0s$Us0U@Ѝ^,5`NNNN@NrNNN$EGNNNNQNN@- RL0H 0DD0XP P 0oC ЍN$EGNN@- RD0@ 0<<0W0S P000 ЍN$EGNN1p@-(M0$000Q? 0@QSL kP0``00SA No0S 0S&  k 00!00NP:_0PS k PV j 0 05P y 0 $0 30 B S  k 0 ppP 0S  k 0\ @@P V Sȿ(Ѝp^,5`N4NNRX=I?N[NN0 @-\  @\@ 00 00p@-M MP:@ 00`0000L :  P Z00\0 0 30 \B 000ڍ Ѝp^7@-@$0@-@d0 33/@H ,5`0@-MP 0   P @TT0P 0LL0VS 0 0 30 B Ѝ0,5`^M$EGNN0@-$M0@000ePP p00S jT#޹00 0 30 A $Ѝ0@^,5`7^N@-M 4000000S 47#03V 0@S 38#03<A!qp` 0 S330S $yj$0# O#P$ PWP H30SP<*UY0S (3q#02$Tj$0"N$)Pb0S  Cj$ p$0"00N$ 0   R 0R Q S $!j$08"  NS 0"NLM1 0 30j  <Yp! sT+$+$ : @ B 00 0 0 V >0 0 30 ? Ѝ@~V0s * * 0 00$0 0 30Ѝ 됼^^8NNN<O-KM⤓QPA\a@`QXAdhq$^00d3=`#0\\3TX3YT0:$3 $1 30WKߍq $0 0 0S"$ # hq`QdXA\aPKߍOQO0  P?P @ `0<21@`0(00P@ `0P p ? 0 SSi00 0R0Y 0 R0P00@ ` P p0 Sl8$<hq`QdXA\aPKߍOK^PH$EGNTN0`,5` VG-8MR @204000S 0S' 0g0!K0S 0S !g0!K P 0S g0t!ddKH1 40 30I 6> ap`  P 0S 0  0%TPfP 0 X00 0mK#P`QػߦPѿ8Ѝ,5`^NNNN/NWN0h0dV0_V0/d/d//4/0/0@-@0KN@-@べM@-P$0X0@T l`c P@$(03/P Ѝp@Ѝ/,5`-$M 00 0$ЍD,6G- MH1@`PxC_NtC_NNNNN>N<`=p.`>/P@-(0$ 0 0\O010 ЍN$EGNlNNG-Q2pMR0l00@XPpRB/0 a0Z000D H2 033/^aP P0 #, EYG@P31!01O0 , P )_ (P(0s RST  ia|P (p፵2(]v1P0 S !0xG000 l0 30pЍS hG+ 0 00L000*^P h0 l0 30 9 pЍG'0000(0 l0 30pЍG2(^0`,5`.N$EGNNNNONlNNxN0@-M0@P00000033/P 040@033/84@x80@DOo 0 30B 9 zxöЍ0^,5`0`x2G-M00040S X22T"0P2PPN @Q<23("0$2(0$33/Po :᧿P ]`Pp$08P $0S,0S4040S30S$  'b 0!FS~P0S0S  b 04!((F i PVpXV  0 {`S 0S  a 0 F S 0S  a 0 pptF (`,40 0 30 9 "Ѝ^N$EGNNN,5`#NNNNENgNC-DM2@r0<00:e0Sg`VdPP` H0US$ u0S!YH` `0P * 0`S $a$`P J^0L!LLF$\D0Y S  $ `qa$0!00F$D B0 PS0 00PMS $Va$0 E$+000S PD0 <0 30 r8 $$ 답DЍ^,5`5NNNNNN$EGNNNMO-CMD 8?<00S .pE<⦧P <0P<0H@PH0L0<0厳00.> L < H0D@POm(  0$0! 0SPʴ40-L]H0)=< PH0LP"@PBp=p@DTN`=< PH0LPPp0S 4- $E 00P,H0HH00[P< 1 30 7 0 S l TlPl`T0,00p\ DT?l= 0$00 0崕P ,5`^1NURNfVMPὢP 0R H0 0 30 $3 Ѝ0@=0 0 30Ѝ0^0@-S@ 0p@-@0P  @j((gpO-P 4 KBS"ApBP@!@3@*T` T@!R` PZ@  UX A@c`@@PNq  @@PEqOG@-@@0 0 00T $0 0 30 2 Ѝ^O- MP1@`0(0 0͸50 P 00M P 0 (0 30( 2 P0 P 00S P UP0 \jP 4L0 PS ӦP` K^b`XOO- $MPp2@0(0 0~0 \ `ᶦP P2 (0 30 ;2 \0  M  ᰓP 20S ` }U\0  pPPp ݜ  ၦPP  Ҝ0p000 000 QPĜp ཛྷ aP` 0ᰜ14 8 00M #KZU 1 UP 00S BP "U1 t ዜ@  < 儜@0 <'Pp1pÏP K^b`XOO-`-(4M?p@000 0̷4VV V5V"`40F!PS0000000000000$H0000000000hP000000000ܨ0000000<\000d000̫0000000DD0 04TTT000000000طH0h00000000000Ĺd00L00000000000000000000ؼ(0ؽ 00@00о00000000000000000P0000000000@0d`00000000000d00 0,|000000Xx000000000000`00000 00000000000000000000@000xLLLL0LLL000$0LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL00d00000dd0<dLLLL0800LL000X0LLLLLLLtx7_V L KL0H 0S S =*, `P``f`F VP0d00000000Р6 6 `6 00 30G R/ `P`(L KL $`P``f$L KۼK0`P 姣`P``f L K̼K0 !嚣`P``f $b`P``fP   Y`P``f  Q`P``f$L Kᦼ1L`HP/RS 1/UV 1/UV 1/UV 1/UV 1/UV 1/UV 1/UV $1/UV (1/UV ,1/UV 01/UV 41/UV 81/UV <1/UV @1/UV{ H1/UVv P1/UVq X1/UVl `1/UVg d1/UVb h1/UV] p1/UVX 1/UVS 1/UVN 1/UVI 1/UVD 1/UV? 1/UV: 1/UV5 1/UV0 1/UV+ 1/UV& 1/UV! 1/UV 1/UV 1/UV 1/UV 1/UV 1/UV 1/UV 1/UV 1/UV 2/UV 1/UV 1/UV 1/UV (X`P``fD1/UV 1/UV (F`P``fL1/UV" \1/UV l1/UV t1/UV x1/UV 1/UV 1/UV 1/UVP (`P``fwT1/UV ( `P``fj|1/UV( `P``f]1/UV (`P``fP^%O OONOOOb`=Ob`XOO1/UV (`P``f5 2/UV (`P``f(2/UV (`P``f2/UV (`P``f1/UV`፳$ `PD|$L K2LH QS  (`P``f  |`P``f $t`P``f (l`P``f  d`P``f$ $\`P``f( $T`P``f,  LP `0 $D`P``f$L KᙺL0H 0 < Kᑺ4 <0K_`P`0L KT 00M`~K0 0 XP $30S `D$KP+C @  QPt 0 hT0 `ᅗT  `~ `wP  pqT0P` 0 < PP00 < PP00T , `P``f-<  P v`P`!@ $`P``f L K $< K 40S ܄Kᔲ  O< P``D $`P``f$L K(< K#K $K`P`,L Kֹ0< Kҹ#K $K`P`$L KŹ$K`P``fP ,\`P``f0L KᱹK0 P0  M` ᇍP h60S tP܄K.0q OOP0  `,< KዹP Ꮦ KWPP KR`P L KxL`H0V S *S񟗡00000d0d00T0$L KYK0} X 0 M` K+P 70S `P܄Kѱ$ NX0 0 :X YKX T$K`P``f(X0L K$00M`K0; X0  KP 80S_ `ٱP܄Kᓱ$ NX0 R X P Ÿ`P``f$L KLH0 X 0M ` KᶌP 90S( `㢱P܄K\$ }NX0 0 X KX ߕ$Kg`P``f$L K᧸K0 X0   M` KyP :0S `eP܄K$b @NX0  X ᨕK X ࡕ KF`P``fwX0L K$000MP0`00M`K0 X0  0K5P ;0S `!P܄K۰$ MX0 0 DX cL 00H Z P0 P D<0S `PX KMP0 p{ &X EpP ?  PfX 5P ۞`P``f X0L K$00M`K0 X0 KҋP <=0SD `㾰P܄Kx$ MX0 7 X K 0`P``f\  `|M K ` (^`P``f` $V`P``fd $N`P``f(L K᣷d Ks`P``fh  ;`P``fP $3P( ,-`P``fl  %`P``fX (`P``f~t (`P``fv(< KAT0< $ `P`ip (`P``fa L KU[0H0 L P *0  80OP' P(< KT0< 0 `P`?P *P08*P `L 0Pt 0`P``f&p 0`P``fX ,`P``fx  `P``f L KL0H 00$(< K< $`P`|  `P``f (`P``f L K޶L0H hRS* P:PRS 3CA 5 s" W3 VX" @@0$W00 00S  0 ڃP0S0ES0LS0FS@pVUA@V@ Ap@R VX @@p Ѝ^iOpO`7`M@-@  T0R000 @240 0 30 " {Ѝ@Ѝ/^ N O OO-1MX`0 00D@0 0\@SRZ P  0 0O0p 0C[   0 0 0 0zO0Pp 0CW  p 00 0#eO0Pp 0CW  [ 00 0 P5 @ 0CS*Ը  I 00 000 0 0 30 ! Ѝ^O-@0`@00P4p0؃᭶0 U P` 0@  DP D0 0400` ЍO` 0@  DP D0 0400[K,[K@-@<p0 P,0 0$ $0$$${ЍZK'M![KZKZKZK[K,[KP/$00P/( S @-SҊ뿊$@8q0P/( S @-SŠ믊(@333fff0p@-@PQU  R ׻0 0 000p P P 0C-p0LM4 0D00`0, 0FS0 4 0,t,嘐(0婣P @P,h\0 D0 30 ,_ԝ0 @pHPLЍ^0`"O\Ka`0s@-000000P`  U  R pr0S@ 00 ፻0 00 0 30 t Ѝp^^EGp@-PL`iK@P (/@P0@   @  0WKp`7`s@-P@` 0S00 , 0((0 50 Ѝp@ O$EGO:Op@-@80P5KP 0S  0p@Y p`7`@-@40"KP 0S Ѝ@5 Ѝ`7`O-M4@P U,`4 `$D4 p9(4 1 4  '[ 0 ~ z 3!r 0 `   t3!f 0 p  0 D3!Y 0      p˲PPPᰴQ@PAA2 < P 4 0 , P $t h \  $P     P        P0  t u` T H <  a P   QP兴 0   0 0X 0PЍ`7`GiK>iKTiKbiKOOOOOOOO O O O O# O- O4 O8 OB OK OT O] Oe Oo Ov O} O O O O OvN O O O O0@-M|0P000I0 0@PPP 0o0 0 30  Ѝ0^@-$M0@P000I0 P0Pʄ,aI0 1000 ᇽ 00Q0 0 30 r $Ѝ^ O@- L0000000,0P 0 30 Y Ѝ^@- L0000000,0P 0 30 A Ѝ^Mp@- BU0PXCb|ptld\Tp@Ѝ`7`8P|hlC-M\2p0|00Hm`PVH0! P0P^IP$A0^pT _A0^p0 @0 PڃBT  QY00>1H0S1H0dP!0p-  i P1 ( ` P@ . @QP0 -R 00.@@ T00000 |0 30 h   d2| `0`00000Ѝ^a` O[O OO-lM@H 40d00 PP `q@(0Y80 *L4 d0 30 ) 8lЍO1,T X60X  ᲡPb 0[S]T` T000803/ T000,0`00PT0 0 0T0080 T0,03/ @T000 03/`Y 0$06P!"  Y 5:0000ZX  Y ^1 03/ Y:tR1 K 0 1/P$0g4@004 ES V X1 d0 30flЍT@00(00,000080T P4 0T0080 TJ,0 3/'0T0080 T,0 3/(0T0080 T ,03/ 0 3/(T, 03/PDн  0D0<0 0 $0( ! 0U,0P000  0 0P5/ 0 3/P04004080 P<00~X;^0 OE Oa`p O O O O O0Rp@-(M`P0$00!10320RR@@S& 0oP 7T 0 P 000 000p0 0X0 P80 $0 30  0{0T 0(Ѝp^a`@ Od\L Ou OA-@pP`T(P "E "E000`00`00` 0 00 ` (@(O-M,:P00000B`?o`2RRRppR`R0Q0 000C S X-3 X@ ,P 0S p .0.GP`  pF0S L #0jF@< Y ,)0d2+P )P(P0 @ X0QP00  CP^ XX (0d+ 0 d|0S dtol/`/d^ZV H(0d* 0 d|0S dS/dFZW" '0d* $ԃ$0Sy =%' P7 0'70( $P P$b0Sh '0d*X 㮃XPW fX40H 0X00<0 0000P00800@,0@` PD 0HpL 0W ,>`)>40 R 0  |0HpL 0W >`>40< R 0  0 ( %/!/X 0SI %0dI*P BPP8 X X*=Xo+XP0(S ) @P D \A@X@X]+X0S 0X0(X0S X*_=}X0S X*T=rX0S X*I=gX0S X*>=\X0S X*3=`QX0S X*=8FX0S X*=;X0S X{*=0X0S Xp*=%X0S Xe*<X0S XZ*<pX0S XO*<HX0S XD*< X0S X9*<X0S X.*<X0S X#*<X0S X*<X0S X *<XX0S X*<0X0S X)<X0S X)<X0S X)x<X0S X)<X0S X)<hX0S X)<@u-P L0 0 30 ) Xd]XD$ PЍ^ O O O O O* O: OH O OT Om O@ O{ OZK'M![KZKZKZK[K,[K[O O!gY O O O O O O O O O0 O; O^ Oz O O O O O O O*O<O\O|OOOOOOOp@-pM1@P0l00 00000 00S `rP  !S;@01 l0 30E  (UnP C0`! 0 y!SR 0V ` 0`0$000$0 00(̎ (ǎ몕!0C 40 0,0RYpЍp^IGISYEUp@-P4`kC@Pp(0 p@]C`7`O-`5CMQ 0105"%05-8 ✅宼 P00 00U\5 1 30O < 0` H0D00p00P0 0@00h00L00X<0gDp 0[  DP $d រt@T10t0p` | 4 ZD 4T4  Oረd冨0p0t00S!@0G?0 F?]/ PA  P @pP.#40dZJo1$0媢1 0$$.}됐Y 0S   P   0S 00C S )  PDdApH=Z& 0S 00C S ) C(d&@>?ᳩ@P0 0A?PO 7UP 00Y4p8@<@PD0 4 ?0000"따[0S0 {? Y 4 000 0$|00S "R 0C 0 02N T0S0r ᐧX2 dp nn'0CY PTXpp0  0p00A  ` '0CY dW p ̸ p0H  0p0$ lA0ppG'0CWd<  p屸 p 00l0 p  B  tT Tቫ d↫  f ~ d{ $}0000$UX0 1 30  Qk= <ʑ2ȑa_ߍ^\O0`O}QO#ONROWOYEUTiK|XO--L2,M0$009 P@Ud0` p᜾2 0S1!01R(?PP P 0 0aQ! ` 0P`p0SpP  0H á T1@!0HH1+(cHL냐 @ !S} : `P A`(0`j&``X 0 0%L0 $0 30 :  Q! `(`` `` H ,ЍO}^`7`O$EGOcOaOBOOHA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0A-P0M@`0p000P`, 0 0 30  Ѝ^p@-@M10<00&1,❘!0 0,$0(0 0p ,P,⍘H!0 0,$0(0 04ۇ ,,}!0 0,$0(0 0ˇ` P ,@0  00`00P00 @000  00`00P00 @0H0 80 <0 30 Z ,u@Ѝp^`7`zO4_`$_`^` C_hC_lOO_OO^\OOO#OA-@`PpT  0 0Q00( Q0HP H@40 04p0pD 00T0E0T0E0T0E0T0E0T0E0T0E0T0E!D!E D E᭬p@-@`VP Ap )(Pm p@-@`VP A஍pHP≬O- 0G̰1 S{S@ ! 30`* S1F 0      ( U` Au(0㓫*`333OG`0S/0@-@`0@% #@ @-@ R/ @-@Q(@J p@-P @ (0, (0, 20#20###$$pO-@1@HA0T{AT ! 3P@p *T T@!H1  @ H Vp AH0㓔#p0Yԫ &GH 98qOGO-Ѐ@IAtD{PAT0!03@p&*T` 2T@!0`0U ᡫ IPPY ᜵ PX Aඌ`aP`BOG, 0P/ R R/7`8P/0S/lO  /0`p@-P@ P p0Pp@-$M 10@0000T00  00f%0Pp   ` 4/@0S 0 p0@ 0 30  Q `0@S@x< 9p$Ѝ^O$EGOtO7`T*OOP/r M@- @`P 00 00X;荋P 8!R $0 `D T0 0 30 E <(00 A4/Ѝp@Ѝ/^2O@- @0S 奥7`IO UO OP0$ ! / @@-+ (OO7`A-Pp`@T0S0S `@P (0S 3/P @$00 P >u 0V00Ay7`O0@-P000`0@@VP pP P0P@@T S P 8p$ 0 0 30  Ѝ^O0@-@03/P 0z 00^$Ѝ8N$EG8NQ8N@-M@ba;l0P Q P0 R<0P000b(Ѝ@/V0`p@-P>;,0@X003/a:p@yi0`@-@\00 00@UP @0 :P0 0 30 C Ѝ^Op@-Pu @Pt #p&OA-PQ1(M`0$00 tV0@Td @P3 TqLX H1D!0@@1#`0L0  PL 000004/P #Q L0@T#U @0L0x0 $0 30  Ì0@PUJt 8D@ό͌(Ѝ^POxO7`O$EGOOp7OOO^O<0@-@T0 9Pg#@y0`K@OP/$0n0P/( S @-SIx6x$^.8qP/$0Y0P/( S @-S4x!x$I.8q0/s@-`/oV0" 000R xQx0F@0SP 00 m0 00 0 30 Q Ѝp^^EG0p@-@PQU  R 0 0 000p P P 0MA- P0p@ 0,S# `- 0T  $   B/o"  ( R0U@9P pPPU ЍAЍ/881P 003/PE`"5iP5nPP9U:(O7`A-M@10|100X(00 00"0`$p,0P` 3/P j"40,3/P h_" 00 t0 |1 30 ݍ^O$EGOWOOOMC-,MH@PT 0p0$00Q9X0`0P00 09/ RE832 HP Ȉ,0 $0 30 U ,ЍCЍ/^G- M @@p1D000H`L9Pᦈ0P|1 0 30 5 0H`L@pD ЍG/8!RI0P 8Z 70 8@T 0 4/@T T  <0S  3/0@00p00P`0&\ 0XX0!r(0P 0 30 Ѝ^O/OQOa`O$EGOEO@-]M$1p@0l10`403/P w!\p00S )$ 0 l1 30% $0S0 0S0P0\0000P 0`0 kfp 0S81S]ߍ^O7`Op@-@8QU  p<,000 @-\  @\@ 00 00p@-`Fx0@T 80p@1/Q _P -PP $0S7PV@0`p@-@P`70 03/p@1 50S %0 P0S /x P0r P 0p P 0@T 0h }`e@2/@}60 p00007P/000@0N P 0+000 # Pa 0/P =Y $PS '{$03/pP 0S @$l 9? W= W; D@ ,P1 , 4P+  q 8  q < q (6P =P000 0P T0S00Sz QP5;\3pWw0Y lpzjQ\0S6PETH"  40 Q !0  0  |j!d0!0 0 pW  0J Pp 00 $ P0SS 0Xp W p @녈Q= ! 3{}p@x00S0S# $0o PHq 0p<1Wp00S Đѐ@040G00 HpFK5d$0@S=?ꯐ p35PЍ^7`AOOO7_hOO6HOO0`OOO/ODOVOfOzOOxO,5`OO ROO/OhD_BO^jOp@-M1@000`P/V @C7@  8P1 0 30X  < <1pH1CD!0@@1*<"T5 ᤩ `  @PJ0/SSF8@<040<@0/S  LL4L⪢4@0S4⤢1$`V  0P0"  PP P 4⊢P0SGUt1P$@UFX1 d0 30JlЍ`H P8P P0S  <0404:4LA S G]`@00/(O//@-@0@-@0ct(O@-@@-@P AO-Ѐ@IDAtnPAT0!03@p%*T` 2T@!#`0U0 v IPPY q PX A`aP`BOGA-@`Pp1P  +P0 $0P 0P 0 0 0P 0p@-@`P5/P`p00Q/A-@`pPU P U  E PO-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !P  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p; poPpK pGfP X:I0 P0p  0(&P/ݔ A-PĀ@T 0DS`Up:0GSvP`G ᜤ PU PWE_PUPPPU -Q0-SP Pj@5KG-p@`0S00Pg j P* W@ 0SW1P P \S0S  \S 'S"S @@@+I p00G SW ,pGo0rPpW/ IpppP,P P AQ0ӥp  PpppppP,P P⋒P0S pW AA8,O5K0@-@0S  0 P ,0 00S00 0 p@-(M1PP@0$00:` `n10000 00 00S U ??0 R S0SX?zU ?$?0 R SU ?`?0 R @0 $0 30  SU|l?@0SX  TSP  0D ~(Ѝp^1SM,OV,Ob,Om,Ou,O!gYiJIS/P0 CC00/A-Pp`p0p@0W ו)@Q @0@-S 0r 00 Ѝ,O$EG,O|,OA-`pPZpX `00@ ẖ @0@-S 0 00 Ѝ5-O$EG,O,O0@-S 0 00 Ѝ5-O$EG,O\-Op@-`P$V00@ m@p0@-S 0 00 Ѝ-O$EG,O-O0@-S 0 00 Ѝ0.O$EG,O-O0@-S 0 00 Ѝ0.O$EG,OX.Os@-@`0P0 P " 0S, [L[X[[ 0P0  PЍp 0P0  P  P 0P 0a 0 01.OT,O.O@-0MP0@0,000 C0   0Q 000S00S 0 0S00S0  0 ,0 30 = 0Ѝ^@-@Q b0S\\]] XЍ@TR P0 00Ѝ.OT,O.O  Q/@- 0@-S@0S]]^ ^ Q 0S` 0m Ѝ#$<+\0 00V,OM.OT,OX V`!T*0v S AQ0 8 DЍ^vP]8I8,OJOJ/O/O/OA-`0P0 00@0ptP  0 B000P0 `0  ,0 0 30 zЍ^0$0/0- , 0/0 0/A-@8`P4p4TA !_)H\DG[O 0@-0 R  !08`bIP/-y0DQ,0@-@1 @bQ4OPEGVEG}M0P/ss@-ff @00S/p@- ,@P(p@x08`!_dI[OP0@/-SCO- hLM8p0(0 0P@ @  P Q@@P8 (0 30  PUP)U =U-U 0ESL00E S$ȟ T R0E^ n Q.S*0Es0'.UB ,U0S PU @,P@ 0E Skikjiijkk,k>U^U ?U @EZ3q31 @@{U }0Es0S@@0@@(P00PU PE@P)P@000C S@.Q@ 0A Q 0A Q 0 U+ R9 \R 0C BP/o"X  JP O.Q U$0 5PPZ QP0005T 0 F U0A \ ,Up'p8LPl 0L PALPU27LUϠ,S V0(00^00^P\ P S V * `(p VP &KჄl&K0 0M0Q0ហ !P_U$U 0A0Cs0S$ P$U_U00 0E Q PAPEUiRY fRy 0P0sQ Y ᬝ PR8P PpU@0$Sb H3@K@P C_@KT 0HK @HPU 0 #1 2 S 0@ 'P6U 0"1 2So@p@p@p@p@p@p@p8pon@po@p@pp,@Kx`'\%X S P 0Q!0 H PQ Q QPI"QG S  C   Q =0B_0007Q.S PE^+CG 00Cs0S\3@ T T0 RCP1HR JPP(0P  BBQP X PR0C?o` 2P@Pʄ@ B@HP\  X R`B_S H0(0S`Q Xto`Q K08`^^+!0O@8`I0Og0O4`LdI 0R / 0PE PS $[ 00C0[(*`EW& 0`Yv 0s0S D 0S+0 0Y 70`z3Vp`|=0 Skp=`VOKvfi 0s S<-  R$0$ 0$0 S$1 000Ys 0z#S0 R,`V0 S <PE p~GWi0p{S  Sl,0"Ґ0S `,\ 3L0S0C00S $, !<P0 0;0ԐSY k@ 0>C0S00c20SQ0IMSmyzzzzzyyzzzzzz{{{{ {({({4{@{{{ |yH|H|H|H|H||P|||y8}H}8}H}\}}y}}}}}}}}~~~~(~4~@~L~X~d~d~t~~~~y@`hx4Xh0X*0P0 IDzR0S J00K00>CS?u0yS )3 0>CS+0 `REnFKP0@0@0z VE Bp~G0W0S0 Q)` 90JkS 9 ( 9 ( 巓Xi ߒh =$:$0 (00$04 ( 040a嚒g &$#$0 (00$04 ( 040J4($ l`4 PxP 4ΆP4 Rx7.t'0pp7 <03<0(0`$(4o4 $ᲺY;<0 3<0(`$ь(4X4 $P4$⪌(!0   000`4ᶌ 4H`4ᭌ0 4c?壎R嶍凌U弊#劉[ t e`D0pT54p04`0 `0 P` XK p0  /`00!000P 004 0P400P#PP004 040P00S 0#1 2 Si PyP 0 80040eYUP4`dP00 0TP4PPUP@ ^P 0 80P(`C 400 0P2 P0P0`0 0P 夾 R>S;Pt041P0S !:<20S200p`P r RT10"0S  J0Aa0 S > 0RR ֈ 0 = 30' 0[0>CSt4F(D$B @ PW44​$5(|sPHލ Ѝ^08`!_GGHGyeIAHG(6O^HGJG8O?O4O>gITOKGJGdI[O+JG@8`FOGO4JGZJGKG^N1On1O1O1O1O1O2O02OP2Op2O2O2O$EG2O2OnH2O(^EGRfIKGlHOKGKG@-Q0M@0 00`0 00 `ns00PP pP&̊$0` 0 30 5 Ѝ^08` LG$EG2O2OE//p@-P0@` 03/0 p@FA-`pP@8/ 0`06/0  Ѝ0@-@08\4O@-@q0@-@0 4O@-@ q@- M1@ 000~{0 000 000000000ID CA ?=; 9r6 420 .$0 0 30  Ѝ^4O@-0@0 0040000K00d00 Dr $0 0 30 j Ѝ^\4OO-`@P&PHP00000L0U HPt DDpHE`    LPAAD`HPL$KOG@-`d0@p000PD0 p0 `PDx0 0 30  Ѝ^nHC-PL`@p0' `0 9/ ЍC)Xp@-qP E@R P0! R  U\U p@0ES*̊؊؊؊؊؊؊؊؊؊؊؊؊؊؊hp@\TLD<4, x`cI5UIOIOIOIOIOIOIOIp@-Pņ @0CSȋ 0`0SP(  (  00 CBP 0   FC0 Dᚇ0 <]@wX 0R  @06၇(0 9pIOIOIOhIIOO-M@ 0H0[L0zЍO )Sl0"  `0`8/0:`p@0P R300X 0   [ H   Q  HQS 0 dP05/ dPH0`0P[S (0 US# ЍGS@R@RIOI0OX8`@-H0X8`0@-R$M@0000 *@PQP 0 0 @$P0 l 0@U @,0 0 30 p$Ѝ0^IOIO@-P!$M  8`g*@mgpP 0. 0 @ PU 00S H3D!00 0!@OU G@GA* 00 0 30+ W R Q U Pp0 0 30$Ѝ@Y*0 41$Ѝ@rjLp$Ѝ^JO`JOSJOgHhH@-Q00000|0x 0tt0 000 S 00,0 0 30   Ѝ^G$EGjGvG@-ML1 000@ 00  0 Q 0t 00R0u 00  Q 0h 00Q 0i` 0l0RT0j@ 0L0 H  0 0 30 Ѝ^G$EGGjGGG\GGIO/IO/IO///@-b 0 R   0 0 R0 0C0 0PP- PP 07@-@Q PR @ 0} Ѝ0p@-@P$` 0 0P 劎 P \00S   @8 0㲸(p@\KOC^nQ!gY:SbKOO- 0 R @`ܠ-@RP00pWV 07# Q  P0S 0S0 0=@S 000S p<(@P 5"@PUT $M1C-M000 0 RU P@-@R L!T C @D01 00 0 0 0 p`04$ P @ 0S0S*  1 C02 c0C /0 tF P SR@ SR@@(0 0 30 x Ѝ^$MoKOKO 0p@- R RPH對 @P 8(嫍 P 0 0@@DOoBp@SJOIOO-DM☩`l0@hp09儹0<00P U\ T  89 <0 30DЍp` 0 R14̙|̡x̡̡Ęd4̡P̡̡H̡̡̡̡\ 0 0  0 0 P8 <0 30T P|PW V ` 00 0 0 0P V  mP8  0=@S07P 0 00Fpehአx 0 I01 0 00 Cj 0 09) 0 00 5\^ 0X  t P KVڐG`V 00SD6 <0 30l p S86 <0 30HDЍO*, 0 0 S S 䥟0=@S05 0S ʐ5 <0 305 DЍO `  0 00  h 0 000 000 0 ""P  0 0 0 0 N0S 0 P 0 0 0 \0!ʲ0 (($3 <0 30Z4$ 0P  0 R R s d`wYʤr 0Py3 <0 30/DЍO腶V ^ * 0 0 0`0000 72 <0 30 V 0SDL2 <0 30 0S81 0pT`000S1 <0 30h W <  0 0 00 0 0  00  QP `  00 ``p1 <0 30l1!W0 <0 30H1t!NlXfSXY 0 `[H@ 0,xP<@ 0 P $0 <0 30xDЍOW^cKXE_IKOISKO6pRKO$M!gYmJKOSKOKOLO LOLOD_SLOIBR$LO,LO2LO;LOeLHJORL\SGLO@RRLOzbHkGcK}MkNHHYO-`M 8p LO MO@RcK}MNMO XA-P0@p`ᰆ P0 AA-R@`P  ; P P 3Pp00@P 'PWPX P  P@0@D p ώ 00pI07@-@P000 040 @@0 0 @@0  0 @0| @xt0p @l Ѝ0C_d8`YOMOSMOSPMOOOMGOOPOS3QO4%lJROHHROȯR@-P00 00t Z0SXi(fH0   0 0 30 Ѝ^SO'SOh8`A-0MX2 0,000P0 0$0(0,A R &0S5f 00(Sh 0P$ 0 0 00 04: 0@T` $P 0p11SL 0S0 C 1CAX 猅 PH 0 ,R0 0)R `p 0 )R0 00/ 0 0$00 00D wD0 ,0 30 80 0 ( 0Ѝ^;SO'SOxSOSOSOh8`@-@P00 00 0S R Fo@Ao=odNq@0 0 30 4W@qeЍ^SOGTO[OTTO@-@P00 00 0Sh R g oj@oeodavq@0 0 30 4hqeЍ^TOGTO[OTTOA-@1M쁟P000``TPPU 0-S @T 0S( BqeP@p D P d > P P 8 PP <O`PO`P@ P6 @0 0@qT$V 000 000   `P  0r 0 [vn `qn p0 0 30  Ѝ^ݙOTOO7EJTOTTORUO0@-P01LM 8@0D000 80 8 00p00S P Rfx8P<0S  4 p40 4 400p\080X0<0 ; 0p40 D0 30 0pdLЍ0^TTO - 0/p@-@P00ShpPcO-` 0(S Pp@VX  0RX P@F @ Z H P @ @P0ӗ/YOp@-P@T` P@D rP "cT"^0 0p@TP P T` P0D`@D@\Q"Q\<90@ P/_P A@P//O-M x4p `000 U#m* @PP0Y3#/Z  R" *PY Y :*P /P0BP0P 0/PIY 0 P0 J R.Z  R<  0 B R8X@0Y 0 :  ᗂ P  0+ B@ 00K S P.[P @Y DP000 PEP0 000C02 0 30 / @ Y:'Zi@YXPi  LZUPb'\v'Z LZUP  2Q"0 2 )0'STv  B\S@ R@ LZUQ _ 1!010"S SZ \SQ Q K0 P0A QY  BX 0 Sᭇ 0@Y: ~ P xP"Z# Y*PYᰰ%*P0 0 0PEP0000C0jY:"Z LZUQ"P"ZY<Ѝ^UOVOdIcVOTVOUOVOiKVOWOZOdIp@-0M|1 P0,0000!0 0"0SD1C@!0<1< 0@s(1!01` 0SP   B0  0 P ! 00R 0P0 P ,0 30 P  0 0C  zP ! 00RP ( {>0Ѝp^WO$EG9WOUOWOWOp@-M0P`000 00P0@0  sJ@,0 0 30 K 7hbЍp^@-WO0Q   /xO-M0 0P0h9000 @0 PppTppW $ N0S 00 0 0P@TE P @0唠$00 @  Ps x0|0 0t@tPb`@4@0`V8@<0@@  1F  P840 080@0 T(0t,0`00t0x0'd0h0l0( ; P@ P48PN x0SKt00(SGtdWhp0 0tP  Ad(-ax tR:0(S6 )S=Y1d0v 0G`FCVd, h0    d 00( ph 0, l 00 d0h0l0dW"(Wt ~5 0 30t D I 0S 0 B0A GY,Sv d00GCV,0(C AR0A2 T B S *QQ <  `H`pL` D`T`X`\p``d`fp`吅 xt|pT`tP`P D0@Pt0 H0tGx00st0td 0pX` Vp T̅ P W TDQVT00(Sp W )SpGW 0 0S[W wTsH0P0V0#S%[h0 d0 4 p\2D Ct0td 0V0#S0#S4F[~ h0S{d0 #Rw0#StV0,S 0 T0 4 p2   D`Tt ZPV T X 80R4T;| P0 0S H DyX`VT00,S 0 T0 4 p2 DT b`t0t 0$P X0ST0 #R0#S V  DGH0ZP0Uddt`Tt 0 T0 4 yp 2"0(0 Dy0TD,p*p( `Dp_W T Y& I DPP}W WЍ^^EGIXOXODXOYOXOXOYOXOYO=YOYOYO6MC-DM@0P0<00` @p@@5 $ (@0@4@,@8@P ,p0 <0 30 p0 ,\P ,0,0{,p_DЍ^G-p0 M@P`000 [P Y* B 0 0p0 %P v R v0 00 0 30 C Ѝ^p@-(M0@P0$00`ᾃ 0 0  0P   @ ,0 $0 30  5_(Ѝp^@-@P t @- R,0( 0$$0 ЍT$EGUOUO0@-S@ 0S00p@-@P`0PS `PpA-@Pp0`PS  n P@-@P A]G-0HC2~sKAS@!@3@`(*TP >3T@!iP 0    YN \ LW  AN] RP>C  OG40p@-P@ Pp p@h8` @-@X@zh8`ZOM@-P $`0V000` p00S00 0 30 > @0H phP400 p00H00S=0A0 i?^ Ѝ@Ѝ/^i_ZO@-@00i+^0  h8`0@-MP@1@P@00000 E   aP 8ORP 00#ሿx7|0D00T0H 4 } 40P4 0 r 4i0S x x0Px 0 r xi,0 0 30 i]Ѝ0^p@-@T P0CS*w 00S(  (  00 CB\  pp@'P/r 0S/P/p@-@P0p@P0@-@@0p@-`@ p@P00SPP 0㶤p@-`@P  pp@-P@  p@p@-P`P0@ C0CP00pO- M0Pp`0(0 0a @ B BP0000W 00 p00M W 40 (0 30 p K^1A-000p@P0[ aP [Mb0`01S L0`P0 * /0 0P0 0 30 S<f0S Ѝ^l8`^+)HP7@-R Ѝ0RG \ @Q? A@^PPU^PNPP@U\Q0  $00& 00 PE N@ @ \R@00 0,00Pd@[O$EGK[O[O[Op@-@P{ Pp p@A- M0P`p0000 0bs@Ps@P 0f{ P @@0 0 30  !pP Ѝ^0@-S (0j$ 0 0@Ѝ\O$EG[O[O@-P0 00 Ѝ\O$EG[O \O0S $0@-o0 000/y\O$EGL\O[OA-`@\PP@p P 0PU0 RW  T Rp@@- @jP0  -$M 0 P@0 00s0 0 30 $Ѝ^-$M L  0 ,s0 0 30 e $Ѝ^X@-@Pp`( 0CSu 0P0S(  (  00 CBP  PH 0D C@0 `80P00q ЍPp@-@@q@-@`0S R $8x 6xTPD0 @ <0 30 } $%x #xZDЍ^i_\OO-TM|0Pxp00 0 20L000S# P0@  C0C0 0  000(1 L030 @ TЍOq  P 0`   R   0xy @PZ0 [  400@ _y  P0 [R V 00S4ww Iy P0 \PX0 L0 30TЍ 0  040,00c=4wwY^i_\O@-0000`Ѝ@-0WЍ@-PL`00@`0P0 H( 000`@Ѝp!gY\O\O@-p(1DM `0<00PkP& @0S R  < 2 0DЍ@p0S  a$^00S $&w $w`PX0 <0 30DЍ0 0$0,00<$w wY^i_]Op@-`0 MP000 @P ( g@v,0 0 30 > v[Y Ѝp^p@-`@(M0 P0$00  F 0 `0 6/ v,0 $0 30  v4Y(Ѝp^@-`0,MP@ 0$00  ` bP vt0 $0 30 P 0 p007/ HP vX,Ѝ^P/m Qɖp@-P0`0D@6/OoB!cU@p9Q@ XY0PS b'@YY,`O-`pplPdY0S  0 /o"@S 0 /o"t8`H{)x ,00S/ 00S/0@-1dp``p`t8`7]O0P/( S @-SEE/UUU P/0*W7@-@P| 0 x Ѝ00p@-@PQU  R v0 0 000p P P 00s@-000000P`  U  R pD0S@ u00 v0 00 0 30  Ѝp^^EGp@-@P| 05c9=?0PE p@yG0 @-\  @\@ 00 000/t8`0@-M 18@0005 PP-a巻ӻSH0: S .03304@@x@0/S 0,0 0 30 WЍ0^|]O|8`hD_]Ot8`0@-SM@   _P  :00<0 0 30 Z  )sWЍ0^RX0@-0 tMP@ l  0S  P0: S 0000S ^P  0SD0 l0 30   t/WtЍ0^t8`G-0@`$0D0S TS뼀弐张P0,0GAoQ WWPX`PpPU ZPUp0D0 ^0SW3/pW,`,`]`,`0-Q 0  @-`@$0[ $[P d (`T$/\dPU HsD08 PPPo0d0 Ѝp@tt8`^8`]O8`O-MXr@ l`h0[ h[P ("$Th\PU  C"0$A먀T plP0J 0CбSa0*pZAppp000l`thЍO[t PW [@7WW[0WQV0 0CX!aV lP0I `PppW  PpG,tWo0P哖&U `sp  P`FtP`V ZVt8`^8`!gY;>H8`9`O-IM?@ 010P @00$@(@,@0@4@ ?`|\h?@d/d0 A_T?@P?@-_0D0$_00 RP (m-nl ?3>P$ AOnACs0S n A>n>A1s A4|A,A(sm0800[HZP <>8 0#Z,~00P0` 0@>D- x p 0SP-D02 R DP P P @ P<DLTx?P BP000]X@ P P4<@`00x< X [H im54< @`0 0}P{0P0 P t0000000Q;0+^a0S w0 0VP040Q000I ,E00B00? PP0PQ  : PP0PQ -%:: : 680*0S000S 0 0: PN0P0 P0PS P0D0 L0H0T ydP:0S1C/!A 11S 0S mAq0  0S}d0倩S Xh AH@X 0A`pp0Xq000S y] HXR80!`p0 (80 *<0 @0080_0S P]`|p%0S D]@0D0 +H0 -L0 .0 00D=ᾺỺḺᵺᲺ᯺ᬺ0Sᬷ 姷0S ᛺DpHW `HC?1x7PalQF QU!P勷 u!Au U* APA.q0S w0S pW0 0g^\0T&\\0TUqqpD0AppppD׫pp8ѫ؀X \`M0Sr P\`T g庹hc\徰̔P0SPPy\`T hNl塹Jm\奰00P )8jOjOjOjOkOIkO p$^,kOD,_ kO7_^7_kOkO6H7_a`\iP` ,␖ QA@o  YPA6oT1Iߍp@- Q Q Q\R@ZtRkP@oRLR@ZcRaRp@-@Qp@-TM1@qP0L000000`0 0S 04N Sd QR0P /R` /R 4,+nnCQ`0 v 00 Q  S $ Q $ S Zr1s444nnnH0 L0 30 44nTЍ^t8`lO|8`*)S@-@P AOO-pЀIq=Q0G@!@3`@)*TP "T@!00P 0W  B  S0CXp AgOQP ЍB0 0 OGO-Ѐ@IDAt=PAT0!03@p%*T` 2T@!<`0U0 n IPPY  x PX A%O`aP`BOG 0CH1@LP*@-t=Q10* S1 !/ /᫪UUUp@-@PTp@m<0S/0@-@<0$m m@质@-@A-p`@PTP@PTQ)PO-`p  PJ@P PmZp[0  0C10H#0 PpPmPT{mhTPOOGA-`@AP@0ApWOd PpGmꫪ@-sO-@1,MPp0$000B`@?à T% `FoT`!T @7`D  o`WT(V$ P @#0F?`∀0HS!X 00PT X!@  m0 $0 30 X ,Ѝ^p@-8M0`P@@D0400A]X0U0 ll0 40 30 / 8Ѝp^p@-0 M@A0007`nPP@D l,0 0 30  Ѝp^O-DM1 @p`0<00PF U1WQ'pEp G!$0 :$lW  l0F`FS L1 <0 30L pG{l vPE%FP  P   P P P3q 0P0EPPE[ :pG ` P qDЍ^C-$M0P000 @`PV0 0 30 o pP PEzQU lP0II PE%$Ѝ^P/p@-@PA`T0!/o b 8 U ]UpPp@ꫪO-`5oM@R010 000 0$0 0,0Q$0(, 0S g gagk1S p P P a000akU 0S ga/!gUgkX1S Tߌ P L0000  Ps [ [rP' [rP" Ugggbk[`k[goagWk P(0: SPaHk[FkP p0W a0#6`0G0PaW0S2A  0PR%쐍P~k  uk p젝`Z7 0PJ0CS: +    {#1! P  `1A0X#`0⪥ . Ujh k h {k  g=M QM⎥  U"ggj1S _ P 0S h h P  l0 1 30 gaj ~j|j`Laoߍ^$QI*)SOGfI////// //0/02t9`0p@-@PQU  R nj0 0 000p P P 0@-8MP0 @04000 D$00 0000 00 @0P lXU @6(0 40 30 P -mL8Ѝ^qO9`!gY0@-Q0,M0$00 @PỚ0 0000 00 0m  l}fL0 $0 30  @0niT-L,Ѝ0^1SlOt9`lO0@-DMP0(@  0<000 D,00 00 0000$@f P0 <0 30 QPL PLKDЍ0^qO9`   0@-$M 2PB0001!0V?PԩP0000\1[WPP 00 0 0!IWQx1[xPP l000 \ 0@!@HI8Q1[,PP 000  0 IPP `1 P*Ԩ|1  P"̨1  PĨ0  0080 0 30 F PcK04$Ѝ0^t9`C_lO2mO?mO^=:`6nO:`;`nO ;`:` BoOx" ToOh"| eoOX";`DpOxoO:`@-@P )` O-@p,MP`pp0 &0 pT $0($0 <R 0  0$ `,ЍwJ!gYlO ᯳굺HC-4M⨒@2 `0,00Wc2 p"00|@xRt2 pp"00T@\ 0 @$a@PPg42 0$a @@PP60 @$a@PP30 @$a@PP0 @$a@PP凩0 @$a@PP塩p 0 @$a@PP廩H 0 @$a@PP@ $0 @$a@PP(0 @$a@PPT,0 @$a@PP#0 $0a0@ @PP埨 0 ,0 30 ; 4Ѝ$;`^8qO\;`AqOqOqO;`%qOrO^ rOFrOtL$XHrO*rOO;H$EGrOsO0P 0 f5!gYQrO0P 0 ]r!gYQrOgEsO0 T;`EsOG-@,P(p` ЂȲ  P d XpL帲HD@崲0 ᮲PU@G娲VsO 'HHLDShO[Op@-@Pm `70PpT  S R R Q Rp@@- Mh0@000 ZT 2 @uf(0 0 30 - fJI Ѝ^]sOdsO,0Q$0@-p0@^`@-L@ 0 S0S 0S$_00@ @g T;`)CG (@-XPX[ @isO@-`PX0T 0PP0LPp @0 xP@TP ЍsO$EGrOsOhOO-PRMp@ ` 0`(P 0P 00o V 0 P ! 0X 0  0Ѝ0S ;P PO-M0@P ` pX P0TЍ0W0 S psY  :0V`P pW 8`0PP P Qᙱ0 @D   D  0 ᅱ0sO!gYsO0P 0S$c @-^P 0tOT;`0P 0S$Q @-LP 0.tOT;`0P/ss@-44OrO@-Md1PP0 000000 @0 P $81 0 30> T`pP "f PP`p P"km pP` GU`0WU`S  P \ 0@ `000 00S  P \  V \ Ѝ^]tO@-@P 0Sѫ@tO@-@P 0Sī@tOG-@PX3 M000 0S8A00C S%PP bP I2p$`0P儠Z`W#0S Nl P8 PPMU`p1 P00 00@Tm L20SP +P!0 VZ`ᯛ@PJ 0S pW1W!01@ 0⻀!d00 P1Zl!0h1P 810,0S 0< >1 0 30: 0 0 300  ЍG*0 0 30  ЍGU 0@Qh0 030 D40 0 30P ЍGD3 Ѝ^buOa`uOC^uO$EGuOrOvO?vO\vOsvO|vOTIvOO-@,MP3830گW  dp:00W,ЍZK XL1}H!0DD1C_W 00Y>*0S5  U "A^$  I` E`$0 Sࠡ1 0X00(00 00p0S PRP0 j00SvO2LwO$EGrOvOA-(M00$000 00`0 0 0000 \Pp$@唀U0 Q 0 t\X0 $0 30   0Q0 0S 0H@(Ѝ^l;`a`1wO%wO?wOP0/T;`P0/T;`@-M0 @000P`0 ላ cs l 0d8l| \ 0z/0w@08$0 0 30 ЍЀʚ;^KwO@BWwOC-@2-2  01a01P0101Y^(0 40 30 } HC<Ѝ^C_C_mxO'}OT;` RC_yOT=TYyO^=8QC_tE\;`{O@/9|OI|OJC_~|O|O|O5N3}O˱O}O +4-J+~O-$O,O)OO*OO*KVO)h3M,*OOOԀOO6OjOOSO-O]OaIȂOO5O0O0MO`*-P O(*;3ROGTC_mOeVO@3ɅOۅO 3OֆO2OO)[OdOP1O)GD-OOĈO@-܈OOWOO^;`O-0 s0 0 30+ `P,0"6 t@<A0H03/0 08R0S< 0L03/0/S0S3S>p>Ѝp^;`0p@-P @0 R 0 0 QpA-d` 0S @T0@ PU p@ @;`G-(MРp0P0$00`}@T@T 0 @x0 $0 30  0 S  0 R1 2SC` P f@(Ѝ(^^p@-@P᪜p@kP/U $0$ @-@ 0 03/@*j`I @-@0C;S<Z 0<0S(  (  00 CB\  < @"_ p@-@0CSQ*Z 00S(  (  00 CLR  p@_ p@-@`e P0CQZ  .h 00 000 0S(  (  00 CB\  p0 -S ^ ^03# 0 \A-`RM2@000 0rGs 10S91 0 30W = $Dp !7/0|p0pV 0   P`3 p0D P:010S  0S 0 00 00 SH000 0 30Ѝ 0l4p !7/0 0xp0t00S`0 0 30\ЍAc#00;`^i_ފOO,m`O0/A-PB 0$p*`P@($` AP9$X5TlSSSSSST TTTPTSSSSSSxTTSTTTSSTSSSUU U(U0UHUPU0 !ާ1 ጧ 000Ѝ1 ဧ1 1 x1 l1 d1`1JV`dV 0 iKTiKKiKLgIFM?M:OHO$XHqiKhiKYOA-@`yjPjoT`@DB00^p}0@0(`)(``!0 `00 @0`OA-@pxZPPX`Xt00S0 ᘒ0T R @ B)"AYX`X`UC^i_fOO-8,Mx`0$008PRTP`d8 $0 30 0H09#00S 480S(!,ЍO0A H03/ P0# AR+(YTXXXXXXXX`@< X/ i;0[40S)P+ @70S)8!%` ` ``70S !Y6 $0 30,Ѝ`<;S\PF@00PS(0 L03/?Q RQ@XD ;pB @ 0,t @P<0 300"& I000S 40Cs0SG%23C P000 0AS Ქ 0C\8S w:50S -!PQ 0CS Q V40S!{40Sڼ!00@SP000 T0AS j 00 Sr $40S4 00<SP000 20AS 30S 00@S 0 0^ (` 0C?S@oW 0@0S(  (  00 CB\  @ [ 0 R@ 3#03V{ 0 V` R.R   P Z\ Px  (p 0q V P20S\{ 0` 0P ?\ P  (U 0xn R` 7X^ 90 0`` +XT 9`@00 M P0   AB P0""  A7 P0   A, P0""  A! P0   A P0"" ~0A 0 H0@3/990 (00SPJ^;`i_O֋OO98O:OO]OL$EGGLOA-@ 0Pᘀ`1p$ 0 0 0b  \ \00\0S  q(室TЍ,"&(p;`O-X4- W @' 7 7p7? 0 ?p s 0 0 000l0 0 30 P77 7p7,00S$Ѝ^;`98i_+OYOp@- P @᎔,㊔0p脐O;`A-`0@P 0CpSAhhh0i0i0i0i0i0i0i0i0ihhi0i0i0i0i0i0ii0iii i(ipp   0A8tp` \xPeHD@<840꧈JKuOOOOOOOOOA- M`00P000 p(0@?0001 0 P9P< 0(  PP$P(P4u-q0PP 0(05(00 0 30 Լ 9 Ѝ;`^O--?\M_R⌐@0T00p 00|`,00x`40(0000`\3`S# /; >  ?  BRp rb.0 !   ?"Q`mllm|mn o\qHwDzz{`m`m o`m{{{{{{{{{{ r,lr{{{{{`mt r.i "x !0 0 0  00 000$0P4 (03/<? QcQvAQaruu 000 0P% 0  `   0 P --B@ r Rl"<! `00 0  pp000 0 0 /0  `- R , 80 0800 0(00(07EP 0tS <R`2?0<020S3S0 +S S,0 0000 !  ? 00"&`(" 0 I0` 0000 0  00 0 ? R0=@S pk04 p(0 3/<0?0S S 0S?s Q0 0- R R00R0S p 0? P" \  `R& (pW P 00 Sp $0S ^ Yሀp(pW 000`ᔚ 0` 0  0= S SppSpW 0?   `   $p (p L@yY \ p p 0  R  ` 4  (`B 0 $    `GQQ< >0S 00"6l 0C##0"Q 70SڠD4 P 0x0 W  PY `w P~ 0 #  ' 0S .RR   0    0  P0 (p0 0CUQ 00PS(  (  00 CBP Y 0 pP0 PS00 0S ,wMP00!?!еp(04  P3/<0?00 S 4 p 8  x 0    " (> P?  ! $), ((z0 0800 0  0 0 000<0>0 s 0080P$ S$00 00S0S <0 0QH03/000  hS R8S0S20 $0US(I 0,BKp5 000lS 0 0S 0 R     0B   2 T0 30&  -L@ r \R2 0 {v@\ P0 p0 0` 0 0Xb 0@ 0ܞ00( 0(  " p ^C 0 R(PUڴP0K (@ 0CXpP 00S(  (  00 CB\4 0 @p㌂PT !0 0 04#@    4∂0Q P@TUP @QP ꄮ#K@Q 0 $ 0 0 hQf Qd L R`4e\^JKuOk`3yH-NXۍO$MOO;`i_O 0 00 0`000  0"&4040`( 04 20ꘐP0 0  0Pp  `"&(p  PA0@ 0 0  p0 0 Ry QBqQqRR  l50 ?00f10Sbڜ_\ЍO-@--8M?  0@0 0 0/00 0$  D 4@0 0 00 .;P 0S10 (00 0XP0#0CU(gO 40xM0 0S P , P @ 008 CBP (04 xM0 0 .@? (00 }> 8 0Hp>pW;"W P pP 0|p `tP xP 0  0P X T.0O0P0 T0X0\0#0CS (O 400 , 0SPPP@008CA\040=\ 0 0=PT0=4X0000H 80Q0CS *(N `3|K 44000S,P  P @ 008 CB\ <4 00 H !S 0XP<U !0`Up0 l0 h0  PPp`0h` l` `0pP X0h#0 0V::0 X0S)0 H R8: 0P 0D0 UH E:p 00 00 00 0 H0Sʨ@D0H0Sʘ00S00S#R$RT  03/`0s S P@P#     0q0 Q0S P0S @ S Rڜ  @   0!!  0 ,,001m V V  V R) | ? Rbꨃd؃,-F@ r R -=V R   S R` VV```f4900SC @ 1`S300 ?@V V- RQ p0s `=V S00 R0S t0s `yVx0s `r V`^p0.Sg 0S`X `DQ9PXH0  Q0  R UppP7`` 0  '0O0P0 T0X0\0#0CS mM 400 , 0S\ P,WP@4`008CA\040  \0       6T06X0<00 S040 cP`4`|6\ 4N  N & R| !l K03/6 0x0d5R 06P   0Sa p00  5R000000" 0 0000J l K!03/ 5Rf"6%S| 0[?0S SP 5 0x@8[S30 000 4d,0 t!6P3S//0 l K0@!03/0[?0S0 0S N0 0 U0*N0P0N0 $0Q0*N0 $0N03S8[S3S8$# ## x 0l# x 000 0 0xP0PV 00 00C0 0\S :F CdPzEP;ʍ %PJ Pfʤ0S 10 l0d K1!03/ d0x 000 V 000 0S  0 0U PpKP 3 &U $" 2 2"VO  VF R1!0#à16 :P `P SQ FQ -Q #Q (Q |! R R?C+#à P ʄP ʀP P lP P ʟP:>C 23u810SqPP hnV`V>>C#_ 0 $ P U* 0N0$0N0O^;`yJI FG!gYKNģfff7OaOOOL,m`a Db DDE ?@j`^K j`BKTKJOOKЎO;`i_O OeO$EGuOO0P00 p0 t0BP W p 0S 8U 0S W paP 0P4 R 4W $2P `02P `0S0!`0Q0S` 0 00 01CР(0X ` 00A S|10S]GQt `Fd` r`P B!cQ TQJ VQfQ tQUy 0Fd0 `P @00 24000000` d] ct0`Fd` s`P x"`fG @s0  "4  00 00 @r 0024000  0000 0 0V*0V00 S- 0Fd0 0 `P @0P04000` d 0tS0Fd0 `P @004000000` d`` 00@ S(0@s0S13 eP0-S0:StdL" 0P S:S00 Ed `  @  4 0000 00` d0S ,S0;SS  ,S  R \S ?S0S03/`Fd` `P @00T5400000` dW P0K X0 XK5X0S XK|Mp0`Fd` s`P %F @s0  &4  0 0 !W P0K X0 XKP6X0S XKQMp `Fd` r`P &x` @r 0064000 0000 0Wm `P00 pf07  g0Sʸ0 P0@%%0h \0  P00C0S00 0 l0 K1!03/0'#&RS'000[ Q Q  Q R>0 s [=A?o? 2R0S<8 0xP0P8[ S3SGpc30== 0[?0S9 ppw (7$tpw(>wp0[h?00C S񟗕ꔘXXXXdX Xwpp0s)O 0 000 0R6"Qi90S B`` 0S:0S8 5 ,t03S++```0[?0S8[=@SLdKe @ 00:4000p0000 0 0 5dKe @00;4000  0!p 000D; ``l`FP K!03/0[?0S0 S N0 0U0*N0P 0N000 P* 0N0$ 0N0= Q S00 P0S$ t0sD,, 0 000-d`Kke @ 00<4000  0!p00x \ K oP Q A@qQ0\ 0^ dpK:e @004000   [0? R400 0l` 0#p` R8 m R6"QZ=0ST CPd K03/\0[?0 S\ >0 s 0 D>," Kt0<H03/0[0  hS  R W8S0[~d K03/\0[?0 S0 d00x Kd @ K0040000 0"`000T0S`0Sڀ[x?40 S ? /0?1 Q Q  Q RAS3 S  # 0"ppw #tpw#wp0?0Sꀝ`<<<<<<<<<<w 0R|01==C@0s0S0P 0 |d K0 Bd @d K0 0400 p0 00P  N0  00 000 0 00 yS PU : $U * P$^:0S  0 `H0d& 0PU@[8pW0pG000 `RX1 0L1tF 00 0p,80S 40d K0!03/dQ0H0Q0S  Q 00 R 00,0!ppK|Kt0 @0 30 ` ` '+nXKJ0Si qf8K览JuOKO N{O^G-@1` pP Pr{{0S# 1`0P 0@00 B!  80<0@0D0H0L0P0T0X0\0 00+HH0#0CX(:F 40 Q, P00P0@080A CP04000倀0嘐H@哄$X*<0 H3/0 @000000 000@X0 `X0Gf,*0,*+;`vPvPKA-@1MpP000`e#0CS4000SP  P @ ,008 CBP 4 0  x03/(E P`cXD`e+0 <*iVe0 0 30 y Ѝ^Ot=O-\M0T00O0S0`O0P?#R$RN0  \0}  0s @40 @0 H C$(0d0$00㼌T,P@0  0SR 0l"#H ,03/ H0x0XvJ P00@<0S; 00(00S0,0ՙ| 00g0 l0H 1!,03/H  P 0" x\ LR6 #P\ 叚C0I z dY! $0  P0z0 0$Y5( 8 0 0J0002d 4 Q P4 :dP Pp r*z }d0 00S 0Sp rD* xQD H 2hP HS%Y) UL:21cAXP:H0 P09 9 T0 30` x #P D$ P lzP0?0S.  r p0sH) d !P( Y 0O 0 SD!2380S  003/08P8 /(@0H 0 p4   0    0   T  ( 0l 哒)* Y':QD H 2h H咃(2 ᒃ#,000 0,0X$:60 0(0\ 0   ,0H 3/ ,t<0$ 3H P0哐)6 003/ Y000 0 S  :08D0S8 00QaD[0 r" p r %0C S 00`@ D008 ,00 R< 80  0 #1?"! , Q:82 S^ 0 ." Br /r  R(B( Q @50S:0 P( YY&0    0  p21cZk:H匄0[K # 0C[ ([C 4 P 400 0S,P \ P @ 008 CB\s 4 0  + 0     \0ԁY4Z30S CH0S 0 H 1D0< @,0<0@0D0H00 00 P@Ts0   0  O L s8<0q 3  (H!"t ,  ? P P  P R5 ^0x  <0\0<0H00H00S 0|   o 0 Ǒ@00@0D00D0;^ @@pP $PT @pAW D1H!/o b ;@X`!PPqT0 @TЀ0 0   S p01 1HJ(Y 4 4 #\Ѝ^;`,m`^O m`JuOi_OMՏOOw`)OTO0VmSLQFGO/p 0r( $@-鷿d!/ᧈJ.HX0p@-QL08PQ@000 p$I FGs@-`/oV0" 000R x0F@0SP NE00 E0 00 0 30 Ѝp^^EG@-@P Af&@-@P A\&@-@P AR&p@-@`P5/P`p00P/G-@`pPU P T  EE PO-p(0BP?@ð[  J/T00!C!!@C`Do`X9/P 1@ 00F?`` `1F!YP`F11@pO-@P`pE@WGYpHp1 `WpG05 pE G!`W Ѝq !' P !P04 0P   0P 0 p PGpH P[:I0 P 0P! 10  0K-M0$ K@0 0 0`0I$0p  M   P $, 9N 0 X 0 0 30 K^@-@H0 0000H0 A 0 0 30 m Ѝ^`II@-0M00,00   `H@P l0 P +B o0S  80 ,0 30 < 0S  U&0Ѝ^00S^OÐOp1G- hAR  RP D弽 0PH0CU&U uU` X P A$ ``` 000` 0 BUX  C R C ` 0p0Hp Y 0`^<`Op@-M0@000다T 0S00 0R0 0 30 00xPl@ ` -P ɻ0 0RἉ00 Q`Ѝp^^[Op@-M0@000TJT 0S00 0R0 0 30 j 00xPl@ `〻 P ሻ0 0R{00 Q`Ѝp^^[OO-M 2@000 T 0S問P 1 R 1 0 30 ' ЍO0ꬁᨑ q= ᩻P 0t1 0 30Ѝ <`PV10JC2C1S 0J`S. S( 0S0U U @ U0 Z0 Z Z 0Z  J B 000C0p U`  U 0C0U 00U 00U @ 00^xO<`^[O$0 R/  R /<`p@-0M01,!@0,001Qʄ1!`01W1!00P0 00I 坄0 00@噂0 00p@塂0 $00`00P00 @00 0 ,0 30 Z 0Ѝp^OO$<`C_|OC_xFOC_ړOkOThC_O C_иOOfOO^0@-$M00000@0TPU00s !PP Pig0 0 30  $Ѝ0^^<`O-PA,M`Xp[pX()P 8p0<0X@00 DpHpLpPpT0y)x10 0 00 S<10  0(R00,S43 @00(N,ЍQ pU #:  U 3Z[ 1 1^:RP !!00P<0 C000$0U :<`^OH<`A-A1 RȌH0 0RA婇彌廌幌g; Pڴ峌屌g; Pڔ嫌q娌Q奌0刁P0@00DV0T Sy n g; P  Dፌgu; PD0 0  {00CSp00CS DLT`] 00@S||WLUlhd^<`וOO)OOOTOYOSeOqOxO[OdIO˕OOOOOOOOڸL߸LOO-P4M 000put@h4B P\$\4Q 0Q(4 0 30 ԥ  \ⴹ \%P 债\p@"\Pt ⣹t\Atc@\P j\@ሓp` ↹K`\PL\P8\P$\P`\P 0# 6\P 0 ,\P 0 "\Pp\P\```p\A ?0S  T0R 0(5W:080p0<0@`0q 0  BB"(P,0@4 P0AC20C0S\0( 0\0807 `Y ` @002 B2^&0^#*0`,U (0$ &:SY *V *S #X  ZU0S S : 0 0\?V :V *Ѝ^OkG^<`!gYOʖOOؖOiKULf TXHۖOHOVO6RO>OTO<`xO@-@P Aw @-@@-EoO-000Ct!C2j#BS`PAS@!@3@p8*T` T@!0K` 0 Y$䠟00%RR㓅+3# P0000U PEX 00%RR%% A# `00d&P` Ѝ@ 0K00I0PꫪOG A-@M1P0<000`\`A4 \p00 <0 30"  @ 0@L0 LW  BL> T@Ѝ^40@-@ R  劸  h<`OA-0BP?\ 2. B/\  0  $0 @0Lp?0 U b%ž \ *"      C/0@ᄂLrb@r`X@@1  bpЍ0@-@$MPPE000000E"$Ѝ0@-  0 @3P :Ѝ      P/@-M@pP `WЍ P0*T  E= 0Pp@-0PS`@1P! @!P10ϬS 1 1U3#p-P :P0 /P3#O-@$M`P0E SCVpH`p2 W pG d0EPES$Ѝ2 pE X 0"* Z * X0*0p \ :0H P :W:`F P X*  Z *pO-`VQ PG@E"/o b  U\?W` CNPN : Q2 A ЍOMP'Pr2ůů[ : 0S 0ϬS/010`P 2000000*"S  ЍQ0/ Q  @ /QAA/  G-PQ`>3 B @BUIIC\*Q U@!@1@*Tp T@!p  BR <  A@YPpRrPp\G@-@ 000000 Ѝ 0S/H00S/@-Q @=(@l<`P/$00P/( S @-Sh U $}8q0p@-@PQU  R }<0 0 000p P P 0p@-@PC 05c9=?0P p@@G0DIC-4M$1p P@0,00` `@ 00 0 P` 0Sg ^< 000 @@T0  @T ;(0 ,0 30 - ;J4Ѝ^OOO}Q!gYC-M0`ԀPАp000@ @p 00 0 P@ P@ 0StPESd嵵T  T ,0 0 30 Ѝ^КO4OAOdO@-`0 0 00000000 0!0 0 30 ʠ Ѝ^p@-R1PM  0L00 hp$0 ص 0P0Q,`0S [}@P U000@00D0 0H0/{0P@0`(8P,0(  @0800<00! 4 f 004 <$0 L0 30 a PЍp^OOO"ORp@- H Pc@`P*P Pp@ ;O^`^OA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0A-P0M@`0p000P`W(&# 0 0 30 Ѝ^p@-0MT1@PQ0,000S38! 0 0!0( (!0$ !0 01Ra 0  P 00  0     0$00ڗ۔000P000L0 ,0 30 0S @—Ô0Ѝp^l<`$ P]`{O^`>S GGO-M5`000 0pl0p0*0t0 됥@㌵0T0P8@x<@0P@L@H@D0@@4@t00 0  P@ Px0@040x0L0xTHxPD0P00T00<0080x00Px00x00x`Pr20@t0YU4VųuV U04 < 庳Y嶳"0IX000Ā;밓尳0\0w@ P\0";L0 S S0CS"S \S  \0᠙\0P h; 8 ⇮,J;X0SJ9t01l0 @9>9p^I S@D<0S 40,pU/ 0S 0S0S0S1V*0S  Vp40p800p 0Q p0 p^l!l80| 孞p |0Q| p0 p |^l0S T 0,0$ P (0 0 " H 0 0@ 0 D0L pp@o0S  8p}^80 0 30  V vU lȲЍ^OOmO49IOOOOcIIOIOIOIOIOIOOO?O<_kO<_@_4`nH Olj7@-@Pt? 0 ; Ѝ0O-$M0pP萟`000@0 P0 P  SP0P P 0S|@DSlr 0 (0 0 30 $Ѝ^OOO›OOO-0$M@P000`0p @   Ph0@ P0 vӥ(0 0 30 l ʥ$Ѝ^O0 0 0 O-\MP1PL`0T008p@,0$0(@,@@00 0 @P P P P$90S ۱6D0< <00@0D00$0p<7p$780 T0 30  <7c$7 \Ѝ^؜O&O4OO-\M1@ㄡP0T00`p"(@,0$0p,@@@D@D0<0@0 000 0 aPPd\t$<@0S tT@0S l0< 0$0Np<P7$N780 T0 30 <C7$A7\Ѝ^OIO4OZOO-\M\1`XP0T00D,0$00(0p,0@D00D #00 0 PP$$p<@0S  h0< 0$0o⨤<6$680 T0 30 = ⛤<6$6V\Ѝ^POO4OO-\M2p0T00Z$"0 0 @(0 `P0$$! 40000020P'S4@P4,0 ,04004`ݷ4ط4ӷ0 0*%0pG 0 0  000&+0 Y W 0ܨP `0)` w@P`00T`ӕ # ᗈP 8 oP H0 0@0 fhP $ $ 0 <0 T0 30 Y  H00@0\Ѝ^؞OOOOPOuOOP/- @-@{@0@- M    Pt!h@P !  00  004 7j 0 0 30 P Ѝ1O^DOgO@--0P0 08O!gYt<`@-p  Q P0" ᣎ(0 0 30 # ᚎ@ Ѝ^\SR00R0S @-ʯ}OOG-0M1@P0,00z!` #GP@DXaTpPp 00 0 wP@DT0 ,0 307 ޚ pX0@D@0P@DJ0QT @LB@Ӭ0 0 00@ iP 0S @D0Ѝ^IG@OOt<`8O!gYG-0MT1@P`0,00 !p `b#GP@Da 00 0 P`@D:T0 ,0 30( o V@D 0`@DQT|  0 ` 0 00 4i;P 0S =@D0Ѝ^;-QXOOj`ǟO0@-$M0@000 PT,GP 0 0 30 ' $Ѝ0@P Le妿pͮ ግ200 00< h }0 0 30$Ѝ0^ӟOOOٗQ@-` 1P-\M0T00d @ P P, U售?p`4hp p 0`p `h$ p 0`p `h@0 T0 30 080 0 R \Ѝ@ h^pOOO,O!&LHߠOp@-@P `T T @T  j0CP =PUvjp2S T jPP_j[jXjoOa`O2CHO-@1DMp`P0<00 @00 0 PPP P@ P0`FV  tV!T  |(0 <0 30  9DЍ^OO3O R/ )R P @-齭]Op@- M0`P000q@V 孭0-S$ P@#jx  00U \  00P g 1?(0 0 30 ј (? Ѝp^OPjGOYC-lM42Pp0d004@U` U kfP 0LPEERzL0 fLK3 4oLD3ⵐ LeL0 0408fL43423X 4VL LRL0 040%fL!343;fpPW Df←0 d0 30+ b @ i 0 0$(00 0g   Jg P>L242f >lЍ^/OOhMGIYHR @- 0 /TOx<`Rp@-x֬P-P`@T ?<p@lfu00U0S `p{@ꀢO@J1RC-M00000R0S x姬Ph1d!0``1娬@4440`S8 8PHp 0`t@T 0 .`#x x2 P `+@P XX P40 0 30 @ЍC ^OO$EGO͢OR@-0? 00 0  Ѝ.Oo`O-M1@qP葟000` ` 00 0 P ` 0S PEUQ@hePPp@TZT<p@$!qhV0S zP 0 0S @oVPx0 0 30  `0`  p@P uUo4`Ѝ^OVOiOOx<`Ko`G--3hM@p0d00P\`P 0S 3#03嚫XP Px尿뼭P  妿! 0Pd 0G?o2U0S ` g00D/b2D0P0H00P0L0`020S gDv 2RDo  00 D 00 eW0!0 X 0dU0Pe0,D \   00 D 00 e0 S R D` E1 d0 30^ Q R Da 030(0 D᥮d  00 D 00 PeQ 0D a%#Di` @XG]U0S 0 S: SP0SL0` 0\0*U U UP0S`0{ 00hЍ^*O$EGOO1SC^dQkOhMnJ!gY-PGVMiQOCOO-t2\M`0T00J@ `D2P@1 gUy 4'_o 0 "1 2SS!0V V P $ B Kp gS 4_O 0 P| pW h1d!0``1R,o@1Xp 0$p00 XYd 000CS !0 0  x0 R00 S ,و׈ 0 f 0  `P@0S /(0 T0 30 B Px\Ѝ^O(^եO$EGOrOiQo`dQG-RH1M@000P @` pB0 0 00 0 P ` P@ 0PEU ũ 0p紀DVP!0S v0 ` `0 R 0C?o2V0S 0  $0 0 30 0Ѝ^OOOx<`O-$Md2P`@000ELb0p000 000 0Q P 0P00 @DT T0A@ཡ`庡 PD F@TVT Q`P @d!pXeY0S v`(0 @ 0S, @oYP%S0 0 30) f e 0 b0 yPKe`@P xXmL`şD8e%^$Ѝ^ܧOMO^OʦOOx<`7QQG-RH1M@000P @` pB0 0 00 0 P ` P@ 0PEU Ĩ 0p紀CVP!0S u0 ` `0 R 0C?o2V0S 0 $0 0 30 0Ѝ^OOOx<`p@-M0@P 00000 00`h0 ` Lp 0DS  y$0 0 30 hЍp^O$Op@-M0@P 00000 00`h0 ` p 0DS  x$0 0 30 <Ѝp^̨OTOp@-M0@P 00000 00``0 ` p  0@DT Ry$0 0 30 \ Ѝp^OOp@-@P% 4  P65 Pp 05 P  *5 P | $5 P h 5 P T 5 P @ppppp0P/( S @-S$.8qP/$0)0P/( S @-S$8qP/$00P/( S @-S$8qP/$00P/( S @-S$8qP/$00P/( S @-S$ک8qP/$00P/( S @-S$ũ8qP/$00P/( S @-S$఩8qP/$00P/( S @-Ss$8qP/$00P/( S @-Sq^$8qP/$00P/( S @-S\I$q8qP/$0l0P/( S @-SG4$\8qP/$0W0P/( S @-S2$G8qP/$0B0P/( S @-S $28qP/$0-0P/( S @-S$8qP/$00P/( S @-S$8qA-`8P JWp@PpA?WpQ I@Kp@-`@0P@00D0,0Ao*D0Spp@,`44@-ӓP $0 0S  V0`<`@-M1@`000O00$0尨h!"0$PP0㨨L!"0$PP0P埨,!"0$PP0㗨!0$P Pj68P0 00倝M<V 0` p弻PU|0 0 30 00P  i ;c 0`Ѝ^S5gIyXSO$EGoOLO0`d^OA-R0M000/0@`/pP$뜀P00!y0S 0t00xPV00 0 0 30 J Ѝ^O,`Ow`x0QC-$M1000x1@TlphP@TPw0S 1 0 30A  PP0 003/ `%V0 0弯T b<  <  h(0S XP 00  KUxw CU~$Ѝ^<` V0`d^*OO-p-1DM0<001 0S ᜡ☱`Hw0S\h1 <0 30R lPPD h003/0@0V h U 0 XI `VxP $0 | $0jVoP 0S 00 $0 |x $0tTVU b̯vǯDЍ^<`d^BOHFOP~LIG-PG-T1-0M0,00@10S 4`0,pv0S 0 ,0 307 9 @P) 003/0P0ٮ $h 9UP0 Z|0 U0 P|l0 U!U ajve #0Ѝ^<`d^QOVVM0@-M00000S 0PSڨ`pmv0S |0 0 30 ۆ @P 00倮  g ka+[v& dЍ^<`d^cOG-P-10M ||0,006v0S JH1 ,0 30J Z`P< V003/0@0D g TP0 { 0 gU᭩0p {0 ZU(0S ᝩ0p {l0 JUyT a®u⽮ {0Ѝ^d^~OhMOAYA-M0P`pĀ000u0S 0 0 30 9 @P 00ޭ U &g#g `℮u =Ѝ^d^OOC-M0P`p000u0S 0 0 30 @P 00夭 0 f `JzuE Ѝ^d^O0C-M00000S pPȀĐ`Ru0S f0 0 30 v@P 00e U0 ff J` :u CЍ^<`d^OظOG-p-10M␁⌑匡0,00u0S (X1 ,0 30N 8_PP@ 4003/0@0" mf SP0` z0 DT0 z0 :T0 z0/0TF7P [SG 0` `U _✭t◭ U0Ѝ^d^OO,O8OHFOO-`0$Mp찟000Pt0S0 0 30%  @P 0 0峬 X V p0`e0 e e _ Qt L $Ѝ^d^O|OBO@-M0P`p000]t0S q|0 0 30 ˄ @P 00p  e [_Kt TЍ^d^̹OG- M1@000(t0S<0 0 30* LsPP 0 0;0 ` pS 0 00 0/0 xe se _ Ԭt Ϭ  Ѝ^d^OO@-M0P`p000s0S |0 0 30 O ,@P 00 >e ^⟬s⚬ XЍ^d^3O@-M0P`p000s0S 0 0 30  P @P 00徫  e ^isd "Ѝ^d^O@-Q0M000 `Ppus0S 0 0 30 @P 00别0 0 d q^1as, jЍ^d^ZO@-M0P`p000?s0S S0 0 30 c@P 00R0 0 d ;^+s 4Ѝ^d^O@- |00 00 s0S!T0 0 30 { @P s8G<E Ѝ^0@-M0P 0 00r0S\0 0 30 U @P r8<eЍ0^0@-M0P 0 00r0S\0 0 30 - @P r8<=Ѝ0^@- |00 00r0ST0 0 30  o@P r8I<GЍ^0@-M0P 0 00sr0S\0 0 30 I@P mr8 <qЍ0^0@-M00000S 0PSڰ`pBr0S V0 0 30 f@P 00U cd >].r 7Ѝ^<`d^O0@-M00000S 0PSڰ`pr0S 0 0 30 r (O@P 00 bc& ]q⻪ yЍ^<`d^O@-P-1,MP@p0$00C 0`ywd 0Q 0ow@ 0Q 0ew 0/Q$0PC4P 0 R  @LS HS(4,$0 R x0 $0 30 |B>  PdC^ E  PR ,Ѝ^O,O8O̺OHFOSVi(X&OA-M0`p000Wq0S k0 0 30% Ł {@P w003/0P0e b O]O H\8q AЍ^d^ۺOO-DML2 HpDD0<00q0S)2 <0 30} 9`Pt 5003/@0W`$geUGPP 0S 003/P 0 C vx 0 :P ko'[ ?O<10S !$@tR ?O$P P$0 C cv $0Pp ?|O$..$n$`e$[$⪿* pwDЍ^,`TDGoOOӟV1`ORȭP[OO-M2 P000̐弋PtP 0S ⤢dp 0S $x|2 0 30 Ҁ  7P 00s0,pS ,20S 2  2$R a@⁋P9P 1 屳000 0S Ӿ0S$aH0T`  XpⱾ(PLq  D   ⣾\@0T0$S,00S( 0000D0S!Wd8o80S<X5P  $Ja8o<⨨$f$Z➨ o]Ѝ^Vd^T^<`<`O!gY0`O)O,`DOA-P0M@`0p000-pP`'po}@u>u.;u 0 0 30  Ѝ^A-P0M@`0p0007pP`1pE}uuu 0 0 30  Ѝ^A-P0M@`0p000 P` }ttt 0 0 30  Ѝ^A-P0M@`0p000◨P`ᑨ|ttt 0 0 30  Ѝ^A-P0M@`0p000|P`||ttt 0 0 30 ] Ѝ^A-P0M@`0p000 P` |ntlt\it 0 0 30 3 Ѝ^A-P0M@`0p000gP`as|DtBt2?t 0 0 30  Ѝ^A-P0M@`0p000P`I|ttt 0 0 30 ~ Ѝ^A-P0M@`0p000P`|sss 0 0 30 ~ Ѝ^A-P0M@`0p000G P`A {sss 0 0 30 ~ Ѝ^A-P0M@`0p000Q P`K {sss 0 0 30 a~ Ѝ^A-P0M@`0p000P` {rsps`ms 0 0 30 7~ Ѝ^A-P0M@`0p0001 P`+ w{HsFs6Cs 0 0 30 ~ Ѝ^A-P0M@`0p000KP`EM{ss s 0 0 30 } Ѝ^A-P0M@`0p0004%P`.%#{rrr 0 0 30 } Ѝ^A-P0M@`0p000nP`nzrrr 0 0 30 } Ѝ^A-@-`PTE0pE0u00 0S   00$P(0 $@mA-@-`PTE0pE0xu00 0S   00$P(0k $@mA-@-`PTE0pE0Qu00 0S   00$P(0D $@kA-@-`PTE0pE0*u00 0S   00$P(0 $@A-@-`PTE0pE0u00 0S   00$P(0$@yA-@-`PTE0pE0t00 0S   00$P(0$@*A-@-`PTE0pE0t00 0S   00$P(0$@هA-@-`PTE0pE0t00 0S   00$P(0$@NA-@-`PTE0pE0gt00 0S   00$P(0Z$@aA-@-`PTE0pE0@t00 0S   00$P(03$@A-@-`PTE0pE0t00 0S   00$P(0 $@A-@-`PTE0pE0s00 0S   00$P(0$@┤A-@-`PTE0pE0s00 0S   00$P(0$@A-@-`PTE0pE0s00 0S   00$P(0$@ҿA-@-`PTE0pE0}s00 0S   00$P(0p$@"A-@-`PTE0pE0Vs00 0S   00$P(0I$@kA-0?-,0M(0,00 _O(s>.000000(P$@)spj.00000 mspsl>T.000000LBDn$^r8~or > P0>(0>$0000000S  @P@00 0 k! 0-00 0 000$00rot*j0-00000P l0S  n0}ror= P0=(0=$0000000S  P@00 0 4 0,0P< 庇0 00w0$00l|urvojrL< P0D<(0@<$0000000S P@00 0 ⎣'0S n 0+0d; 0 00f0$00;r0$00yqnq9 P09(09$0000000S P@00T 0 :0S $  0(08Ȇ0 00-0$00xqnxq8 P08(08$0000000S P@00x0 .0S H 0'07卆0 000$00xGqHnS G`O]`d^`N\t^`ML_`L$_`J4_`JD_`^`H(T]`,WL^`Y UT(V$^`,G4^`|9^`^`$F܂@E_`TD_`B_`XS^`A^``R^`_`<@LT_`D>TlT2]`_`<   0@-@0O@-@@R R R000/O0/R R R000/lO0/R R R000/S GGO-P` pF@   5$ 10`T0CC1$0G#P0AT 9VwOG98O-p\2,M0$000!R' R02,"0((2 `!$0P0 00   0 Q00 P_ c0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  P$ PH |Pl ᐠuP@D  nP$  hP$(0$030 r ,ЍO2^G$EGGTO98A-(MP1 B0$0008aRBQ000> 0U0@q0 _U    P0BC1U:0!0000  L0 $0 30 jr 0 P ~(Ѝ^98 FGO-MP`   p F@<0 080j  $ 0`X 0CC1$0G#P0Ѝ T{ AOG98O-P` pHF@  a B$ >0`T0CC1-$0G#P0T } OG98O-p\2,M0$000!R' R02,"0((2囆 `!$0P0 00   0 Q00 P_ 0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  OP  R 0K C1  <P$ 6PH 0Pl ᐠ)P@D  "P$  P$(0$030 Wq ,ЍO2^G$EGGO98A-(MP1 B0$0008aRBQ000f> 0U0@q0 U    P0BC1U:0!0000 L0 $0 30 q 0 P (Ѝ^98 FGO-MP`   p F@<0 080  $  0`X 0CC1$0G#P0ЍTGOG98p@-`0M@P0000 00 0S 000 ~ P0 ` 0$00h0 0 30Ѝp H0ἵ 0S $0 0 30 }p Ѝp@i^P]`>S GGO-P` BpIF@   3$ /0`T0CC1.$0G#P0.T !&CdOG98O-p\2,M0$000!R' R02,"0((2 `!$0P0 00   0 Q00 P_ v0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  P$ PH Pl ᐠP@D  P$  P$(0$030 o ,ЍO2^G$EGGO98A-(MP1 B0$0008aRBQ000> 0U0@q0 LU    P0BC1U:0!0000& M "L0 $0 30 Wo 0 P ; k(Ѝ^98 FGO-MP`   p F@<0 080}  $ 0`X 0CC1$0G#P0ЍT .OG98O-P` pF@  t $ 0`T0CC1$0G#P0T OG98O-p\2,M0$000!R' R02,"0((2刃 `!$0P0 00   0 Q00 P_ !0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  tP  R 0K C1  aP$ [PH UPl ᐠNP@D  GP$  AP$(0$030 Dn ,ЍO2^G$EGGO98A-(MP1 B0$0008aRBQ000S> 0U0@q0 U    P0BC1U:0!0000  L0 $0 30 m 0 P (Ѝ^98 FGO-MP`   p F@<0 080?  $ 0`X 0CC1|$0G#P0ЍTnOG98p@-`0M@P0000 00 0S 000 z P0 ` 0$00h0 0 30Ѝp H0 0S $0 0 30 jm Ѝp@,^P]`>S GGO-P` spF@   $ 0`T0CC1$0G#P0T [0QOG98O-p\2,M0$000!R' R02,"0((2݁ `!$0P0 00   0 Q00 P_ 0$001 $0 30Z,Ѝ000 00 0 0@C`1DADAT  0 CHR6 lR. $R  P  R 0K C1  P$ PH Pl ᐠP@D  P$  P$(0$030 l ,ЍO2^G$EGGO98A-(MP1 B0$0008aRBQ000> 0U0@q0 9U    P0BC1U:0!0000{ ~ wL0 $0 30 Dl 0 P l eX(Ѝ^98 FGO-MP`  C p F@<0 080  `$ \0`X 0CC1$0G#P0ЍT%OG98 0R(P//(0S0S  S @-[ /P/p@-P@ pp@-P@R  op QO@-顛 0P   m  <`qvN(0S  0R@-/0P/00/s@-`/oV0" 000R xs0F@0SP 00 0 00 0 30 sk Ѝp^^EG0p@-@PQU  R 90 0 000p P P 00s@-000000P`  U  R p0S@ 00 60 00 0 30 k Ѝp^^EG80 0 SQ QR0/0 0`0 @-\  @\@ 00 00A- M<1P@000U@ 1 0 30; j p W`VP0 00P0 00? 00 P+@ t@ΣP ǣP  Ѝ^O$EG?OOO0P/@-鸎<`p@-XM414Q0T00㈕0@ῇ1P 0 P$0s 000 R$00 c ꨇ0@ 0`S00`⭶<0 T0 30 Ij ⢶d`XЍp^<`O1`4`@-H0@P $$N$,!N$)$D@<`O0R@-f0 @R0p@-hY PX@0SL~aP74~P00hPpPp@bO1`O O@-00 0000S0 0 30 i 00 R 0 0 30Ѝ@$p JT@ )HU $0 0 30Ѝ ^1`<`2Oخ0@-R0M0 00)*@0iS J0P0SP00 G~ ~00S`\PL6~(0 0 30 vi Ѝ0@^[OOOOOR@-~@ @DOG-p@X{W QP~W ` VQvPZPnP i0S ` 0 VOOOO&Op@-@R TP `<b P ,] @P }@0 @pkJ_sY:O<`R@- $}9@r 0 @r9^OHP0@-0MR  2P }]@P PU֓T0SU ͓0S P ^(ɘ80 0 30 h TP?Ѝ0^OHOOO6O0@-1-{a0 pWA p1 00囩PqLYD1TpPU  勩0 d0 308 bf 맓@T 0T13/@0S @P { oT  Vwt0TdPP R D0T13/P ( plЍ^4OiO4O<`a`V5gIoOxjNG-(M<18P0$00H$` @pp00 0 Ps@0PEqU zPs P Oہp N p 0 {T](0 $0 30 e K](Ѝ^LOsOO@-h00 00  00 00/]0 0 30 e Ѝ^2O-y jP 0Y0 T30S 0`Y0 @ T B0 0 30$ Ud P 0S ~0`zY0 30oY0 $Ѝ^!gYO&O0@-PR-d2$M000@ P@"N0NY$"020DY"020:Y!0200Y!020&Y!020Yp!020YL!020Y(!020X!020X 020X 02㖗ۗP 0X 0}2 ၢ40 0 30 c PJx v$Ѝ0^DO;OJOKOO^OծOwOOOOOmJO@-R0 M000*@ MP P0 C X 0A2뾈P P0 C XX 032 700 0 30 Jc $x ,e Ѝ^DOhROOO-M2@R0000[ QP !q & 0P 0 s dAp8t! {MT9`9P@`YI1 0 30; b %0S  P  0 ?1P 0S  PX0oPY`Lzw⦡ ? 1Ѝ^<`^fO&OO-$M1aP000p@p00 0Pp0UdFw100v 4! L00ES" ``V \0 0 305 ob P@ 0T0S  0 :@ho 0@PSlw 2kP z0S  0 $Ѝ^dO5OPO4O&O@-R1TM0L00a0Sv@0 00 <0440x0@S\!}L0D!0@04020S0!0040t2 0P 1040g2pP0SPǠ P0QP0 C W0 04y@0 L0 30 a ⪠4lTЍ^O<^OOSS~YROO-@5-MHp000ؐ`PDpD00 0 PHnD0H HR!w}0@080n0@S(((((-t00h0 0n0P40v -00w0-00g0-l00b0kn0P(04 X0X00$00(0| YJBX0 ȟ00000l0P 0Du< +0 $?/ 0/0(   ?<0?  0 T?0  0 ?  ȟ0T /"LiK, Pp D /P"TZK8|wP0  0Z d0V"d0/000 0 00| 0jd0Ud0 /(0 ST⛟$0S  000 Y d0U8d0 / 0YXP,00  0A^S$ P,0@0,0<0, p40SLh*XWX0 0 30 w` T[PLW*XWЍ^|O.O@OOOOPOOOO&O0O,YR:OXp@-xM0P@0t00`U t0 y,|@T&$w0 C T00$0xP 0 C cUd 0T D/Ti*W40 t0 30 ` T^*W5xЍp^>O4`VMO-dM`2\p0\008HPw`@X@00 0 zPm@0pGW t{pďl@܊0 @ ?00"R|tRt!9J @$0`@\\ 0 0DR ⡞ 1 \0 30> _ , !D   .0  0S   0.!D   .0D  R0{P,0 C TD ,0te.D@,D'_ @ dЍ^OOOO,YFPKXaII OO- 0$S p \Sr@y(0s @Krp (0s (Dr,0s (0s `p k0 0p0P 10 00S 00 ,Ѝ^NOgOOnO~OODO.OOOrOOO;OOOCOPO@-@_PZPtUP dPP TKP DFP 000 CCdRO~YOd]ROqOt0 @- 000@f0S 0S\0*(d0 0 30 O Ѝ^OG-M01P@0004`U<@Pkd0 0 0儀:0S 0SĐP 0p 2  0 2 ?P00S k40 0 30 ~O  `Ѝ^ O7O?SHR,OA-P-pXM1 @`0T00 "RDP0D40 0 0V+414 40@0800<0@0P000mD8 00 $0^D 04b sD0 T0 30 O 4U f,XЍ^hM,O1S!gY-P FRC-p-dM\T00<@DL<HpP X0=aP @#c0 Ra 0S^#K9Mt$0 D$0 '$0 C$0 "$,9@0  BBT:$☍ 0  BBT*2 R ⋍!0CCT,*0"92 R%V0 0 P؁@%` @q威`00CCT:Z <DT1 \0 30M gN b0SH1D!0@@1c/ 0  0儐 !0 "'!d0 0  ?CP$0` C oC$0 @ <CDB$dЍ^TqXH{OOIYhMO$EGOeOO-$M0@찟000P0P p@@`  0000 0uPP&&& &@`` 0 0 0 30 M $Ѝ^O OOG-M0`ᬐpᨠP@000 @@ 00 0 4P@ PPP0 0 0 30 M Ѝ^O!OG-M0`ᬐpᨠP@000 @@ 00 0 P@ PPP0 h0 0 30 bM Ѝ^O6OO-P-3TMS@0L00`2p@@P2  P P2@ P Pp0 (@@h"7P(`,Y ((2 L0 30 M Z2!"0  2am0S1"!01a } B40P0B40 ! _7 Z>I$ $b40PBL40 240PB40  477PY` 0[ $ PX0 B4▋$Y ␋4⋋$ ⇋⃋(#TЍ^IOgOOT O$EGOO>OXHrTOH%#@-@P AC@-@P A9@-@PHP a008OGO @-aOO @-aOO@-aO@-'`aO@- 0\@: ^0:0QS  Rxp@-@`kPPp0/R0 R R@- R 4 / P O!0A-pP $@`  \'   \8 0pv0 000MVTЍ!d0A0` @` \UpF0P 0C0]S `9P 0]S .S UP000C SX *XOp@-@D`CP0S(Sp\0S(S 0q@D@V0W$0@C R/ q B V0Wp@-@ `PP PQP `p|P P0 p`pA-@0Pp0 00P7P2`.`X  0QU.P  000CS (0 0 30 *K $PЍ^O-M`pP72`0. 0 $ S\ Ѝ\WW P  AT\P 0:P 0"  2̠  PP$@a`O-`K72`0P.00$ U@ ЍpVV R 0AT !  # Q PP $@d ! a`O-LM"p0x04[0D000t@000S20P0 0 @4 D0 30 xJ T 4000,000<0@00(0<`V 0(  3#03_ 0@T㨀ŀP<- P0U*Q p 0pS$0: 0S$0* 00S0$000 Q 0@D"#:#  R :  BRʚ%p0T 0 w pw p/ ᚂ P UP#3QP@00$ P ^@ 00S fPT0S.wpXmP@D0PE 0, 0S 0U0 E,0P0S ($0Q\4 84 0300ST  0 Q0 :(0$ 0 Q0 :w #0S@ @ 0嚃"0S  0^0 :w p [3 0S  0\0+*D)Y 0嚃#  0Q0* 0(`嚃)LЍ^O OTOO@-MH@ 0 0 30 TI Ѝ^-$Ml0 0000 0 0P @o0 0 30 3I $Ѝ^   /p@-@PpP/PO-$MpP@P X`g[ 0 0l20vP $Ѝ00@20 0 hP00S 0020 0S 0S[UPE`0  X U 0P 10S X1q1 pClT0 |`)0Sql0000 00{#  <Y$   BR*   I    `V((  BA\ 0 {'$`!( T0 ( 1   iGKKa`NGhGUKt`O(O0OC-MpP8`0I S #B0x@@0p@t[\   `0 @pЍ0t@t F\마JKOO-$MpW# 00S00.`$PV  0@嬀H(TP 00:3 OP   P $0 0 30 G 0@$Ѝ^a`A-P016!01\0`PS !0  0Ѝ!d00  00@ p00r'1T 1TЍA  Q\ !R 0@!0 u PpUp*!0 ЍAf !d01 p Pp!d00 O$EGO[OO-MP` l100S p ,0S@?0,0p(72`1. 1R 0AT p$  P@T 9/P $@8/P Ѝ2 ` 0 1pW 0 3/P(p8/P 4`A4`\AO--P3EMP0 10$0@ C {72fL3L#H3Q T  @p0<0@ptTapVYY 0 S h20S -`+ 0<' 0 0`V 03/P $`0 $%P $`V  pP`V<M72jU< 0  1Z 0 <3/P( 0 $P $0S @j \'<>0 1 30) WF ,@T S `j D'4@T S `jt 5'S T-'<>NEߍ^4`A\Aa`Gr`OOO,O[OD0@-@0000  0 0 30 F Ѝ^0@-0 MP  @T !0 L0o 0 30 E !d0 0 Ѝ0^O-,M1@`00$00PU: PXPGpVC:1 $0 30Y E 0 D0 p0pE0Gr!0 ]00 $!00!00 000p p000S pp00 0 0P0k0 0 0FC22 000 0 0.0`j,ЍOj}^ xO-6-EM0 100 00= 0@S9p60S P `)*P0 3&00` 0 0hP 0 R  00P`Z V 5G"5/o b    0P0 W)l% PXeZU0pG0`P0pF W:0`F W 50PPEER000 h+ 0$'($  0RP !V1R 0PP0 0`00 FWP R 0P00p `0S0PP0pPtLp0   I 5/0 @ 0D@`0<03`0HPUW\UH"010#1 QX 0032C00P0 X <>0<0 2d\``0 `p0.2d  p02l0v dx9COP@D┄T0Q] 0$ ,$0 0P0 `(00 ,0}${dX9`pVC_PEmUpPg 0㬐@Y20 1 1 30Y D 놑YЮ0 03/ P[!R ?1Q0!6  [!RpP `00 2$ 011c$A(?0S ( 00R 0  R 0t0pyɃ=0p2ap!( AP0@lEߍ^t`O,`,HL-OVOp@-@ Pe0(00 # 3p@-  0P  R fPЍ@-@P Q $0 @-z02/IOVO~qp@-卭0@QPb000 c`U ` PU N Vp FGA-@,1p0000aS!0AP S:xQQQQQQQQQQ Q,0SS;0,00000@ 0 30 C 000 %00L0 %L0h0 $h Ѝ^@-@P Aాp@-08M@`0400 0@D 0P0@D6/P 0(0\ <0 40 30 B 00` \S8Ѝp^P/C-4M@`p0P(U4Ѝ 0P T   E00 0 0R PO- 4Ѝ^T_VOOO-80@-@0000 0R#R ^*O@-@] c TO-@0Z 00 \'PJ`0U0  IPPY  PW AĹ`aP`OGG-0Mp 0@20,00 PnP10 ScR- SsR*`Sh`Foob 00 PL2nY  f H 0 SSS00000#` 0Cs0S13 '㠡AQ';'Q  !Q00S , 00 0*럺 # 00C S``F8]pP  BR A.W`PP`P p00/ 00*00% 0 ,0 30 C= 0Ѝ^POXVO]QOC-M0 `@pP0 00@0U :00x0 0 30 =  pP p 0 00 P0Ѝ^YO S@-@   3 A-xM@P00 02`0t00(0 00P$0(0K@20S U ]PPt22p"0ll2QEP0 PL200ާӧY P 8 Z8@0 Q< R<0 $08 0<080C 0 0V 6/j (0P@0(pP(0@0$ 8@p80P@ h\%P2 !떹 .V 0S ' P :ɧ03/d0 P@ 0S 3/`Q a  PPPPx0 儧0S 3/\PV2  0 t0 30 -< xЍ^T_*O$EG O]O`QHH=OLOA-`ApPP#`mmmmmmmm;I p`04IUAt/Iplhd`\XPI A^PIꘟV~OO5USVO'I\OcOx 0t00S 0S0\0BD 0@0(0 0 30 H9 ڍ Ѝ^O$EGOOnRO-M$M0  RP0S 0# 00M0s x0d 0`0P \0%D 0@0(0 0 30 9 ڍ$Ѝ^O$EGOOj7MnRp@-Ml1@000\P@H1 0 30J 8 %`P  vRPP7 g @P @F0 RP @P  0 RP 0 000P vP0S(  0&S_0000@@뿵Ѝp^0@-tM0P0l00@P  P P `0d RP$0 l0 30 x8 tЍ0^@-p1$M@`000mp @0 0 30 $ЍP 0 0 30 T8  $Ѝ@QP 0 00MnP@0p P P@T^00^ZO$EGOO0@-$M1@000 p @0 0 30 $Ѝ0P 0 0 30 8 $Ѝ0@H% P 0 00L#P@00 P P@T 00^ZO$EGOsO@-p1,M@`0$00pd1 $0 30 ,ЍP <1 $0 30 7  ,Ѝ@$ P 1A!00oLP1@00 eP0 0`0P0S 0_t 0|0 0s l06P 0X000000S 00B 0 0^ZO$EGOOOOj7M4OP/ts@- L@HP6CD`( R8 Ѝp@,C000[CLO^cOOO-pQ040F 00L@ 0!P 0R0:$C ,C 03/00P`Z0:C Ѝ PU `Y0 P1`1 AO$EG$OO@-@P  $00@-(M0@`0$0  q  000 $0 30 6 (Ѝ^@-CMt0@, 0,40 00; 0S0  000 ,4 30 6 Cލ^p@-P`@\LpG-B 1M⨏P`@000Ȁ\ r" @DO\ 2L40 pᨏȀ V B +P 0H?À‐I P  20 0 30 [6 Ѝ^0@-$MP@PEE"$Ѝ0p@-Mx0@ P@D000`@DP00 0 30 *6 0 Ѝp^P/@-M@pP `WЍP T  EPO-@P-MP`p  0S| 0 ЍO8P  0  QЍ(^p@-pM0@T1/0l00 /<1: $@04 !0,ZO,0S8 PYY,0P+w@ P`)`0P 0(08(@,0 l0 30 5 $ @p`P$TP X( OP $ @@,뛲pЍp^IO{T}Q)HO-M2MPP@p000 2"U N 0S 2T"bUT Ux2 `0,C 7v P|HH2Pq <$0 0000,00M> 0(0}OPaT8P tOT MpO(0?0E,0?5C80 00匰4E 46 H00D00< @0SOdd00`00X \0MJO(0?0E,0?5080T0L0h0P" 00PP4M.P6 P$ 00`0C s0P S 01 0M> 0 0@ 崅P| 40 0 30 4 ٱݍЍ^OcO{TkXVXOOOqOO/TO O,OO@- X@x@ ) %  !   @c@8OOC-!M1$M! @000T@!$N$0SG |P$ GcuP< ``00CP080000040 0,00@00<00( D0GN P$,\`{4J0pt8C܀ IM% J( 00@00<00pD0 P`>@$P d @$m40! 0 30 4 $b<!܍$Ѝ^SO{ToOOOOG-M18M 4P000?!M0SJ A刁刑 4tP=  4T`P7  NP1 4NP, CP& $ )NP! 8P  2pP  ,P ( NP "!$0 p0 0?堄P t ?404 0 30 3 ڍ8Ѝ^%O{T>O}Q-P)H[OLOQOOG-M1M @000]?!| M0SC lphh  itP/   PP)  `P#  0S S0000 RR    PW  "?p0 Q?.P W ?t ?z40  0 30 ,3 oIڍЍ^,O{TBOz7RG^OPOWOSOO@-P LM@Dp`C L 00P! 00 DMP !SR 0H0 010@@0 0D1P0 D0 30 2 D p`M LЍ^|O{TOOO-M1 000>PP⬱11 0 30X 2 000C S&@; P!0 B0 P@0: S0 ĠB?@ 0  x`P'8P000C Sp  P??p00,0$0$@(0  0 0\pt>Px4 ЍO2>x^OOOOOOC-M1M 040p>I`P @PR1 4 30O 52 000C S@ PP!0A P0: S/? ?p BpP萟 p000C Sp P0 A#: P=00 3@00P0=4PPH ݍЍC=p^[OOOrO<^U~OOC-M$2,M $P000="0^K00Sc `0 irPX 080Ch@(0D0 0<00@00800P00`0 0X00L00x,T004 $@H0iKP88p@<D% Ai& IeQYO& Ia' ~4 0 000P00I? 0A?0L0,0T0(@0$H0`pi=0FP d ,=040$ 0 30 J1 0gݍ,Ѝ^O{T4OFOzOOC-M$2,M $P000="0J00Sc `0 irPX 080Ch@(0D0 0<00@00800`00X0 0P00L00x,H004 $@T0iRKP88p&@< D% A& IQYO& Ia' 4 0 000I?0A? 0P00L0,0H0(@0$T0`p<0岁P d <040$ 0 30 0 0ӭݍ,Ѝ^O{TOOOOC-BMx1M 0400pT@P! 5J@TP@ 81 4 30< 0 0+r`P  T@  P_P T 0  T0PCS00[0@0 0>P@ 7/ lBލЍ^7O{TSO-M2 000<<0P0 TxPAx2 0 30 $0 000C S@PD 0p✀cJi" 2 / x P DS$0 0`1/ PP@+ @"@0: SH000C S hPL( 'J(004080PS1@01P prSP0W00T0SK 0R0(";?=sY p 0 @D . mT hp< ЍOb;^JOOOeOJrUpO)H6M!gYOOG-@ MpP`E VFWpH`p2 W pG 0EPES Ѝb E bP P   P  P   `PH  PJV :pG PP O-dM2 $0\00:Pm 0 004080N@ I0@4@J8@BR000C S@zPd( 9I(rP0p804P0U "P!E4P0 `EFB~t0T0!03@*T ~t>C#N>C` p  YP 0 Ct204P80PCU0l 1 \0 308 . `EF"/o b  VldU İ<T `!  0 \`.MP$0 0 0!  0m:@, $dЍO.:^OOOOG!gY/OO 0@-@\T T0P\TSRUSR00@-@P A@- @Ѝp@-`Q@`` C`PB$ 0S SPBp 0S 0$  00)$ 0S XO0p@-S@ P00$ P nSBpO-MT 0l < = l< $0 0 30 - oЍ^O@-M M@0  l =/ P00*, ,0 0 30 - ڍЍ^ M`Oh0-tM0l00T0 RH  P 0#B0 l0 30 z- tЍ^L`OO@-tM1p`0l00P 0@dYH F0Sp0`V @0 l0 30 N- A d8nP  *Ph0V:S0 ^B@wQtЍ^N{T O OG-M0P000U  0 < @P` #A0 0 30 - DP P8/PpAPW``VpЍ^OO lOp@-PH!pM0@ l d,!<$!mF0Sa'T @ 0 l0 302 , ^A0ZS0 TS XS000@t0C?o20P00 dm@P $P P=뭩pЍp^N{T&O O-O`0@-000 P @P0 0 30 l, Ѝ^X0@-@000 40P@o 0 30 S, Ѝ^    @-M 00 Q d0000 < E R m@P | 0 Q l 0  bD0 0 30 , 0S@S-Ѝ^:O{TL`L`P@- 0@-@ `0007p&WP }Q 0 2 +   Ѝ@@p Vp eQ0 Tt@@0 0 30 Ѝ 000Sc@^ROvOO0 @-{ 7p T* ]Hp@-@P000000PRP 4 ;$ ;9뮨pOO0@-KP0C   K@KAP@n,* l K^Oa`FMOlOOOp@-P}@zPT:p@Op@-Pl@iPTD P @ PTn:p@|;OZOp@-M0`@P000 `0  P UT H0 0 30 % 0 00S U@:Ѝp^MM@-M 1`0 00!p2QP&0P Z@T 0 P0S  @ #!0 0 -[M0 0 307 $ 0 pW0 0S  @9 0VpO 0V 0000 809%Ѝ^OOOO O?OROp@- <@GP`000`000G`Pp]`G-PP`pPQx000G@   @W :0000p]`!gYO--1MԱp @000`  P U* _R `V@W   X F: X A*,!0&#0S@   3/ P U !   P d  ox0 0 30 # Q 릡@1L L뽡꺡`VЍ^^O@-D DD@ @@<08 80@( OO OO@OXkOLXp@-M`1P00000 R898 @ ,= P e?Z0 ⇛P 0` 0` B:Z0@P 0 q0S `@P  0 b0@PST 40 0 30 <# 4y VЍp^xOOO O5U[O*OO-DMXX2p0<00w8KW@P BP ` P `{`000W ⰷ0 0000000⣷; 00P0 0 003/0{000P 7F 00 000 00P4`8`,0(0$0B 080400000H0L0PQ `` H D0⏷D$⋷ @ :⁷X0 <0 30 " 0x-$t )'n뵟DЍ]`^ FGMO\LO-@0Z 00 >PJ`0U0  IPPY  PW A-`aP`OGO- |Mt6@Qp p0(0 0FpKDp @p pX `G@4F!/o b Z@V$@` WW`d0  0Pl0  0S 0 m 0` X0 `0 Sl0S[AX0 0 d00d0 B`kpP 0+0C0[SX00X0  `000`0 QEQ`00K8 K0EK40KCP t0S E0[t Sx0S 8Q ᚽP|0S 4Q ᐽPT0S 0Q ᆽP`0Vp`!s0 F0 \ Y0 p û0\ pp BYڈ0 ᶻ0 S AӜ\0 10l0X 0Sp ,1A!0 1T0K 0P$ 4 4K` 0 )-  P`pX&X pX`0S`P0`Ep0`  pP00 K^O$EGfO O]`a`̶*OGOO/O/O0@-@40 3/P/O/- PPGQ/UC-P0Mp0 00o0 ,0@` G  0`@`@$0 0 30 b Ѝ^p@-P[PxP `@PPPL 0 < <00匛Ƣp^姢[0]`4]`O^D6O-@IDAt[AT0!03@`!*TP 2T@!?P0 00X  B  S0CW Aћ QPB000OGA-@`PpP  P0 0P 0P 0 0 0P 0p@-@`P5/P`p00Q/A-@`pPU jP U  EIPO-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !)P  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p; pPpK pGP X:I0 P0p  00/00/d_0@o/8 $0 RS R ( / P/p`P/p@-@`u P0CQ   00 000 0S(  (  00 CB\  pSp@-@P0p`៬ 0 0P@ pp@-@Pk 0` 1 2S Sp1Sp!0 0!1 00 p(^0/A-P@`T@pP 003/@Hs@-`P x@>41 @0$1H1%@P ЍpP0P/,000 C\P0    `PdPhPlPpPtPxP|PPPP CPP0P00PP屹 /⬹V9pPt` 9P40 LxI@]`xHp@-P<``@P =P@  @ `p@]`@-M41Pp0 00`@V0<:P1:@`0V, 0T) T0  0P$000U0 00Q U W 0S:x0h 0d0h20T V $0 0 30  Ѝ^a`OTpOOOp@-`P@ᗴU: U#3pp H]`  \0$HH]`\s\ⅶ@-@@-@ A-@ `pPP ̹P  0P@-M(1@P`0000S ! 0S  P 0pS 0 002#0CS(u400 80SPP@00,CLP,040` 0 30 * Ѝ^XhlN$EGOO@-P|0M000`0 0 30  @ YP 0S 0 001Ѝ^uO$EGO.Op@-@ 0#0CU(4000S,P  P @ 008 CB\ 4 0  A0dPU` 0 L0 <0 ,0p@0 PH___p_\00 R 0/d0!1 0 0 //a`@- D00 00P,A1 0 0 30  Ѝ^O@- R0 0|0|510S R 0S \0 ЍR40 00Q 0O$EGOOP0_a`P/@-@TP/@-l00 00@TH0 0 30 - P0SЍ^t0@-000d0@$000T@0 0 30  P Ѝ^a`t0@-000d0@$000T@0 0 30  00S Ѝ^a`@-00 0000$@$0T0 0TL0 0 30  0 k0 0SЍ^a`x0@-000h0@$000TD0 0 30  0 00S SЍ^a`0@-h0 0a`@-@`000000A-PR`p@0S @0SRP LV:V*Ps@-`|0@P000$000TL0 0 30 D  0 P Ѝp^t0s@-P000`\0@$000T<0 0 30  5/P Ѝp^a`0S/P/P/0@-@P -,㉲@-P4"M(p@  0`2 P000  $   G  p0t0x0|01 T X d h l 0h1吱d\)0U 0!V D1Q@!0<<1l/ dSX 뻗0@P0R 00S/0@ FP:P00 P |V  <0 0 30 l $pЍ^a`H]`YP$EGO&PPfP0@-LM1@0D00S R 0T  0S<00E qhT0S 03/\0 P- p 0S 00SOs(⫱0 0@dRXwh0 D0 30  ST0P 0LL0. PU xổLЍ0^T^`H]`HO$EGOPA-P1Mp000`90 @U1 0S 1!0|1|.0S l1X!0T10S L1q4!0010S ,1!0 10S 1 000P0@`0 @p0a9 @00 0 00g_l2Qf냗뤖YZ00<0 0 30 w >YЍ^P$EGPOP-PUPPa`PO-4Md3ph@0,00 d0 AJd0h C@ R XP  'R2 ,0 30 < 0BP0P`0S 0  ^ RU#XPUlPUodh0Sps0S`Y0$`勡    $`aP000 SP 00 =;0  000 00 0 Sw0 PH  H @ tP0<03/P (P C Р`0pp 00SW0S P0PFEQv 0 @E ` mQ먕4Ѝ^G-PMp1`000Y0U- 0 30% k h@d0@D"tġ吂  0Z@ 0 `T@P0Q +QfЍGJ 0 30Ѝ^ FG@-4M<1P0,00 P`P @T 1V: ,0 30- # U' Ahpd0pGqW 0 00,h d0 AH a ` Pԝ y4Ѝ@qJ Pʝ ,0 304Ѝ^P$EGOPO-dM@60\000P$0~ F 0S0SZ 0SW` 0S 0S5q%05},P$0X000XpU:0S@3 QB;$0@X0X0W?`V E!/oD5 b i@UI,%@P$u V<0`P0C00U=0S0U11~ 4$04p@儀T:X( Q bP000 @`0V:X Q OPa `P$1p0 (0 !YZ (05R S/ YZ x3X#0l3b0 Q S H3 #043TR S 3"03HQPpqP`u0XpP-2"02418011PU 80a ɭƭ >0( S 0, 0*T2: "0H200 S 04 0:p0H`UUBU`11= 1]!010<00@010S 0 `L"#@0(0<,00!$0  000L0,0 0(00 0w0S:@`0@000 0QR 0x 00 0\ 0X00P00t#P0$0 0 \0 30 Q $dЍ^a`~P$EG@POT<P P PP&PPNPP`Pi_PiPAP*P@-@RP0Pzo//@-@@-@Q@@-@Qx@ؑp@-@PU jΑp@-@P őG-M0Pp`0|00 0܀ 00 00p̠TUYU0 |0 30  0L 00x 0p0=U 0`SLUU03/L$@TЍ^aIIV?I GP]`?I?I@- @TQ@op@-@QQ ppJ7`5pp@-@`P5/P`p00P/G-@`pPU P T  EPO-p(0BP?@ð[  J/T00!C!!@C`Do`X9/P 1@ 00F?`` `1F!P`F11@pO-@P`pE@WGYpHp1 `WpG05 pE G!`W Ѝq !m P gP04 `0P   0VP 0 p KPGpH BP[:I0 P 20P! 10  0 P-4Mx0 t$0,00d00`00\000 0P00L00H00D0H0 ,0 30  4Ѝ^ GxC_tC_ P5PNPP]`p@-@`VP AKp $P p@-@`VP A8p $P p@-@`VP A%p $P p@-@`VP App $Pp p@-@`VP Ap] $P] p@-@`VP ApJ $PJ p@-@`VP Aُp7 $P7 p@-@`VP AƏp$ $P$ p@-@`VP A೏p $P p@-@`VP Aࠏp $Pp@-@`VP Ap $Pp@-@`VP Azp $Pp@-@`VP Agp $Pp@-@`VP ATp $Pp@-@`VP AAp $Pp@-@`VP A.p $Pp@-@`VP Apy $Pyp@-@`VP Apf $Pfp@-@`VP ApS $PSp@-@`VP Ap@ $P@p@-@`VP Aώp- $P-p@-@`VP A༎p $Pp@-@`VP A੎p $P0$0/0- , 0/@-8M@ 0@0 04000AQSQ n'Q 0 0 00$00(00,0 @000r 0040 00 40 30  8Ѝ^Y P Bp@-P@ R,$$$p@opp@  PPpPpPp'x P@-;  G-@(P;` -;' 00p凁W~ 00RPPSЍ  0@U0Z1  ("p@? U;PO-4M1@0,00;pl;P:` : 0: 00@ءS   P& 0  @ 0 00& 0 00C 0S0 0 0SAF0 ,0 30  C0` !@? sHyH0  c 4Ѝ^ P P$EG P PG- Md1p000;`:~@ :z 0: 00PS   1P?& 0 : @ 0 00;&P0PPE0PS0t 0p0Z: H0 @! U0 0 30 S Ѝ^ P P$EG P P8 P@-:00C0S@ ?P K@H,10@-M000 00S 1 0 309 ' P@oP  P 00 P  R  0SP 00SP 00S  0 RSЍ0^O-D24M@p`0,0099 0SP P 00S P U}% 0P  `P  XP 0  P5 \R.00Q(0 P S! $P\L0@EB0  S00R 00 ,0 30 t | 0 0  GZ a ɫ@ 4Ѝ^B P Pv PC-$Mt1@@p000)9# `0SPP ` P$ߙ@0 030 ' ?$ЍCB0 00C00 @LA0  S00R 0`0 0 30$Ѝ 0AtPFU a a@^ PA-P@8U.  0`p8 00SF8 00SS 0CST 0W  0AA4 PO-@DM p<P`6/8 00SUPQ  0`06/` 0@04/pl8f@h8b 0P0S 00SP X7 pO8P 0F 0B  P* ( P$ 0 P 0 P  Pi1 <0 30i0 0jH`8@#P ^ 0 0R!QP"04 SR QP (SR@P@ 0  S$00R00 <0 30$ DЍ 0 7jP 00 E0# 0$E0 ታ@P<0 <0 30  0 0DЍO/^v P P PG-p P7$` 7 00S@@ 00S  0s0S  @M? A |\0 T  $ 00 S P0?#T 0$  PG-` Pp@4/@ 009/F7@ B7< 00S P" 00S P X@OoBT  0`06/ X@OoB? ЍG@ 0`06/0@ ]Ѝp@-RAp6`7P 70S !Pp@EO-PtMl@4/6 0@TBP  `6 Px 0 0CCP0SZH"D,p%P$U0_@P0DD0SQr P6 0T`y Y , ?PP U0_@P  dP U0_@P  ,ݩP U _@P000 ?  0@ S@@ Z 0w0CS`(p((P(W0BU00AS 00Bs \A0BS70Ba0BS< "U0U0000 0@0 rPPP0 PY>t60S0>P T(@1 l0 30H  0 TT00`0!ᬱ6 @D\  C0 *C  ! ᒱ 0(0   2P Y5@B67 tЍ^ P# PV> PA PF PQJ PP P'LG/ /"//I P/P P/ 0P/G- P@` pU  @0SP 0SP$0  GG$0@-@ 0G@-@J0@-@0!G@-@ 80@-@0cG@-@&@-M0@Q00000| 0xx0 ! 000 @S 0000 0 30 6  9Ѝ^G$EGjGvGA-M;@ 000 00 p;l` 0<+  0+ !1"?!! 0*  0* 0*  :Ps 0x* jv 0X* !1"?!!\h 0$* S_ 0* J 0) 9uNP<H 0) 3? 0) !1"?!!%1 0`) ( 0@)  0,)  9>P 0(  0( !1"?!! 0(  0|( 0 h( 0 P 0((  0( !1"?!! 0'  0' 0 '  7p 0d'  0D' !1"?!! 0' w 0& n 0@& 6rp`l 0& Wc 0& !1"?!!IU 0L& @L 0,& 7 0@&  6b;p)5 0% , 0% !1"?!! 0%  0h% 0T% L5L%Lp 0%  0$ !1"?!! 0$  0$ 0 $ 4$p 0\$  0<$ !1"?!! 0$  0# 0@# 3#p 0# { 0|# !1"?!!my 0H# dp 0(# [ 0#  3_2 ~W2 vO2 nG2 @f?ᤞ2 \5᚞\2 R+ᐞ82 H!ᆞ2 >1  0 R 1t!01" `R 1h!01 R 1ix!01P0 0 30 C Ѝ^GGiK} P P P P Pv P| P P P P PbiK P P P P PƪK P P P P P P P PGGͪK P P PGGTiK P P P P PҪK P P P P P^GR P P P P P^L P% P, P3 PHR^gI: PB PJ PR PZ PIGYiK>iKKiKtpVqMd Pc P WG$EGGjGG\GGC-0MPp0`S4@ 0 vP00Ѝ[0 000S0 00( S0P03/pC0W P0P03/X0P03/@o?P$EG-PPP0/hPTPT0@-@ R 7`8 S( $@N ,``^PPPPp@-0M`PäP ᾤP00 @ᴤP@0$0 !(0,0000 05P < y8@T( 0' 0Ѝp,``kGOP-PPP 01/hPp@-P8`@}PTp@TphPA-@PpiTi0 P`p P0 000S 0S^ 0 | pPU+P `@ D J0S  SЍMP-P,``uM$EGPPh^p@-`@Pm+0` P @ p,``A-`1 R`( P@p` ` PU0 0R 03/PPiFi0  0 0eiU pWЍP 0V X S pSxph"i  040 4 09S``,``yP-P!gYtPPMA-(@Dp0(0 0>lC``ᾤPPN   PPU  P 0B_R Q `⒨#` P p= (0 30S   XD=  忤P/UP  P# 0B_R Q, `(#`t pP P,UpUFU| _U$UV 0A0Cs0SPx X-0Es0/#D<X.U000C SR$< Q0U 0 XR0 0DS0 0 E^ \.R  0E#S񟗶@T@T,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R,R@TTV,R,R,RTLTXUtUTTU@U^U\U[U``Q{0Es0S(PUI 0QSPD``00\P0[?0000 000'S} j@X"00P'S  'P `HPX X X hP 0Q! ,0``(P0,0,PU PE`,P)P`0S ,PU `,P`\.R. P SE^+BD 0B ^A A BR=8I0 01PP00 0M0A0s x!}P`h` 0`V4@0Z%4h0 "R \R R"h 0S"S00h "Rt4 0 0h PA_ 0hKh0 00p40 P h 40 <U0' P$U_U 00E S 0A0C<US <Q  >Q R 0QXP 0IS0FSPG  000-᜝P Q7ᓝP Q.hኝP&C_%HၝP 8|PQ qP  0hK .h0S ^`0$SQ5@K#0h0 (0S h0K0K 0@ @P  P h0SY h0SZY0 p4$WpW h0Sh p 0@ aBP B 0X(0@S h0K0K 0@P  PpW @0Y aBQ B Õ X(0@S h0K0xK 0@ ABQ ×P  WPxpY p@`4 ᬢ00Q00`h00S0W 01P@K^W 00#1 2 S @GP W0@ ᙊmp00h0I_0S0 0 0帒12S`0 C SR`:SL0:SI`0 ` C SQ0` $S_S 0C Q 0A0CSZ. <  姡 @ Mᾤ 00  F 峤0 pK  p0S !"R p`00B_yPW0`S W S: 7 S *\0K 00@SQrp00V1P00 Q0h00S0 0aHQ@Kb| KH``^PP tY 00C0U*$X  0D.p,w <0s80S >A<<0S58< Y = 2py1We<>p40 S_5pW0g0r0S0C080S `- 4@0<0 S&1<00-0,s 0y!S`-0 R%pW[ 4= @Db8R80рuS  IS,0.>А80S Dd, < 600S<0s ISp, ..ґ RED0 0D0)@<` 堛 w700pc080SP0`T{0CISvj8j8j8jj8j0jk8kTk`klkxkkkllmmpnnn8jooo8j@pLplppq qq$q0q. 0``0AD0@PE0p.9~ 5 B0y0S0P%p `B9p0S 00Q0S0彗0і堖0(0`T)B>Cx TxT0(0P  R S *0`TB>Csx TɊxTސ0(0Pq  R0T B>CW vx T`7x0ږT⽐TT`D-T͐ Hx tvx T`6x0彖T⠐TT`DT▐-(0H0 0 P& 0 `@ 0D`00#< 00噐<0, H8xH0< Hx pᯃ5Tp0`0 CxₖHe<c_xzH]<[xp'Q`<@0Q00< 8k<00`H<0p 3 T <0@T0XIڠd<pMHTԄ<0T 0ʗ 0>HT T0Ta-0HS 000W0   0000S 0 R 0 00SH0 00S徖`T H TΐTH0yMzPw Pt 0h@0S P uP `T008 TᛓTÏ008000@0ؑPIM凑J9GD坐AO>嶏00H02M崌f$!ʋ囊 G <0 x000'00 x⃟'l0x x0Ox>%pP $`005#V "/x_00V 00`D0M0 p؁j0Tp0T009 00T p`(00H|(00V0*%@^H``!_GGHGyeIAHGP^HGJGKGJG>gIvP4JGZJGKGI!gYȈInHEG(^EGRfIwfIpHH``fIC8T0S X 嘚OP xd'Px fdxV0xIxN0xAt RhSe@#0^@80S 4e4%4S05b(0nTJ00P@<0s IS%80S  Qebx㴅[M=0[ 5 0 308 0U0x|TT❍RH♍V %-xbT⌍xWT:HxPۍ$Ѝ@-Q0M@0 00`0 00P `u0,0 PP p,y $0` 0 30 sЍ^H`` LG$EGPHPqA-Dbp@p`ppQ!PēP FGO-@0HP0L0U HPt DDpHE`    LPAAD`HPLpHOG@-00 000 0Sd0 0 30 P0 0S40 0SЍ^U P- PA PO-@P(p,; P`0S:0S3P1 0@P-(P& )P"[ ?00 1>0Z 000V  ?00 1>0W@$0 000X0(00S @P @P(P P[  ?00 1>0Z$000V 400/  0!. W <0 000 0 R00X@0@00JI%H P'Qp@-P @` 0A A S00Q0S 000#T0S R`'T00 H Dp@R $$ 00p@ x`)X5U]QS@-@t0 00000 00SH0 0 30 (,Ѝ@ 0 30Ѝ^)XO-LM@0x002p`0D00|@0(0 0V?o20S 0PF 5 a`V; P Pp 0 SmU  0 a P 00 R (: (0 R1:S0E SU 100#U0S 0(0(0 PE 00 05L1 D0 30DB  $0qa$0 RU0S a0(00 0Pdp07/,00, 0M 0 pC00 0pW:(0S h=0WS#D0 D0 30HLЍO. D0 30LЍ^@Rx`)X]QvOXE_GI@-Q00000|0x 0tt0  000 S 00,0 0 30 5 8Ѝ^G$EGjGvG@-M1 000 @ 0004L $P8<@ 0 Q 0t 00 R0u 00 H Q 0h 00Q 0i` 0l0RT0j@ 0L0 H  0 0 30 Ѝ^G$EGGjGGG\GGrO/ P/ P/3yH/0@-0 0P Ѝ@-@t0 00000 0 0SH0 0 30 x,Ѝ@9 0 30Ѝ^)X@-00 00`[`wP 0 @P`` `0 \ \p@w40 0 30 ;$YwVrЍp^``d P``^D6p@-P@᱖ opp@-@PX`L00S   0( 0㏻p@gMC^nQ!gY:SG-P8q`4@0 0=@S000STGT  0=@S00 R     R     0S|0 0h`00` 0 P04#@ 0 0 40R u$MTLO@R}QsIlI!gY!PHQ GA-@8P41p000i`e`v`V@RT1 0S. ܀I000C S0p 0 B R @ `T0@S 0@L0 0 30 ]@ЍA0 0 30ЍM^McK@R}MO-M`p0@ 0X 렰P㜐圠UX ЍOU   0 0 !0P80 0S =S {C0 PPQ0&Cp4ACpP>0>S  /]@-0@Ѝ0@-@p0$MP 000| @r,0 0 30 id$Ѝ0^-|0@-00000d0@0S n 80 0 30  n Ѝ@ Ѝ/^!_x&P0@-S ,0( 0$$0M0$0 Ѝ/P$EG$P&Pp@-0M0@` 0,00$0P0000`00P0 @0a0 |$0t0`0l0P0d0 @0\00 ,0 30 P0Ѝp^xC_ltC_&PK'P 'Pa`\:'PA'P{'P'Pa`O--$lMdP夐Qp Q巵`YU  Lc@P 2U㰢0?o20S #P#P)  0S R @=@T 0 0 @T 0S R oPP 0S   00 (0 W,0 4080<0H0L0P0T0X0\0x10 0 @@$@D o0\03/0,10SW$00o0 d0 302 Pm"40 080P0<0< 0 Qqd00S 00S d0  00003/_h|d^o|clЍ^'P4`4`a`@- M\@0, ( 0 0 30 T Ѝ^@-(M@x$ 0 00S 8Vc 0 $0 30 /(Ѝ^'P@-DMl1@P0<00000` @ @0@@( $@ (0((@$0$pW @8$0 <0 300 40S @0P808@0 ^0@T f{0,00S P,Z 0@04/@Qcc8I$UbDЍ^@-M0@p`0 0000S 0 d P00000nޏ,0 0 30 ՏbЍ^4`O-DM2@0<002TOT`Pp J`0`T ` 0S0000` `00 0/00@DB00$4#뛄 $@$H@0 0p0010L0`T `H@ D|DHD p`   L@AAD` aH@L`⳺ ⱺ ᯺<0 <0 30 ⦺ ⤺ ᢺ1bDЍ^UUU FG IOGp@-M P@ 0P000 KP  00 0 30 Ѝp@ P`Ǟ 0S P0 0 30Ѝp@ PP ^8q@-@P 003/ @2\7@-@P0 } Ѝ0R,@-P  iQ  *P++Pc+PO- TM2P0(0 0 뒤X 0 ˧` 0S mP @ PTpKm:Xٞ7[0p \!  @1 (0 30I X@r` 00M0\0 PἸ0\ @X` \J@U@M@ 0 X T{C00 0`D H0RwH0   H L \wXw\ K^4`6I GG-PP@6HM0D00 (j$[ 0 00,,@Tr 0S f 0 p00S5 D0 30_ hpWM 0儠!0>  O@`De 0 G00 ᲺP,e , ӰP@PQ  ɉ`@ 0 ᔺ@,e ,0!d0A0` @`X(oeP 0  c!PpP aᒰPo#` 01"P ! P ne 5/q20C S4(@HX.P+!0p @ Kp@0 ',]=e ,ẇP  Cp@  0x2"02 003/!0 wxwhd 003/w<80(  0S Q؀Ѐ 0 ͹@,d ,:`P  n RpW| @PP 00  ᨹ@H @Q!0 &@p0 ᒹ,d ,%P6  i!d0A0 @p<:HЍ^+P4`+P+P+P+P+PD_+P,P,,PfIC,P(^NJkqHI,PN^HTn*P],P,P,PS,P,P,P-P+-P5-PmQL-P:L-PO-tM 40l000P$0冬p30$ !!S3W l0 30 0`0 ` @FS000 0S X ]PtU:t 0(00U* 04 4 R !0 (  ᅶ( 0E, (0#, P2 ᤲpD(0D < SP@ D  t Td00T\0<QX R ]xX0< @0T 0X0T0$x!SQ00fSZ 00 S4 },p3l#0hh3k #!R 0 0 0 $00(00@RB*0P00 p0 00k@ 0@0 S$0a0Cs RS񟗌 t  \    0S 0 R 000# 0  Ac0  \0 TX 0  JX 0  @004(0S h` P `0$P(00 L0 00 d"wꧠ`4 (0S GP @n P0$@(0" ` `^0 d0 30 lЍ^(3P$EGn*P2P?3PC GTGG[3PO-EMYiQ<0D18 09@A0 10 0@0h aRc i@Pq i PEQ000sSw0 wG000Se w[0000i0C?o2H0`0sS`0V00hZ@ @ @(0jiSP0P|P C2 4 6 8 : PP|0 S0 0峱4qiP t000sShh00' bR  l000sS b0hR wR gRg000sS0p 0Ԁ00SCLiH強 0pT`Z0 00[Q `00g  0Lp |%` V 0g:| @0C áJQZ'S 0 @0 0Z| P <6 @ `p| Q0VP0 0EUS 6&06bV= `  0/00000C402d02e\0?` 2=D0 0@@(0000eh0?$@0l00Tp L0`0L@0 0P00 5Pk @00CV80Q80d 0P80L0\0D  0\X ^S@00S@0 X 40\04000 XJ 0$  R$ ( ?(0,4$ (  0$ @0@R( 0 00 0S `2w$ZS 0S 3 @ 3 1 30 E4 0WT0Tp0X0 04P % |p8` UpW 8\ @h0l 0$0( L0&/2#U0 PT0@ 0긫<0S V`: P5 $ (p$0  ቞0( t0]0v0`P  v u0S ( 0` 0p 0 `fm0iS}pYx p"Y"Ed0(0X " 0pP$0p00P0pX0 H0Z00S0 JR 0(0`#0S(0 Zʈ嶸 <m)0sS00[b[,l00Eߍa`^Kn*Py3P3PNK[OH4P$EG3P FG{4P4Pz7RwNG-pB M2! |4RP`000x`P{8Z8Q6 0S3 0 WpY 00Sp 00S 00S K u0Ss0000SX儠0 0 $0sV!`bPPP49 떖`P"h 0P 0 0 30  ЍG0 0 300 ЍGM GN0/S0`Pv0 0 30 Ѝa`^^!gY4PFL\OA-@P 0`S  R@ 02 00Q0p PWЍ0( R,P0PP`0ST!0,P5P$EGn*P4Pa`3@-dM0\0000S7 0@S 0,0P0P0, P}U 0,00S ,0SS0$`$0P00,02( 0RRM, P2 \0 30 VS%0S9 xM Q \H$\E$0sSiS %@><<凴 0S$0iS/*0 $iQs 0 000&0% $ |$Q ~[ x$,'00S0N0%@p W0, ({WO$`Q MN0000 GNNQ~N@Vp,0 0, WNN$`QhN@Vph0` 0vyNwNdЍ^a`a`)HTLO2YI5U}QNK[O)P6pR+5PXE_F5PN0p@-@Upa`O-P$24M 0,002 ,0 30y J0/S0  .!p PW#` UxPsUiUbp0 "$ (040`pPL1@0X000@ qP j00 k 0 0 00 <  P  < !p#`@ (  ,  0  Q@  0SX{b,94KYL4Ѝ^a`a`^EGO-M$ P$, 0 4 G `0$00"S \j $8$0$0"S 0^$0,S S T$$< p80$R $0@T,P000CCW<080} < 0Qp(0(040HQ0H ,(0$0 ,R0$0 X񟗿" ! ! ! ! " 4 H \ ! ! ! ! ! !G!B-롓0 ږ "0 RP 00S x H y)ል0   @X T0R T0 T P ۴ @f f0 S@0 S8,1 0 30[  Ṵ B HX," 8" D" P" 4 00 S ꀚ8}TzXw\ Z   y0 t*t~t`it]i8Ⰾ,WK! H ADf 3fЍ^Y5PHiHjH5P4`6I5P5PKn*P0@-DM0P@0<00 00(0 00$0(080  Ui⸘40 <0 30 ki⭘KDЍ0^1S@-@TT嵨T@0$0/!gYA-(P`V@@W`a`P@-8圵P ЍW000005P$ (. A-P`1\!0X1XTa  BL \0BQ3 Q- QP 1 00P P0R R  B@BQU@ЍAP0 P 0 LP 0P 0p0W0 \}h4IPEB6P$EG$6Pn*Pa`R6PA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0A-P0M@`0p000wP`qJ 0 0 30 wЍ^C-TM40@$0L000< $tH $$00D $@0 0040R80$0p4pd(0  (PP@P<0D$ 4 00$@0< 0$00dc<c#L#H3#V啧#=3#`ߧ3#E儧3#03ѧ3#0x3ʧ3l#0\3ç3#)3|#|$x3 t#t`d30S X3 D#PL3H#HDM@3#8囧(0 㯧@0[NP (@0,0 $0S |"G6OD0"嬂۩x@r0 ٩0 @өx2 t0l2 @0d20\2p0T2P2 L0D2 @0<2@002p((2$"$娩PB2"@傧2 " @/2"@)1!@#1!@1!@<0 L0 30 Lv<wgINTЍ^ 1a`0P]`n6PT^`>S GGC_hC_w6PIY6PQFG67Ph ^U:Pg:Po:P$ ;P;P( C_d=PC_l>PC_?P@P$ :HsAPTAPp 5Np9`IDPӳOFPs H,~GPmS;NHa`1 p 0SmI0P0$03/UfP 0(03/,0(P00S(vMI40P!48<@嬑P(fἓ$P嬧804 80<@040푑'I垐ᡓGIML]I] vi^_Ѝ^0cPda`bP0 -PKbPcPhMGPcPKvXcPȲHcP[O]P 0cP/@-@P A7>@-@P A->@-@P A#>O-pЀIq{,Q0G@!@3`@)*TP "T@!00P 0W  B  S0CXp A=QP ЍB0 0 OGO-000C!1!S|/,PAS@!@3@p:*T` T@!8`  Y8$80QR㓅+3# P0008U! PEX 80QR%% A=`80d&P` Ѝ@ 8K88I8Pm۶$IOGmO-Ѐ@IDAt+PAT0!03@p%*T` 2T@!P`0U0 $\ IPPY f PX A9=`aP`BOG@-@x0M`P0 00@Dp6/P@D00 0 30 K0Ѝ^Q/G-@`pPU /P U  E[PMO-M@`<0P 1Dp0 000B?à0ZჁ! PE_S0 0PC_PVჁ  7/P 0E/0PၐI! P 1 0(0 0 30 ЍOЍ/^@-0@ N0 0!00ЍO-`P2$M@000PEYɱZ"`pKp1 0`00yW pG0 0EPESʤ1 0 30b I qE {P 8 uP! !0   pfPI  K]P W0:J0 P MP    <P   1P   0 0$Ѝ^@-0 0 00 QЍ@-P0Mp@0 000`0(+0 xQ !0 И@0P %d0!0@@@ 40 0 30 @<Ѝ^a`p@-P@ pp@-P@ pp@-P@ pp@-P@p0//G-M1@p0000P0萟0`(00P T%P80 S0 *" @GqH0T 0 30 d8b}<Ѝ^a`0`@- Ѝ@- ЍD D0P P0@o /0` VP/@-0M@t00,00}P $P 0#8 8Y7<0 ,0 30 0Ѝ^cPcPMp@-P@ P K;p@Ѝ1p@Ѝ/@- HP 0/ 00Ѝ8G$EGcPcPp@-@Tp P@:/@-@:@-h00 00X0 D0P 0 30 ЍY 0 30Ѝ^0`A-MP1P`@00041PP ``P PP 0S0 0 304 pP0 SR 0S E0S*V W#3=  PW 3 #010!p0 D000xz;Ѝ^0`p@-P@_ 6`op@-@P00 00 P`P U@PV`P P D0 w@o0 0 30 Ѝp^(H R@- \00 00P 0SS0 0 30 Ѝ^@-dM 1P`p0\00 1@NU @wN0 \0 30/ 00 oNP0V `W@p 4@@ N@T0 4[N@P@Tp P0 @ 4HN4ENCN:dЍ^LgP\gPegP R@- L00 00P P0 0 30 Ѝ^@-@P :P@4tgP{gP/@-@PH0D 0@@0=0S c8P Ѝ@0Ѝ@EjN$EGgPgP0/(0 @-@!VT@gOh ta` U|a`  P0Ug |a`P"VP4V Uta`  0Uh ta`V!V@- @0000Uta`@-~oP@ 000ta`/h07@-@ 000S$P$0S  Ѝ0$R ,0( 0$$00奠ta`hP$EGhPgP0/p@-@PpPKPP& PPpp@NH0@- R P00, 0((0 Ѝ8 Ѝta`zH$EGhP2hP`0p@-P `@ P PpVꛡw9ta`@-op@-"~@Do0P0P` h 0P00 R `0@Tp ~nP(0 d$@P@KUta`0`80< A-@dS<0VPPWWH`s@-@`780$PS  V PT0P 0LL0,00C,0B 8 0S0 0ЍphP$EGhPahPO-M3@s`000P0 RU33#03v QP0 ||0 ᎉ|Vl d|V*9P |ر|0 0d0᫉|VdV dɱ  |ű|0 0d0ᘉ|VdV dⶱ |ⲱ|0 0d0ᅉ|VdVᛉ0 0 0Zᤉ42 0 30 Ļv 0S  0S  0$0( ,0 0! 튊i ? R 0 $0(,0 0 rxQ 1p1PU`u&(0S0Y 00|A|  审|VP0|0001| 垡|V 1N|UdU(B|U 1:Ѝ^ta`!S$EGhPhPhPAY!gYO9RFHiNFM0`[OhPhP0P@- 0S 4L0 0R40@PA@@ta`iP7@-Q 0S1!010@ BAQ0BSV SP S0T `1yL!0T10T 0T4R R  BU00C0 P lJ|mmP`P0 SX0 p@/O-PNM@`< P,0 (0S  D0 ` 00P N0 0N0Ѝ00 S80@D40 [@ @p [:0 S@D [ WPN0T0N0pH@7XV!DP L  R އ H2/P @ R  EP V   RV  @R V  PRV  @R @-@00 000000  10V9  R9 N9 J9 F90 0 30 Ѝ^p@-@P NP 0 0Rp 0Rp0@opp@-0M@00  0,000R L R  R      $ S ( T  P唛00@00 0 ,0 30 0Ѝ^jPjPjP 00S/p@-@PPP0H`@Tp@8<|ܛ@jPBR[O=Kp@-P@Qp0@-00Q P:000P/pC-@PUp `\0* @0@B"R0C@Ё B(O-Pp䡟౟@܁@YP  ᥆P ᡆ 00S)؈ 8 D P \ T01SGt ĉ ̉ ԉ ܉   ͗ʗ IŗÚ|xtplhjPjPjP@RjPjPjPjP kP#kP7W[O6kPISCkPQkPckP~kP-PLNkPmQ:LkPkP0BG-? @P0$S#  B/S"00€`` C/ Qr€"2bPV*0`00BPσ0 p2ᇢ`L⇒p Zp1 bЀ`` 0(0@0p@-@PPPp00@-M`@` AB"@ЍQ/A-@`PVP Up  ENpPO-p0BP`?@ÐY F/T00!!@`Do`XP 1@ 00F?`†J P  11 @pp@-@Tp P@/O-`0M p@08P00 0儰媌UThPCd0TP  0 ' 0 0埙Ѝ0S PNK!gYkPkP@-P 0 00 ЍJ$EGJJ0 @-\  @\@ 00 000@-M1P0 00@(Q003/P 0 0 30 003/P[00S003/\岙9 0S  00Ѝ0@/0S  ~0^w`kPO-@MpP`E@VFW`J`1 V `F05   EB!0ESЍa E1 0 0P  P04  0P   0 0  0P 0  0`P0K  PJ V:pG0 P 0P! 10  0O-p$M`H W1&!010@P @PP80400 SD0@00 S4 $Ѝ0QS 0S00:T*Y @P 0!   0@P P0QS 0S00:T*Yw @Pp 0!i   0@Pԃ PflP$EGRlPkP 0G-@ᄀPM0` S   ' 003/P 003/ 0\ؔ`֗ p$@ 0`8qM4Ȕ,ƗL1!Q 0 店00S(0S ᱗(ė᫗#R 04$R 0@xtG藗 ᓗ,0祗,0 1` 列vlPlPlP YlPRlPlPiJcmPN[O_sYkJmP;mPkmPmPS00/@-@hT0p@-@PTp P P@p@-P@Tp003/P@pG-`p봀@PT U$ 003/P o|/ RPP @MP  MPP@P GgY;RmPmPRlPp@-P@Tp@3O-M0$00 SЍPX000S 0P @#0<,P y@T00 0p003/ `$F` V$*F咔B 0D`]7ὓ4 $`& 05`N7ᮓH%@X D0 @ 0 0XA80`4 0 0SW 0$ 0  Pb*P 07{x $ 0 7lL 7bٖ `00PS0 0 0 0zP–徖 庖 0 0zP ᬖh娖\外Ђ R 0:sa`vP$LmPmPmP[O*nP:nPCnPmPnP nPO-0PM 0 L3 0 0 SЍ0$`0V P 0Xp儐WZ k`P "0+P u@Tpӈ 0SZ N塓fpGhhCdd啓ZT;003/P8  1 (2(Q+) 0 +D60ᣒ $0 0  0 0060ᏒLQ  480P7 8 40\ BB!P@D0P, D @0$ BB!(P   ەٕ00S 蠟ѕ00 S˕ɕPn@d录,0  Ვa`RvP$L\nPNK RjnPkJW_sYjoPznP GnPnP3MJ[OnPnPnPoPoPGoPoP@JYoPoPoPO-0Mp PD`HR%@TN L0S>X: p$kpX */L0SB @2g<"08820S S X0`@P 2@ 0SV00R00S 0  P ! 0  ̇0[SЍd  0@ 00 V pX9:$0 0 00 X0.*@0 0 0P( 0 !  !ᎇ!SR @d  @b 0S 00@11pWpP$EGRlPoPp`A-MPc 80 <000@P X 003/P  0忉000ЍA/Ѝ(pP00S/@ D4A8 0 BB!A!RA-P`Pڄ匔p@T d႔(sAH{003/@Pp pAshpPpPpPpP qPG-@Ԑ`РPp00S,0003/P#,01(0S0S n4 ΐᚑh4\Ȑᔑ,0L0:ፑ[4哈,00 03/Pw`}Q!gYK=xQ0P 00/0X0@- 0L L0L噈H0 D 0@@0咈<0 8 0440勈 ЍC_l qPsPC_d sP sPC_ sPsPH1@-M000M0S (1$!0  1l 0@S-  00 00 R P /Q C0S 0 0S 0  P@0 0 30 o P*Ѝ^4tP$EGRlPtP*)S@- p` @T Ѝ003/P(PU M0S W P 3/@@-`1P0@N0p4P0N008P!   B R9P p , R噣f , | 03/Pp 0  Q0 L  IL00 Ah U:XP 0 ~P 0S~  ~z  ~P[:m6P 0$Ѝ^ uP$EGuPtPRlPp@-@P`:p(03/O-,MpP0 ! $   0 S1 $0 30] ۪00S@ 0T[ !P0* P0U 0EC"~r $U !0!@!P!E00PR`!`3` *V >#V`! 0e 0@0  UPXPEP AR&b@`>c,Ѝ^OG0@-@M0P 0 000nU0  R L0 0 30 _U@ 4Q0 Ѝ0^G-@MP|@P p1`0<000⌠` C' "6Z` 2d0  !0  m0  00A00x z 0  0r el 0(0 <0 30  V('@Ѝ^( G-MPp (2010L@T%` [EX 0 00 0lK 0$6 D@C`@|@@&0刡@TPMN00N0@ꁂ003/P @PU10(M R5/P0S  5/- 5/PP1S 3/ 0`1!PPP,0 1 30 v&ݍ^\t`O-@M`P00E SCVIb `F  Q A0 0EPESЍ2E0Yp #*^0* 0 \ :0J P : [:0`F PY * Y*^ * G-p1(M@0$00` 0R&0 00 !IPU/ 0R M  Z PJ0  E"/o b n U.\ YZ$  0BC2S$ R5 SR10 $0 30# 40 0 0@0 0 0PP  +BTC02N20(ЍG%0 $0 30(Ѝ^O-TM5P@0L00p줟.负`L10P0⋄P0@GPT CP#t0Pp D00S PT0 D00S |P 0uqDP@ 0i0-S0cP 0[ qD00SSUX lм<s0P# FP 0AP 009o4@#<sPw4p<ir0L%4<`hU $20$ !!S [U ᑼ$P0(0,00@勀0SX000S 0P4 ("0$#P. U/ 04080$00" Y ᗌ2wP000pP Yቌ +s A0  000pW X0S 0 03/4X vP YY r 0 pp0 hX  <q00 L0 30 HTЍ^uPvPOuPuPuP7EJuPuP"vPHa`ZvPvP$L9vP[O|vP0@-@06kvP@-@X"0p@-@PQU  R A0 0 000p P P 0!d01  /@-@P A"p@-@P(0 0 0000p p@-R0@ S p@S P00pp@, R/@-,N> R/ G-@` p P0R*S6 0S 2-0\0%0#*Y  P03#W ! 0 -00000P0 UP 0!0#03 O-Ѐ@IDAtPAT0!03@p%*T` 2T@!`0U0 @ IPPY J PX A"`aP`BOG0@-@00S s00 0O-RM@P 0 0LLhph`I , R, 4 R8 ( (00(0(0( 0 ( r (0S1!( r (01!(   @0#80ЍR   0  0, ,00R   }z@0#8000A-pP0PE0 00Bu0000 @ g##U@ G`V0 00P000{80 0 30 g0`Ѝ^ FG 0@-@@ 0  00/ LwPp@-@X00SL0P0S<&P40000 p@  p@^a`xwP,H2QwPwP/G-0M|1 x!p0,00hh1haMd`0\ XLT1 P!PL @><0 ?01,!00p!1 !00p)0 p$ 00p0p00A0pF0 $00A 00冀0 $00A 00GU0 ,0 30 ʤ0Ѝ^ xxPwPa`yPHO~PP/$00P/( S @-S w $8q0P/ss@-| i p@-PQt1@ tQP1lplQpQ2.@``@?!0p@ k+St1Pp0P  P :R/-OA-8Mp 1@0400TP 0k 00B,@, OU`P0 (B^00S &@`0D M0 40 30 L8Ѝ^}P$EGq|Pk~Pb`~PA-`1p0 00PP$t1S0 0 30* + @4 C$T 00S &},0 p P@0P 0  OP D@Ѝ^b`~PA-0`p0 00zP0 0 30% @P 00  OPP X0@0S E&0,0 0ŀP@Ѝ^b`"PG-MH1@p00070P0?0`V1!00f  O|P 㦭 000@0 AC 0ȃ@_00S %,`0` q 0 0 0 30 kЍ^eP}P$EGq|PPPb`PO-3\M@0T00Pd3倠0S %p`00 >pP2 T0 30 5t( 0P@mm 0S P2"02޳   [ V) ᬔT`∮0 @m5 0l!0C "12A!02, $ S 0l0 0lP]!0$ `B`0sml 0km2 tlP, v\X`=L0 mP av0Q 0 0 SUl ?lU l ?llx -}0 R,0S UPV`\Ѝ^b`:P UwN߀P$EGcPq|PD_NP8PPNK-OAP6MLPUPhD_!&Lz7RZPcP[OA-M81`p@000P0P* taV' 00S#v$y6P+0P?0S%] P0 000030 +0 0ЍA/D  2 0 400 0 30Ѝ^a`tnM$EGq|PlP<0P P P/ @-鶲00//a`Pp0@-0S b$X~TT庨PL  @6P 咲b`܁P V0`GIqII@-x00 00@O % P 80 0 30  5P kЍ^qII@-@0@-SMPx x O@ PHN P 0 0 30 Ѝ0^PP2A-8M040020S #o~BP &C @OCPP ;~0S2 S; S;Oa|Pp`P`P`dqPPE300 00U~00S  J~0 'ݱ7:P tfT0 40 30 `8ЍA/~7#0 40 308Ѝ^b`+P V0`GIAPlPXPaUIq|PP@-,M0@P0$0000S T#p0` 0 |1P\00 0} x7h10,0h $0 30  g7,Ѝ^b`P݂PC-4MCPc 2(p"40,00<2`pPw`0 zw2 "pZw`0 nw2 "p,pMw`0 0``wp2l"00<PwX2T"00Pw@2 <$042p 0,2`0$2P0202w"0p02hw1!w1!8w1!`w!0`^w! 0H`hw1 $010@1 P0100x|!0DpAwd!0`KwP1 0$0@1p081001 P00x  _12!010040$ ,0 30 4Ѝa`b`^ PoP T-P PPP Pb`bPb`vP( PPօP P^@P ?PG,P kGiPd HP ƈPP 2QPSP{PPP ߊPPԋPD!P h @-h00 00  00 00ғ0 0 30 Ѝ^O-,M(2`0$00 "" &lGV?Ap1!OS@ P4R !0 l|t1S00 VG``Gv 4|7G`v, 0  'R !  0  00*|VPVX  pA0 $0 30 ,Ѝ^PPb`.PWPPPC-@T1$M`000@PDHq!p(!p-l10ST 夯CA Z!P0 { TUV咯OO  P刯 P 40 `9 A0 0 30 $Ѝ^Pb`PP)P0@-M !QN|VOR:PQ0 $PЍ0R Q31 0P@-M @0000u00 > , P`0"  C  #  4h0P<0 0 30 UxP, Ѝ^M0S ЍЍ/O- 0@0 08PR<@pD`H00S0TP Y! 0P 00 0 0S Sp1`10H@pD`8P<0  ЍO/p` Ѝ^LPa`0`@-M0@`p00000S PbdP t嗮p00Sd0/` 0\\0嗮0  2 ˙0 80Ѝ@/^a`>Pu^P$EGq|PfP@-@0`0 0000S l  2 0<0Ѝp@/ PP 0 0 30Ѝp^a`D0@-@ PZ0@L0/X x@oV,0@-@PF0@P0/VD0@-@P80@T0/6 x@oV,0@-@P$0@X0/V,0@-@P0@1/V0@-M@P80P0Ѝ0@/Ѝ0VA-`-rM @P200020S `2U\"  L"QH2H0 y300S0UP`` 2uP0 P (P5/1 0 30c 0S UP` pPP6ePt1p!0ll1匭0Lq0  , `0" #k4@h0TּP N2aeP,00 g , `0" #A4h0P ,*3Ѝ1`^b`PN!gYPƍPa`V0`*P$EGq|PPp@-M @PX1000L10S `) $Qy210S 1P  2 B0Ѝp@/:00  ,t P`0"  C  # 4 h0R@0 0 30Ѝph1,00h1n20^b`GP1`V0@-Mt0P0 000 P0坜@T<0 0 30 t9tQI( OЍ0^O-YM@P040\1040S Lp+`(0!x1@00JYt$`h0P@ 03/pT@c8`0X00\0T `04xTppy{N1c8Q?`<140@a1Da1Ta00 ``4x{Ta,$|h4P_PP `3/\#0XX3>P4@#0<g4_e4 1  Р FvP 0S RP0pBPW 0 R S00V00S$ (0S@0PUG h2JD"0@@2 [ Z R  WPRUP p0,$!$@Mh0 ` (0 0,y,@ >hU000 p`(0Sl1R@!0<<1巫$D!$@&hP,(PX!,@h0P00S1S 00囫P@04 C' H@$0P L00L0|4B'P6P&,,$g 0 \1 30 Yߍ^b``PzK1St߀P$EGq|PP-PKwNKPK.PPO-4M02`0,00 " &gGV?<l1!OS@ P5\ 0 lwt1S V G`(`Gv 8~w8G`v- 0  [( 0\   0  00(wVPVX  n<0 ,0 30 4Ѝ^PMPb`rPWPPPC-@T1,M`0$00HPLPop(!p+g10ST 墪A<XP0 v TUV吪OO  P冪 P .0 9  <0 $0 30 ,Ѝ^Pb`PԏP)P0@-M !QN|TOR:PQ0 $PЍ0R Q31 0MPMO-MNP 1 a0l80000$0(0,0004080D8/<0S p) 0Pv/80S 7P 001`0 0@4/j;10< @ <LuP|0 C* $ & ( + T0 S "R 04G00SC 0h1* (P,0U(P$ $s$p(@E.T` /H@@X /@W ,A0$`a(@,`L@P诽`P0 0u/~/00$5 0 30l Ɣ`( $0BAVY*Ahq0Ph10Sb (I( $0BAV:5P%05l R  BF/(04P0C(080U4P%004@ETp -/J@@Z $/ @X 8AB00pq4@8p@P `b010EPQ P$P$!L`   Pu.pUU 0ELS ! ! ! ! ! ! !| !U? #`P L \0/ \h10h1LP00 L \h10h1 0 \0F \U $9L \h1000.0$0!h1@ 0h1 00w P 0t000|PU&ha` 0S C0p藼0F`Q !!!`   td.h10h1P "0`4PRV R 0S |tV 0S \t18-lp0l1p1#0PS `}@Mp0 00nt..r.nR#Rm08H 0\p0ЍOЍ/^a`b`P1`VOG V#PXH$EG5HIPPTPڐP Pq|PPȑPP P|P#P0@-$M0 P@000 00 00  0 Q0 0 30 $Ѝ0^A-@`pT$P0$00$@0 0 p 00p00p0QA-P0M@`0p000)P`#? 0 0 30 ՒЍ^1A-0S =|sxax0GC1hC1S@ 0GHS7 lS0 $S 41R @ R $ R$@W(P600S 0 00Q %@ЍH RH@ l Pl@ 0C x0R $@ d0R $@0S 070$@0$P0EWb`>Pd^`98VPP]`fP' Q G@-00 0000S tNsR0 000P80 0 30 B<1S G Ѝ^b`P@-00 000S ,X)0 000–P,0 0 30 ` xЍ^a`2O-M000x20S xdr`"0p00Pl P"00x H"40t @"80 828BR(002,0  ,pPPpl0(   !@0Pl 0$00(0Saᬁ먑l⤡ļ p!M+1   囜嵼 0< 0\14!0<1[ <0 0 30/ ljlȆ 0l 00 000 00$00(00,0000 0SS GG^`aIIV?I^ a`?I?IoPp@-MH1@00000010Sv_oR000 0r0 (P5/῰P  ЍG Ѝb`0`1`^@-@ `P00ϠP 000ЍpPKN0 -"P@-@ `P00ϠP 000ЍpP250 TPA-`pP\L00 \ @Hꫪ 0P/( S @-SUUU G-p(Q`|0x@T1 !01*  Q ^2 Q.0S T0T00 H0:/TP ЍWx0T:|0T:p03l 0hh0帠CT  0CR00|@T b`PTPAPH$EG5HPA-@R DpP"`Vh P 0Ah b`(0T R h @-nb`qP@-T 0 0SR^\0p@-P0@S 8lt`O pb`P0A-p0`PS @M 0f 0ul0P NpU`00@P L! 0 PP P1ЍIb`P\0@-0SDHl@#8@H L@  H L/b`/Pb`G-Q@`TYTp00S`10S V LrpPR4"W,՟KP$vrP p 0V00VP  PP !"YP 00 0 0P0S0P0: ᯶0 80G/b`^1`VP|PPPO-`-A Mp$8P+CL0H0P00T0SD0AS00Y0S< <00S,10S *L+SerPYY Q00 0 P 00S k Ѝ/P 0000P0 S0P0H 0P  HL  80 ЍO/b`^1`P|Pb`P 0TTT0/b`C-@RDM2 `刀0<00㌐pr @$@(@`T嚱H PL2 H"`@De<2 8"`4d0`dp0 re`dbd!06e! 0P@e1 $0101@0 @1e$0 pdd(0x `d|dx1 t, 0l10d1@0\10X1of,08 pd<d00 `d d1 40101@00 @oe40 pdd80 `d(0 <0 30 DЍCdb`^J!ЭPb`հGܭP.P#!cPNP@T!P b`Pb`bPvPɡP;PPP^+PIP'!UPhPP%P^EPePPPޤP*PuPPG- M42P@0000S S- 2 0 30{ p r10S`  `ṭ1 Sjq q!-ǀ0SH` Vr0S0p0p! P00Ёᅭp!nd 0  j0 P 000S !Wd p孝 -0/0 !tP 00 t Ѝ^b`PP.Pb`G-0pPp`TT0T@V000 T V0 0W0TTb`^p@-@P 00Sy!R0*٫pn@PP@9 0p@ e«njP^PPP0S P0b`,000S0S P^,QQ\ P0b`O-DM4`д0<000$00S  ]i( V4&$04|D00T hT0 P00T0X  00S0$0 p0SR(B/0  R R R p0 ! p PP Ϝq  0($0 0 D0`0 S vp V4 h($pp0  3X 0 (00ps00S S' Sp0SY NR0S I0!100h0D00(0 pP(y0 1pFJ0S (0 !b0 00000h0,0(, p(00! (0p0 (D0 p0h0 }h0,0(, p000(0 p  0Xr 0R 00S0m(0PT0 BP0 <0 30 K`0VT0(P 2atDЍ^b`֦P]J$EG9JJ^b`PP =P0b`zPPPPMO-MXGP ` H7,000 T0(00T00S '7Q00 0g0S06&06庛& 000P PvOPV00S 0RV 0S ᭲00P00400 5/y,6"pᛲ08P000400 8/0 S50S] & gX5T∀H0  Xp CP  H   \0P  0R4S20S/X $~|a00P 0@P:gP_*#Q@` ᄯX00T00 00 S003 0 30 C@0T0_P 쓟00 Ⱥo00訂t30S g0  (,08/000,03/00F43 9 0000000S @ 0`TP 0S b  03a f~0S00S0000 Sh2R 00 0S000S080,"0S :00SL0S) ` f0S 0SC 0S 0S`  f`$ @0P 0S`0S0S  ` 0$ ` tfpf`00S``V 0R00S000Q@0S00S 070 ЍOЍ/b`^b`OS>PP$EGPPV!1`^|b`P0`YPP0b`ũPP P1O-`0MAX10S TP0T0p0 D03/TPP Ѝ|Px0U 0U P !EE|P  Q\  Q 0S 0 00巙0 x| E p0   |YP  Axp0z'|PpTP^b`1`~P$EGP1POGb`O-8-xM0000S & e봸반 X 0000P S $  `  ] @w@8h@0@X(0@@^@X@@XD%\HP`PD@H@@t00@0S) $0S 7'07%h @.0S pOe0h60`S L7VH'H ?eV (000S  3e000, 0,0P 00ߘ0S @, t e000P000 R00+ y+0S S& Sd04 i4m40@1  Y0S U 1!00d{08 F8J80@ <$P 8X0@0Q 0i00 000SH  ٲ!^0 0000d90@0< P00P00000<00<P 00PP00L00HS 夲0 ?^0 00QL LH0 $00 P0Q00i0 \#XTx0| S|0k000SB S.s` 0\ 0 3 #03pYk\XL2 0 30 - 0S w c㺮P |20StwD0P`媗X9` 0S(0S |@0T p@'!DD|@ xp|0D$0  P p  g$0 bW@ A 0xPR%|@P| 0(!00  018`0<0$1@00P0 0SW\4P0< 08@0;/$@jЍ^b`Pb`^a`N^P$EGPʪPP)PtTSK/PQ IPPPP)PhP0b`PPP#!OG^`aIIV?I GP]`?I?IݬPP1`/PwP^b`cPp@-@Pp@//ЭP/ܭP//@-@ @-@@-@P A0p@-@ `PZ 0p@/@-@8 0CH1@LP*@-=Q10* S1 !/ /᫪UUU0S/@-嵖FI, 1 s 00@-0婖/b`^Pl0@-@000000C S<啖 000 0 30 сЍ^ GI7@-@Pp0000ϒ000C SHu @ 0 B000 0 30  Ѝ0^ GI ꟚP kgзP0@-!0 0 ^TP T 0DSx\1P0~/l01Pf1PPD_oRᚨP pX@00p P>pJ0@ a 0000^R FP0 0 30 i|0NB F$Ѝ^HODPXPlPPPPqomki/////@-@@-@@-@@-@G-pR`|G]pPd`@T #P 0  ]@P!gYS6M@-@R0P0 00 0 0 30 {pЍp@\`T 0 X'P ,\0 0 30Ѝp^PPs@-`R@P0SЍp@\V0Sl P 003/P80x4 0000mP((Ѝp"P/P9PP$EGPBPTP2M0@-@000P@@-@S@A-pRl1MP@000 0SD1 0 300 p{ 0 30ЍA`\wW 0S0 0 30 dP |0` 0 0P :\rX0 0 30ЍpL   0  ᤖrF^"P/P9P FGTP2M@-@P 003/@-@P 003/0P/00/p@-P@7p p@-@0CSQ*" 00S(  (  00 CLR  p@I@-`P1S!01問 P0CS 0@0SP(  (  00 CBP 0  P D C` 0SpP  U pR p ЍpP 0! ! q1Pp0q1Pp]kN$EGPxPpp@--P/$0*0P/( S @-S$8qP/$00P/( S @-S$8q0P/0@-P0U00S  4$bQ 00P/0@-P0U00S  4$bQ 0L0@-@y9T0S(0$ 0 0廎0Ѝb`P$EGPPX0s@-@`^9T<08 0440壎PT0Ѝpb`(P$EGPP00/0 01/C-M0 0R0 00y @ ̐0P 00SЍ J!P  0 p3/`PX0@ 0<0V  0`P3P$EGbPPPP@-@Qx09t 0p0p4 0R 0SP0;< 080uT,0= 00Ѝ"J$EGPPAPPs@-@RL0cH 0DD0 P`u00!Ѝp@RQ$EGPP@-PR|0x 0t0t`p@X00!T@0, 0(0 Bo ЍRQ$EG(PPjPp@-P@0pp@-P@0  pp@-P@~003/Pp0 R  pp@-P@`i0V0! 0  pD0 s@-`R0 0||0卍0P@03/0 0S 0!(0Ѝp0!XRQ$EGPyPs@-`R0> 00c@P!0qP 003/P 00!jP ֛0 03/pЍpRQ$EGPPK-MP1`p@0 0 00qX0 00TP0 00U0Sڰ0 000 TP0 0 3/T0 0 30 2x0 M 3/ K^O$EGPP&PHPK-M`$1@pP0 0 00X0 00ƌUP0 00V0Sڸ0 000 UP0  0 0 M 3/ 0 03/0 0 30 wK^P$EGmPP&PHPA-p0@P`U < 0 0000  Ѝp@-P@'00!0  pA-p0@P`( 0 01lЍO-0Ѓp8P` P@ @X 0 00 Y I ЍO[ 0 000 ЍO50  0 ЍO/ ЍO-$MpH0` ` P$Ѝ@Fot \Qt w T\ʕ " ` Z: P @00 T@G$$ RP@ LPH$ЍO@-0 Ѝ @- 0 0 Ѝ 0 s@-@Q0_ 00嘋0P0Sh06T 0P0`T Ѝp@0 Ѝp@ "J$EGPPAPA-@Q0p0 00j0S0 0000W 0x 0t0 :P 00S P00SЍ `P"P$EGPP.P@PPA-PQ1!0|1|+0@0Sd1P!0L1`xU ЍA~0 S 00S S'y0!0@Ѝ P# 0 p 8P 0@0!፪0!0@0!0 ЍAl "J$EGXPPAPO- Mp`L1@0(0 0P0W17!01届UP1q 00V0S0r 000@ UPZ  @x0 (0 30 uRZ M  P@ \> K^HO$EGPP&PHP@-p@P`$0 0 000 ЍQ@- ^00 , 0((0Jz Ѝ2P$EGPPO- M0P00 `h1p0(0 00{ZD1@!0<1<%WP,1!01X0S1 000 WP 00 S @_00MS  ^P@  00 S z00 (0 30 u; K^{V$EGgPP&PHP@-p@P`0 0 000 ЍQ@- ^00, 0((0崉o Ѝ2P$EGPPqs@-PQ1!0 1 坉0@0S0. 00U0뇦`100ᐞPᱝ Gpᗝ! 0AЍp0S 00S03 P 0 Ѝp@= "J$EGPPAP0A-pP@` lUTE TA P<  0S6 p  jU T0puP`@UUV"U P@pᖘ`pl0 =U L7UTA40U `*UdIcRsH6pR[SpK[OO-LM3`@0D0033PU 3|#0xx3҈ul#hUd#`T\#PTP#LTH#HT0u0000 B" P# 2Q T T U  EqT0!T1 SU  0G 00 S hZ000 T0D 0 0T 0pW[,000 ᖃ,40Q0 R m00 0, 000,04p oP p yT  P4 p W 0,p40,0l Q 1L{PNLP P  PpP 0 00 99i P 0 `V PQf 0 z 0P^ ` P 0 0  0S0 0C00 !Z0  `^YQ p3ca0PR  SR 6l Q 1a V  ! 00C07R  <,bQ1pP|<P \0 0V- '2Re,Ѝ^VP$EGPPb`b`0`b`b` V0V@-@T@UPA-P`pS@0 0 0 0  `a>O-4M P 1 0,00P 0@0`P  IPXp0U(1 ,0 30C Ko000 3a00U ^ R00<S G_`̟!X C_,!PPPP@-@P @-@P 0@-@0`P@-@(I- M0P@p0 0 000100M  .P`0 A $0 0 30 lK^I- M0P@p0 0 0b00100M  P`0 Ab $0 0 30 lK^K-M@`0Pp0 0 01 000M=p `  0 0 30 lK^K-M@`0Pp0 0 0 000Mp ` p 0 0 30 jlK^I-M0@Q0 0 00`p Rʜ0  000100M PP0 A $0 0 30 3lK^2P$EGP&PI-M0@Q0 0 00`p Rʜ0  00؀0100M PP0 A $0 0 30 kK^2P$EGPPK-M`@Q00 0 00pP Rʄ0+ 0||0囀   Mip `  0 0 30 kK^qP$EGPPK-M`@Q00 0 00pP Rʄ0+ 0||0d   M2p `  0 0 30 kK^qP$EGPP00P/D0 @-<aPP0 @-<a-PQp@-P0@0` P!P0S`p 0 bP 0P10!0 00/PG-0AT Pp`0YuP \ @02nV @ P @A-` 00<" 0Ap ^ ? aAPWAAAP7A ?θH@-@@0 0 00P000 0 30 +fЍ^@-PM0P0 000 0 30 f0S p/`@P 0 0|P  @tP00Ѝ^@-H@0S (㋉_ 00 0 0 0 C @b`@-@T0 R0b`@-,M1P@p0$00`U PedE0 Ṁ0 TV@T @dd1t0 ᥀V \ dP0 D0 0 $0 30 e,Ѝ^XSiJ˺TPPb`^  @-@p00 008P @0 0 30 keQЍ^ @-@0} @~K-M1` KKK0 0 0P 1 0 30e :eKKP0KKT SP \[PPP0 Kᘀ  M p @PKLP |0: S  S   2 ~P p T P@0l1s @ PPQ(PE℈@ DY @D! CK^b`@-,M1@  0$00P <0 $0 302 dpPT0S  P ahP0S S S  0 03Nqp1,Ѝ^H-Mp1@ A/KKBK00 0PP 81 0 30G nd,KKBKAP1K  M P P1K  M ` PKKpKKW0:9C9SP t0:9C9S epc/0'S00K^0H- M0@ KKK00 0P 0 0 30$ d0K  M P P|KoKP l0:9C9S  5Qqf K0^0@-M0@0 00P P0 0 30 cPph0SNP bU,0 U 0!0Ѝ0^b`O--\2,M 0$00dP (2 $0 30 cpp 0 P! +CGPPw w ` 0M L@PR.0S( 0MYX @@0q `[ @9T @D &b @@ b tT& l0/003/P@00P0S @@Æ @T.P0 Q P ,Ѝ^b`$9`G- M1`000P z pp01 0 30E baP ЁP @| P0 ZP w wqZ 00p003/0$03/T_  L@P-0 S 00) Ѝ^l9` 9`A-(M1@0$00P 0 $0 302 b pP0 0  ^ pP0 0 v0 q-` 0 P(Ѝ^pH-$M0@0 ( K$K0K00 0%P 0 0 30( Cb(PU` 00M0 ` KPl00SU  V{UpPKp^b`I-MP1@ KKK0 0 0P 1 0 30? aKKpP0 Kp  M` P nPK[IpPP 0:9C9S 0 `KKBz0` K,@0` K{P>K^A-M1P000 tP (\1 0 30P a p`@@P0pS40 h  v!<=00040'8(<QL^/0 ` p /c`/a @0RW@/0@ P/A CR7C/p@-P@Qp@Q BA-@`p@TTPT  /0`/ BQ0o/\ /0 S/ 0!p@-`@P0 000@Sp$BN0C%RP 0P/0P00/L^// /p@-@H~H P@ 0P0p4>QP/A-P`p0S<ss@ 0 0000C0S00Pp@-P@/ op0@-@000p`TP 0T@S`0 0 30 ^7pPT4p p003/0$0 Ѝ@/^l9`0S ESp@-@P^YP ZYP Pp.Up//s@-@`V 0S sPPP Ѝp 0S0x5S 0 00k0 0V 0S\rVP 40x5S 08 0 0k0P=Pc`PPw Q?YlPPP0@-@03/0@0/T0p@-P|@P}%0@>S @ `0<21P@pc`@- R@P?3#kAPjj@-׈P@ 0<>QTRA-P`pP0S<zr@ f 0000C0S00PA-@p0S@br`P z 0000C0S00Pp@-@$P!A ".7p@AS  LCP HCMP DCrP @CP QPPjPP=PA-`P1000, PP( P# @P @P t0pSq@X 0S Wh )zDPTq@$0@p 0 30 ]Ѝ^ PyLW?P%MDP]PPT^`^ @-@0C S " 0 0S(  (  00 CB\ 0  000O-14MP0,00`@l lp`l0 0$0 ``p98Z hjl$@0 7(0 ~70 ,0 30 \4Ѝ^h`PP4P!QT  P/R  Ӡ//$P/PS//L^0@-h0 0 3q{P$EG>P=P0@-S S S Ѝ0 00qJuJT=PP@-@of`@-@og`@-@oh`@- P@of`f`@-@oPf`@-@og`@-@og`@-@o`f`@- Pg`@-@og`@-@oh`@-PpPg`PP@-@|P808 1L 0SS@B >QO)PfP@-(@Xhx@c`7@-@RP 0 0S ,0( 0$$0xpT Ѝ0P$EG=PPO-`ᐠ@P,@Ep0@l pk84pY E0`ek@0Vĥ0`@EP:SQG-Pጐ@@L pvv@D@`Xp P iv@0Uĥ0P@EPP@-@og`0@- @  T0 XW00 QM0S0 @-o c`P=PS o  02 /Pc`BA-ό@ T   B/\ B B L/ Q Q Ap `XB aNQap P `XPNQ Q0P/$00P/( S @-Su$z8q0P/0@-P0U00S  4$bQ 00@-S@ {z0 0   0P 003/=Q@-0  , $  ( , <@ D H Ѝ7@-PP0 00Eo8AT`Ez|  0 @$  @$@4 8@<@@@D@ P@881P 003/8 Ѝ0[N$EG=P\P=Q81S/@- 0S @- 81S D@o@-81S D@o@-81S D@op@-P81Sp@D0S$ p@-u0P 81S z4Ѝ 0 P/00/p@-P(`@嫜"i p@衜c`M7@-$@P 0@0 њP(@ Ѝ0@Ѝ<0@-Q,0N( 0$$0n 0 Ѝc`P$EG=PPa`p@-@P@05c9=?0P p@G0p@-S@P p@:S @ZR@-$00pGn>QP P0@-M@$P P @ 0岺TUЍ0@-P 0 00/n ЍJ$EGJJ 0@-00Pc`a`!gY@-@  @?굺Hp@-@@0,`(P0V(P 0A pPn4>Q@-@H0 @-\  @\@ 00 00p@-(M0@P0$00`$x0 0000 00 0\0$D#,0 $0 30 X;#(Ѝp^1SP/A-@PP `p 0 \0T  @|pO-@MPp0 00E@S CRH1 pQA05 `E F!pVЍñ0 0 1   ` P   V0 ! 0S P" 0    \C0 Y X : 0P0C 00 V O- M1P`p0(0 0@aT-p[M @RZ/T I!0/o b a@Y0@` <V$`X)0 (0 30, X+P0 ?@@p 0 sr `p``  1`` K^@-M0@000`0P pS  [|0.S lR|0U00000 F|Vp d0U`H0 0 30 W8`0bP4 0UpЍ^"P V0`0@-M0 P 0 0000@ ibP!P  0R H0 0 30 WЍ0@Sb0 0 30Ѝ0^0@-M0P0 00r0@ wPF◕a(0 0 30 VWXsЍ0^0`Q@- l@T@::PrPp@-@p"P| 0 AePSQ00000!<0A80A40//00/0S00/p@-@ 0RP S:S` *`PQ@A00C pp@-HM`0@ 0D008@ &,0 D0 30 V HЍ^p@--<1M @000L 1(P Pj0P`PPQPR$P4@`,DPHPzLPPPTPXP\PhPiPr0|Q0`a1y/151d0aafQQjlQQQQ!QQQQ 0 30 VЍp^ V0A-@0`0P0yv ppPnL2P 1 UUUC-,M@1`P! F _D0 0 {_D0 F 0q_0 0  TPЍOЍ/H T< Z_PL^VAQL$EG=PPPz7R PPPMC-`-,M@p0100000+2 $PX0  C   ! ,P`0U0 0 30 JO ξP 0S 0 0,81@ḀS D$∾ЍCЍ/0`^@-@HsP@P$0P@-@0S 0S 4i6P  ]`6P@'P[PuPp@-Pv@Pp 0S p@'!0S dH6PpiP \H00S 0S p@0S0!0pp@P[Pd^0c`@-HM0@ 0D000000000'4 0S R'H0 D0 30 N 0S ۍHЍ^?YOh`MP@-1!C@O-M3pሣ000tXX@$PK`#\$p`ɿ`0XS՞(#$p὿`P3`  - ឿP  D   ,@`0T~0SYV B(0SpŸE@2 0 30 1NP`0 D0@vx5S @$0萍X0 S(#&S\DwX`^\0S00\0^\0S 00@@t@dP@x5S (!((L[Hd`S ( Aow&Da0S RsDcXQY0SV  0 0R0 R`0S (0S X`Ѝ^Vc`0`1`0`P P?Y@-=A-`$0S!P|1D 10S  Q   P1x5S <u.1弁 HB"R@0HS; S3 S0 0R @!nAD00S 00Q@Xp X 0 0R @Gp00Q@ 0Q @  B0 0R @0 0R @L^c`*PA-1Pa FB"R@ 0FS, S% S00U @ 00U 00U@Vp%!nAZD00U@ 0U @  B00U @00U @00U @pVp@-`t0@0YP$Ppy1S q|QU k>Q@-@G-hMp@P10d00+aἑ0I40(JZ@)0ISF S> SUPP Y0P P0Y  C@B10S2 @LBuL j-&P@P@P @`PJP@P@L40 d0 30 ?LL\PhЍ^c`LP@-@`Pu!@1R Ѝpp@- M0P000@1PQ P00 PB00S z`t!1t0C C1, niC<0 0 30 K Ѝp@ +B^c`wP@-M@\qQW `VP PЍ0@-MI@P@bU _@] 0 q@TT Ѝ0@T`Ѝ0PG-Pᜀ@p)0`00!0$嬕Uqx!0@ST㬕衁t tJ Y嬕^c`h""Pp@-@`P#P *P ppPpp@PpH^O-px`tPl0@ 00!0$嬥uNxP  嬥i!0S嬥P^c`h""@-@d0d 0S X BS@$pw& S$kw( @ _L^">QyX{TP=P@-@0 00S@0@-MP@ vn0SzPЍ0@$ 000(@Ѝ0@vVM7@-P@ 0000dUP x0 0 30# J_P xP @tUPh i0P S  @Z8 Z Ѝ0@Ѝ/^ VPAQPPP@-$KPp@-P 0S p{0@ 23/p 0S 0S @opf`@-T@- 0P$vPa^@- 0P$vPa^@-$0p@-PU@ p $v!1R tPp|1p@$ vgPp|1p@,!O-@24M⌢P0,00p  y$P`C p3 #PG C0AS@v```vP *P*P uP[P`@@uPPTPb BK AP:@ P^ @t1x5Sl! @T1 ,0 30M I@1x5SW` `$pP `wv0x5S  0Z0x5S 00Sg[pd[p`U x0x5S  0p 00TTPWHD/@4Ѝ^H^c`P3P(P?Y]P{PPPO-DMl3pP0<00@ X?圧PmP 0S $^ 0``$   R# & m `v`mbp0 0 0 Cx5S! 0 0$t2HZ [ [x5 S K$08"8VS $0"V$ 0S6䡟1ipp( $0@ SX SU:"8:":":":":":"9":"9"x5S @nP1 <0 30L HX!@WVx5S PpPPPPp@-@,PzaPp[P5NPO-MxP@`pl@VЍ ;00 0 B B0  00010 0R?E ,P }[0 SS)0 0 0  00Q 0 B00h0 B0P0  0 0$? P O[`P5NQ$PaIIp@-@#HP@0S$O[ PpG[MPP5NUPp@-@HP@0S$4[ Pp,[qPP5NUPO-(,Pp@`@ 0 Y,00 0 @P@Q?0P 0S lS  XxPO-M0pTPC X`  1!01ZPRiPW@ X R& [+uj rjZ@00DP IP ] I@D DPЍ;0J0@ЍO0e`P$EG=PPPO-M0TfPE OY`0 1 !01ZQSp;RiP<@Y -P% W'jj[@00HP P  <{HHPЍK@pЍOPe`P$EG=PPLPG-Pp`@q0%0P00iUiUiuPiYPP^> P0 G0iM@-M0P@` 0000p 0QS 0CSP ;00SP0 0 30 E80x5S , ,,yRЍ@Ѝ/^]Pc``P}P?YC-P$a@ 1p$MT000( 0TSP@ 0;@P @0 @S :P  H P 0POP H0 z$0 0 30 D$Ѝ V^K0`@-M0P`000/@hP+  00Pph d0  0,S  000  0mS 0 0 30 xDЍ^PPA-PM1@P0L00p00 0`!08 0 0#80 0ES<68Y΂`V>PA _ W P 3P 0  0,S 0@00 n000  0mS Ⓜ00 L0 30 D@P≂PЍ^NNPO-U QPd`PA-Ptp`l@d P0SlS00R >PPA-Ptp`_l@A -0SlS00Z/ PPC-pP14M`DT0,00HP (1$!0  1oT@)P'P  !bp Pb Xb 0 O48  Q 0mSTQ56$0 ,0 30 m?4Ѝ^h`2PT=PPcPA-`t1@MPph\0<00P L1H!0DD1T@qP !b` Xbp `b  0)O$ Bd( $:$  0CS*S ^ 8 j<0@o <0 30 ?$ #@Ѝ^h`PT=PuPPPO-QM@1p80 00RY Ѝ c`^O-|M3pS`0t000@~`P `00~p4`S4S 4Sh\5S5S 8,05S @5S `4S `5S p5S  (0 0 0 $0(0K$05c9=?0 S|K 9d & "  o [PR0 葟: 䁟࡟8^0S 0CQ}4A8P`0S8/`@:V(1 t0 30C =; `P SP`= 0P    V-R ?R# +R#  XR[P00PR F`  P x@Aж;/  `:Vq|Ѝ^c`CP5PLPXPaPbPoP|PPPPGPP>QDQPP@-@q0P p@-@PP  A2M0pPp@-M@ `0 0001 01006 P@0CS* 0CS*`0\ 0XX0Q 0   0 0 30 =Ѝp^QP$EG=PPO-@-3M0005PT 30SP #4`4@PPhTppWLp0P0$ ( $1h0$ "%횬0@S8L4 P(LUAkLg`mQP5NUPQA-@`?pPBT 0G00S$dL @P\LQP5NUPA-Pp`-P. @w001 00JL XGvw0-   0 0uw0(]P (ЍA LЍg`Q$EG=PQQUPO-pP@0!`$G@[ F!G`   \@;00@X J G` \@;00@W J F` [@;00@0 00x0@S 4\P (K"Q+Q1Q8Q5NUPA-p@|P`P# P 0F/ ;T@P T @(o, FrK0f`?Q~YLQPC-P<1Mup0 00P9"`P g@y0$0(000PUP|PS P ff0 0 30 6a0@S p0 i@T g@'c ΐe0S tЍ^a`0`O-4M@PX葔pϱP (0S004Ѝ̱P,aݥP 0Y$00(,麱P4ЍOبA`P ᳱ SbP o00 0R`00V@  R4ЍO_0`AQG-`2MP@0000p@P  ?rP1d!01J0 SR? "R $00y,(`Y=(0, S,0P`R)3@04040D0#$ޓPP0  } P  F   W$X0P003/X0 0 30 50 0`3/PߤЍ^ VP$EG=PVQVMO-0p<P 814@000  ` 0p 0S 0ES OS I|1D 10S @ P 08d0 0 30 85@0 00H0 0  ЍOЍ/^PQL^x^VMO-,MhP\` X3p P0$00<3@  P 02 $0 30 40S `  ! R 0S 0020<p& 0S0FSOS0 00SG E0Cs R\SYȊ" "؋"؋"؋"؋"؋"؋"؋"8"h"؋"؋"؋"8"8"؋"؋"8"8"X00QI 0 0 S S:`0 00\0 000p00  0L R 00\L[ 0L0řP0 Q I0 P 0(@xvp 0(@T!?P g4?P@0,ЍOЍ/Q^ VVPx^_QQQAQMC-LMhPp4` ,1(!0D00001ԇ0 101s@IXP =p0P 0 8XPCs0 D0 30 30 !1RX |1D 10S %sLЍCЍ/h`^?YOMURL^p@-M0`P@000P^ OP mo 000᫯@740 0 30 3 0Ѝp^ VAQO-p14MP`0,00؅,PX WZ0@ ! @Q@SH1x5S 3@Y4Ѝ^@e`c`Q=Q?YQTQQO-,M pPP,10$00Y@(040=P `H0Y 0g0c00P=P FB, PY(@4@h0 $0 30 2X=PH=P<  0 ,Ѝ^AQRlHQVJ@- 00Ѝp@-@GPmPp0( Qpp@0`O-M1p0001@tAP `1 r P4L0m  C    G T0ZǨ0 0 300 2Pa?FC1S SXG[ V<0 0⻡M4= ⑨tЍ^g`VQYQ@- 00ЍA-P-M @⸀1`0000Xp0P0L`<P1@1 ,`P`0"  C  # ȡ4h0P,1@0S10V00S FX. P/ 681S cD@,FV VXS0C00NVKV00@P0 0 30 1X0XTL_PD@FЍ^VlHQ1`w`Qf` Q4G_QQf`@U,Q@-@00 00/Pf]P `,` uA*0S V0 0 30 1Ѝp^SQ@-,M @p00$00`0I<@P @0 $0 30! o10S 0S P T00 0\* 0 OR@K@DOoB,Ѝ^AQG-@(P,p`20SP@@DB@Dq0 0L00UUZpp#* s0S 00 0j0PP4 ЍzUTpE`QQO-014M`p(0,00nPz$@$@X E0 ,0 300 0r  0 0P#(Qځ rzP (QA( 00 3/ P0 $@Q 4Ѝ^Q ?@-"O-LMH30D000000P !,PR 3V;P,0S 00S cPg40@000S @0Zj V0X 0 @0R Ip00`C02FaF1 0` 0S"0 CR? R7 LR;P 0V0$00(04$0S 0$04$0S :PL`:P`:P`~:P 00C:PL`:PL``PpV'0 D0 30 /nP lEO<0@ 00$@8%LP'LЍ^0`AQk( VO-M 2pP0<20;$0S!wD`:P 1 <2 30l /0S 0S @Z )P i0S$ X! \? 0  >}( 0S .A 0i0 20P 0S 1S E/?0S 0S ,d ?41S 0S ,4M/?ߍ^Q=PAQd`QQ#Q.QA-pP`@ >0 ( k0ES,CmS <QPO-4M\2@0,00ZP' <P# &v $p $H 4 ԑԡ P)P  ]T[T1 ,0 30_ .`PM @00 P[ ; 0 0>5)!0Pȁ rPp !d0Q0p PpY0 0 00p P Q 0 I>  SS늫4Ѝ^@c`EQ[QOQiQ@-@a00 0S@Sa`@-y@PPY0S@GO- M6@p`0(0 000hK`6`&0\6\0X6m0P 0<5S0  P68 K0S t0d23/ Z MP00 0S x BhK1m`P PP <PVk@ ,,.qR;PP!  \4 yP vB!  hP xfB013/ :PL P MB0 v8/p 0K0 0<23/K 뢋Ps0W0CSV)BM 너dcP 0P0:x0K G8P" x5S 0K0  KKK⃞"p`:P0K C K# K! K K K0P ǟᎨ& R [00Pz++XP?0 b7w NPᷞPVA |D,  hK%l1 (0 30: ,0`00  0 6/FPP ފ6/10 0S p 00 0S0K823/K0 03P M K^O?YMh`rQc`If` Q5NQe`QYX c`^QQQ.Q9QJrUgQV VQL^x^a`Q(3G-`p000V P /X WP P!ASzX (LP,N"20PLP,A"X@T0S015S8P (@05 X$P o1q X$0P X0$0 1$X$oX$ZXW WZ!| d0 WR 0 X(D  000024T0 @ ! R1&t = Ca?C0S01h0 0 30 +ᕧQ0 S뿩 AЍ^QQQAQa^c`QQ^Ti`kQ[O?Y$! c`xHQ  p@-MP `@#0 0000 0000|000t000l00[;$ @DP 4Ѝp@@Ѝpt^Q{^y^h^U^u^5NQA-`P@ P pl 0,;W$  0OS0KS$ S? Q. QnT QC-,Md1p`A`0$00PVP0?ငP"VA V 0SZPxP 1S 00 0 0SeU ꎝUt0 $0 30 *,ЍCY\00S H  $0 $0 30,Ѝ ^0`D QrP^jNp@-@`PR맚1S 8_Pp@$pp@WSph` h`O-$M@ؤ510Sq `AP;Pf P*!r:Pj5P t10 PU2:814!0001D?pM5PP 0 0 0_P0 0 0 00 0T#wP$Ѝ @HP 8>1` c`PAQV Q$EG=P_ Q0`5NPG-Mԡ Pp`1`@⼀000GP 0S 4P6 189Pl|a0T0KP00 ˙ ,pW0P0pTpX40 0 30 )1P@,Ѝ1`^V0`x^ Q$EG=P QO-`-M@hPPx3000"p%0$0 f( $4ך  A<p0P0$0 P( $4P    *LP0S 4ǘ#0S 0,03/@P0S4T2x5S 0D"0 0<0806 Q 2"02> H I H 0!   (,0p   $ 0P04‘Q c` QV Q5N1 Q( Q0@-\M@P$0 0T0000x0x0t00p0hdžP $g40 T0 30 (v$g뭥\Ѝ0^?YOh`MĈNp@-P`@T N8y! ,]P Pp"= =H Q`h`O Q~ Q@-HM0@ 0D0000p0p0l00h0gvP g00 D0 30 C('}g^HЍ^?YOh`M߰OK-HMT3`@p0 0 0PE(P<TD@K 㖟D `P 08K@0 <0 P8 8 @` 8K<` P8/ 8K`"07 K`P P D 0@0 8K<0 P88<P0 f M`0 oT10P) &Rܙ P ^1(0&PDV)1!0|1|r<x`P0 D 8K@0 <0 qP 8DW<;D PK@0 <0 0 I0000.*KP  `㏅00p0 0 30 s'V 0l 0h0KPl0H 0D08K K^e` QRNpN Q Q0`VQ Q$EG Q=P5N Qx^e Qy QG-P`@ 7> `P p堀堐`0/S 9S@SFS`SxSfSx5S X ~4 l8;${Tc` Q Q?Y Q Qp@-P0r@RP dd1P R0p@1/ R  0S \pc` V0`O- Ml1`@0(0 0pLP׬M UP: sr6  @0 J 00 6 70 03/ᴬ  vK tP P PĿ DA;@ <H;0 (0 30 }& K^Pc`) Q. Qg Q=P-0A-P000p$@ `(0p 0&zVt kp;XPX ;0 p$0 0 30 C& ЍA Ѝ/^ Q=P QA-@`P]pP ?!0bI` ^I@0 P P :p9:pH^ Q Q Qp@-?<@<P0P P :P":PpH^DQ%QOQA-P`P qp@t` 05 7,P` :f`oQg Q=PA-ML1@P000G41`  莕 PP0  C    g$0X S 뼁aX0 0 30$ %! BR uUqP dF:0  BRuUpP Ѝ^Vx^xQA-@Ppx`PP \:eP p  UPAO0`f`QO-M 20 00`pPr |@PU%Q* I0@S/ PP;3![:09ׄ,0@  I@PP⿄0PP AP P P0Sl9h9`0S\ 0XX09$0 0 30 $Ѝ^e`QQQQYQJuJT=PQC-P0,Mp0$00`1@7  I. 0 00t4 `P <<0 $0 30 $, )9 .룡,Ѝ^sK5NQG-`@ P  P 9fO@pPPp6 @PU0 ܪ@\Xw6 @PU 0 ˪@e`Q5NQe`e`-Q:Q#Q5Np@- M1P000P0 NA`V@  I`0 3⹾ ^lP \8`L 3⠾0 0 30 # Ѝp^`e`LQnQ^QA-`@cP{pHP P 0dP S0 03 P n86`p 0SLPU <[8A^pe`T_Q5NQQIQO-P@ PJ Ё P0`00Z  0  ,  pk 0jp00 J;3013/P #R 013/P $R M X1P P $R 8G1  ЍOy Ѝpc`QQG-p`@PP( PLz0p0000,00 000T I2 T0E@o0 Gypc`QO-`,j@m[ p0PrqP 07TZP0 H2POP  0(0\ H2 P@ j7 c`Q=PQPQO-`,Pp@pU P !P 0H7 P 0 GN2PP m 0l(0d G>2i  MP 0 $ 7 c`Q=P QP%QO-@PЁPZ Pw`pZ00100,00 + 0*p00 K1013/P #R n013/P $R   ]hP P P .Q ٽP ,6$  6c`PPWQ=PG-Pbp@enP+ X^Pz0`0100,00 000` I1 4P 0 r6c`PQ=PO-`p@У PWMP# ,P  0 `1 ޏ pjP P0P  0 ЍOUB30P Co Ѝe`QA-(MP  1 0$00P= ,`@p  0 `$6pp$`/`0 `P E<0 $0 30 !P$$"/(Ѝ^e`QQ Q@QA-(MP @p00$00P2 {`@~4z 0  `` 6hP WEW! 80 $0 30 P$$5 (Ѝ^d`mQzQQQA-P`MP4p@7P 00 $P0`g`Q5N`O-p``@P P!0!S ! 04Q0  P 0ES0.S& 501QP"0!S 05*0 P 0ES0.S,4$01 Ѝc`Q&QRQ{QQO-4Ma@Xp10,00P0S SBn `4AnP {<0 $! /  ZP CP 0 ER0.S H4H  4∺Q0Sԝ<0 ,0 30 $n4ȝ4Ѝ c`^PQQQG- M,1@(`0006P{p7@P a44 u/ P0 ER 0.S YH h >4.룜NHD54$0 0 30 u ЍG^c`PQ'QSQA-pᨀP@`P0Wx 0,/W ;P P@0ᓻP 3A3pg`|Q5NQPO-$MP0L0Hp0PT@\P$ЍX`V  kP U\dP&SR>\<0X0\0`@[? 0 `0P!U@P JB0 DB0 ! 0 0P9P0  /J\PH0lS mS 3   0D0`0lS 0p0 0X-\`pdV X ?`0 ]3!gYQQQG-@pP$0Sx! t1Tp@Ҿ ``` V493 QCzP+3OV0KS ̿%0 p @`V᧺P߿PEV000C S@TP0T@S/PT/pL000C S Q!gYBQIQ QP5NoQC-$M$1@`p000TP 0S@@0䐟0@ P`0 0 30& 1CsoᨂX 2x 0 - )0 @` ~P VA$Ѝ^c`Q˺TO-l1M@P@`أ0 00R0p0T[@ 5S b205 PP. ;0  ۿ? ۾ ҿ ?Ҿd0 0 30  0 U  \G.7묖V00/ 0 40 30 ~<Ѝ^PQ`QA-`01`M@0\00P0p 0 ╻ ? ╺0  00@00Y@P0XSh ᷴ!0#@p0 \0 30 ? @0>T <@T 0@ -/`Ѝ^QQQO-TM7@p0L00`7 040 !(0, S,00@00XSMSN0C S """""""""<"<"wSF 7 L0 30 (000,000,0S0 S00*P*P00: ᰴPPl -YX L& ᢹP ,  , 0;S & ᏹP0% ቹP 00@=@0,0% {P % vP% qP 0040=#,#h% cP X040 Po D.-@% VP 0040Pb % IP0Y% CP 0S$ =P @<@0,@0$ 1P ,  X000$ !P ,  H00P$ P0"<$ P P@<@,婟  ; )000000X# P 00;,L0S ;,8 v<U"P TP   X"P 0DP $8 $0 <  0ݮ[0 <;, 0v, 呛) R ^U _ , 0@0'<@0,00;S$4@, ᫿8<0P,WS80    S < 0#00S ;S,0S ͸P @,;@0000 0xX",0 00@1 ᓸ뀔P$@k:D$,Pd ),0P0$,0YU+0 ,0S@ 0,0XdYXa3TЍ^ VQQKQ_QmQ;ObHiH|Qg`QQh`QkYQȭP]HQHQFH0RQQ2QXQaQVQ O- $M2@`0(0 04Pp@ჸP 0\+ 0RSp 6 00M Npp0 S.pWB1 (0 30q 0  00#K؜4   |~ 00W0Sp n+00ĭYpWP 0WS,!=(f+xSxP N(0 WK(00p p 00 40 囜8 P% 400  04 00 4 800Px 5P3:0xS 0 0 PP0TL 0<D0*+0 03/p K^QQ*Q=P}Q$EGMQp@-@Pp@=A-P@wD`TԹ@p 04# R  2/@`BTPc`A-@pP"0S 0S9S@@ 0C R ` 0RP00 R RS0`^@-O-,M@0P0 0d0إ0h0`0<30$00b0XSMSPP#3 0 p 0Pl0SP@P@UPE 并PE噱K0`XS`? Z@l0 @1S ៶PES@TH".Dg*/@O0Z0l0 @1S ᇶPE?0 T? T 0 @0@3 @D0 ့ 0~l0 Sl` ,00 ? q `0:XSJ 00 P 0o: RT  AR  00 P 0_:l0S T `F?V:00 @ 00ES 0/00 X0 $0 30 ' , Ό`F#2 9 @,Ѝ^QQ=PPp@- M@`P$圸P PM0l Pd` \ )XX00 D0 0@00# 00 00 Ѝp0c`T=PQJuJ0T@-$MT@X`pP@acD`PP$ЍH^#QO-,MP` 0H1d0$00X`p:@GP1 $0 309 0U P7 0 P/ 0P  B0   0  9 P PkP80 00 ,Ѝ^!gY0QO-TM`Px0pሀ$0|0匠(00吐,0$20L00끩@U$00S(0

0 0000@P1 0Q 0 RS@_& 0S TP@!P! *09 00'"  0 0P`@`h0 0 30 $Ѝ <0 0 30 \ X0HE$ЍO^Q$EG=PQO-M`@@0P 0ؤPTXpB<68 0Sl>P 0TpHS0LP0 0 @0 0ЍO@` 0ЍOa 0SV 5 T00PpHLЍONl5 `T00PpHLЍO 0S VC 5 T00PpHL0S 0 S0 HpL0 0@DЍOtS##########,#T#|####<#######D#l#?Y0:0$0S&U 4 $04&4 T00PpHL3 T00PpHL3 T00PpHL{3 T00PpHLqU L30H#0D3d3 `T00PpHL_0$0S437"02 3 T00PpHLKU 2="022 T00PpHL9U l2Ch"0d22 T00PpHL'2 |T00PpHL`2 \T00PpHL@2 <T00PpHL 2 T00PpHL2 T00PpHLU1oX!0T1QV1p8!041I0q0 0R00iP0S  0@PU ( #0KPS41 00&00PU 1x 0t0@ P 0uỲ!PЍ0`f`vN f`d`"QQQ$EG.Q=P@d`iZKPd`DOpd`'Xd`Qd`QQd`Qd`؃Nd`Qf`DUd` QPg`oPg`=3Q`d`[O@QNQ^QQ@-R@ \;0S HQ@280P @rQQQQ QT^`^p@-P@V`fPpN˾ 0 +&@eP 000TS dm%᧳pQ ΍덎0@ S , 9롎ꁒ랎 e`w`W Q` Q QC-M1P`000@⾖p ቾ VV1 ᳴`P1!0  14%0S   P 0030 a0S 0 0 30Ѝ0 0ЍC/`XV &"0S  P0 03/`^ Q$EG=P QO- M 1Pp0(0 0㢾@N `00M @"XG0 0 4  V@ሱPh$ P  0 03/0 (0 30  K^ QC-MT1@p000P`Oͽ CVW! `P0) 00x$ P0S 0 0 30 ЍCrpmᬦW@0 0 30Ѝ '"0Sp^ Q$EG=P!QA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0V A-P0M@`0p000/ P`)  jhXe 0 0 30 /Ѝ^C-TM= 0L00t= pl lMtxh d px`-0@0< T-00H L-40D D-80 $08=R(0  (P000 <0$ { z  ,W00< 0 00$00\0|@㼌<`E,0@  p< ,d `|< x,0t tQD^`">QD"10P]`?Y>S GGh`hC_ C_M!Q,"C_`"{"Q!QC_["#Q"Q$!#Q!#Q$QL^B$Ql$Q$Q!w$Q$Q$Q%QHQY%QD%Q%Q%Q+&Q!q&Q&Q$#&Q'Q (Q!0)QH)Q)Q#!)Q)Q *QE*Q!|*Q*Q*Q+Q!`+Qz+Q+Q+Q3,Q!,Qv,Q c`,Q0T0c`,QP,Q,Q0e`,Q-Q@e`-Q-QPe`/-Q?-Q`e`MN-Qpe``-Q#Qe`x-QQe`-Q:Qe`-Q-Q@c`-QSPc`-QT`c`-Q-Qpc`-Q-Qc`-Q .Qc`.Q .Qc`#.Q5.Qc`8.QH.Q@d`X.Qi.Q`d`=O~.QPd`.Q.Qpd`.Q.Qd`Q.Qd`Q.Qd`؃N/Qd`/Q//Qf`B/QW/Q f`Qk/Qd`/Q/Qd`/Q/Qe`/Q/Qd`0Q@Uf`0O4Gf`0Q(0Qe`30QA0Qe`OW Q e`P0Q]0Qc`i0Qu0Qc`0Q0Qc`0Q0Qc`0Q0Qd`0Q0Qd`0Q0Q d`1Q1Q0d` 1Qe`oO(1Qe`-1QQe`Y31Qf`91QLQ0f`H1Q`1Q@f`w1Q1QPf`1Q1Q`f`ĞR1Qpf`1Qf`1Q1Qf`1Q2Qf` 2Q12Qf`@2QR2Qd`i2Q|2Qf`N2Qf`&O2Qg`2Q2Qg`2Q2Q2Q2Q3Q3Q3Q+3Q83QI3Q[3Qp3Q3Q3Q3Q3Q3Q3Q3Q3Q4Q 4Q34QH Q:4QH4QV4Ql4Qy4Q4Q$EG=P4QH!P(!4Q05Qh`Y5Qc`5Q5Q "Q6Q"Q-6Q"IQ8![OL!C6Qg6QxC_!6QT"6Q7QtC_8Qt^!=8QF8Q!9Q69Q!J9Qb9Q9Q9Q^!&:Qv:Q:Qx!:Q:Q";QT;QH^/>Q//>Q//ካ0@-@05=Q@-@6P0@-S 0{ 00T Ѝ5=Q$EG=PQ@-@P @-@h00 00  00 00Z 0 0 30 Ѝ^p@-P@T P AP Aህp@-@P 003/@-@G=00P/mA-pQ0P!CAWB00P*sW@!@1@*T` T@!K)`0 Q P A@```@0\G-LQA$ R @-@P AO-Ѐ@IAtvsPAT0!03@p&*T` 2T@!)`0U ӣ IPPY έ PX A`aP`BOG@-@XO-pЀIq5sQ0G@!@3`@)*TP "T@!0(0P 0W  B  S0CXp AऄQP ЍB0 0 OGp@-@QP ar(pA-`@APDApWPpG⦮RA-P `@R  @H@T ppX@O-@IDAtrAT0!03@`#*TP 2T@!=(P0 0000X  B  S0CW A' QPB000OGp@-@PU Mp@-@@$ p@-@`VP ApLPG-`쁟p PJEQEQU @! 0JS> S6 LSiPd ZLPMPU L0U PE @EQULpCL@ЍPL@P@P@PPE PL@PL@P   ▣$$ⓣ<0@@L@0LPZ@0PEႣd004@0 @k(A-@pPTL`  e$$Pa<0L@0 0  00000BO-p0@GDA0TqAT ! 3P@` *T T@!L0' Ῥ L X` AL0㓔)`@k(k(OGQA-P0@0` qP qp005Vpq& Pᛢ0S{` 0 bP 0P10!0 0@-@0(AQ@-@ɂa@-@P0q000 ẅ́ 0 0 30 Ѝ^p@-P@e ¨ops@-@P `VPP PP V+Ѝp"V'V<0PSd dPP0L R 0S,HIQVFPaII3T@!#` PY  UX A@b`>CP  POG0$0/0- , 0/ 0 R@-@T @ ~P ,ܟo/QQQQ@-lP 0 Q 0/0 0C0//G-M0!0  Ѝ@-:@|P@p@-@`0S`00 Pႝ `'p 0 RP(@o//0G-M000 0 R&0S#pP` 0 V|0 0 30  X@P0  y 0 0 0P p`Ѝ^RQO-MP@0LT20|00a)[0pk0P2"0156`N)00`0`40)Gp XP0 l1 |0 30T MA`a9 0 06# p 0`o 0P( V U ` 00VU[U  0 006#TGP0  H 90 `0L0 bЍ^RQ$EGvRQRQXE_RQQ@RD_.WcKRQ}MsLO7@-@P 0P m Ѝ0JIWRs@-P 1!01( 0 R R@` P P (@P @P @86P !000 S,K`d8s P Ѝp@) SQ$EGvRQRQMߘLp@-@g( 00Sa(P? p@1p@A-p(`R( 00SIP@P  60 0(0A@ 0S  H 0F7`-(P 0W  /  T G 0 |0cP 0T P 0 0 <4P p07ЍSQGSQSQSQSQPTQO-tM@`0Pᘠp0@$:圐堰0l00V 0P 0 S9 l0 30   0P  B RKj#hc#4d#4d#xi#,k#tb#,k#,k#Lb#t9 l0 30tЍO[ D9 l0 30tЍ0 *W  `p~ 00Vw 00 00 S xm 0 `PZV a 0 0 000` 0yLO 0  00Fj0S 0S P 8P 80PTP<0! ($ 0(z0P -@R0`70S0 0( 0pl([P[PZ (P 0S0(0W (0 00SPuPUD [G 0DHp6 PR,P0P4P(0PP 0 R60,P0p W G(0H!/o b @XE@( X91 PS`F$` 0W;0Q (J0 Y(0 00Sttll5pP0S (0 0000040QP0P ,`>PPP(1( y 0 0X(0P 0CP 4$04Q,z0S (0 0000 \4H$0DD4=0 (0 [>00S (0P 000`  P0S8 (08P 000`06g0P hh`(0  00 00000$0 [ 0 D(0 00R>2Z[ 0  ,b6P 0P h 0傞@`LH 0 X1 l0 30 0 8#pV 0 ÞP0:S00:S0p 8M 806Pg0P0  00hp`V 0 l0 30 ,o0 l0 30 0 tЍO"l0 l0 300ᘠ tЍOA[ [w  0 RFsTQ^LcK!gY}MTQ@RmJTQTQS$MI.WIITQ?JJUQ$EGvRQTQnUQD_RQJ0S}QUQ@JsLOUQA- M`@p@h0P000R 00 <0p08010 0 30 > Ѝ^O-tM3@0l00㘠% `P< 0rPP6 % 0b$0"<`$DPf P<N"0`<D0$\ <D$ 0p@3`P3< 02 l0 30~ <+ yPPp 0p R  0 R 0S P0P0p <0[p00 W0S <z0Sq QP(Ud R" ^f0S  0$0 0 $ EJ P40 0<0pU,9tЍ^QQUQWJI!JQ}QcK.W[O}MsLO6MD_TLOC-\M`3px@0T00$$0C0$0S)0$0&$ 0P  B RVp#r#s#r#r#r#r#q#r#r#r#r# r#p 0 RDP@  P: 0Z2p`m,0S  0Y 0 L01 T0 30[     P T7PD7 @1 0 0 P0h 0P1  0    A 8/ aP  00S  rsps0 jP0  \Ѝ^}Q TJLZQUQSC-$M`pD "T  U< a#1YPt&!T00 U Vp*1 0 30 dU@#0Sl!9#6#7PHD,#@ 0S  ` 00  = 0;0 "!pcPl0P 0 @mX !P!@0 0 30  0# 0| NY .uu 0 08 v<$Ѝ^'LWQWQHXQO-@S,M`L!pP $ / `0PP 0 0:/T 0аp00S T")0 $0 30"  00:/T  0 @  0 p 0t,Ѝ^'L@-$M0`<8p000.@PC VPD k A0S_p@p0 0 30 oN ? 00P40 0 30$Ѝ@){t$Ѝ^yXQO-tMP`2p☀0l00 CA+ 0@04/@ 0 00S   00CSNP  nQ  <<wT⨒TB$⢒T⹑<ⷑ7s$00` 0Z$H $C 0 R$$ 0 0 00S ` 0CCV:U 0? 000 nA ^L####X##d####̔#\Q  Ѝ@P  {R  |, 0}Q0d0Ѝ     ]Q$EG\Q\Q]Q5]QT]Qr]Q7@-@,0 bR0P0P 0'S 0Q 00000\S  x0, 'Q HD  U800<0,0@ Ѝ0]Q$EG\Q]Q]QGGC-M,@<20000`bV0p0p 0P0 "R 1!01d䑟00܁,U 01"S  S&H#\!R 0S C` ( \ (  00 CB\ 1 bV 1 0 30> k03) "S  \SbV  0Rᄈ 0   @0000  dS 03p 0Rg 0   , 000Ѝ^&^Q$EG\Q^QI!J?^QX^Q{^QO-,PM rZ0#SB@P  `<Pp 1!01@pp 0A0C_XS$X$Z00 0 H RGT8 00 D10 0o P 0 ɒP 1 0P3`Ѝ@ T ᷒P  ᱒P Q Q00 \ 0A Q``\` R Rp S$Z 0 XQ ^Q$EG\Q^QiQKOO-p,`p 0d0  @  nP 00@ @d `V00iQiQO-M3P, 0|0000<0X8;@P L3rH#0D3Dd @0r lphw `pS3"02Tx`p\pw `p갲`ꤲ`, 0P.S/ O.RpP @`HH@0 00[00w2!01p,0q$D0@  B$ $⟊ , p(,0$0,, X0 Q@Z00$9 00S 0xS0  oS0  bS0  0 @ N_Q $`P0`3`"V ,vp8L<@@p$W Up0 |0 30 (H0Xp PA`08 0800X$= ;lЍ^(i`_Q$EG^Q\Q_Qt[i Ѝ0^0@-P0$M@(000 000040)S !0 00 0tt) ~t*i 0 0 30 $Ѝ0^@-\M2`0T00?F 0R 0P,p  ( 0CCU :!0CS. * <n U0 R 0  p<R!@0CP< P`0<00\0) 0   P0S8  8 ( 00 CBP   @PlH sD0 T0 30 <+sh\Ѝ^daQO-M4P`4@ U0|00  1U 1U p1U  4 1R L "84 |0 30 I p 40S 4 1R p 40 S  ` \ 40!ST< 04  X  R lT0S4⣅04<04 04 480 ^4⨅⦅h` L\P 8004 R < S LT Q T S4 L6L4 ddpd⁅L4}K !S @ 40<SS 0S R:  RUZ Q1U[ C_EPEU]0 TJ40>S !S>|QQtX0d' dⴉd-!0CCX:ىr 40<SSS <1U  % 1p0Sl 0hh0LHGdrDЍ^OcQaQ^EGaQaQNIV6M`QaQT\QaQ1@- M00040*S. &S" (S2 X[S P 0T00@0S T 0@g =-0 =V`8`<`@``00@0 ` 0` 8@@<@@4|X *@X#$X`C%0HS##ؿ#ؿ#ؿ###ؿ##ؿ##ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ##H##ؿ##^X$B?HSS8#P#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#ؿ#,# ####### `p ```````ໟ<@ Q800DS0D DTP00D HDL0 <{ 0^R S%BQ1d;x`+0H H;_kh`d``]Z`VSdpOpJ<@ 00`D 00D04`0:40Dd 4I{0G{>DD{0B{8>{c 0P 4P0$00 (0l0004000409070({4&{(${$"{P 0P 4P0$00 (0O0004000409 0P 4P0$00 (0<000400040D9 0P 4P0$00 (0)0004000408 0P 4P0$00 (00004000408 0P 4P0$00 (0000400040l8 0P 4P0$00 (0000400040$8 0P 4P0$00 (00004000407op 0P 4P0$00 (00004000407\] 0P 4P0$00 (0000400040L7IJ 0P 4P0$00 (0000400040767 0P 4P0$00 (00004000406#$ 0P 4P0$00 (0~000400040t6 0P 4P0$00 (0k000400040,6 0P 4P0$00 (0X0004000405 0P 4P0$00 (0E0004000405 0P 4P0$00 (02000400040,4y, ,y(y$yPy9 0P 4P0$00 (00004000404 0P 4P0$00 (0000400040400=RP 4P0$00 (0 000400040440,4y, ,y(y$y, k00 04000403_3 00 0 0 04 $0(000,0400040d304my, ,hy(fy$dy z0`y4^y(\y$Zy 4Q#h#####8####T###############|###|R BBQQ񟗦###############L#L##0####vD  D@0T0 D0@00 `pDD0<@D8 DK"~rNDR>0!030* S1 D `p D   0Z@ 0 C`080 2<@@080@DT 0d 0``0 8  Vx 0 T0 30 ) \Ѝ^bQ$EG\QbQhGbQTpHȐIHIȑIPlH\ HȉIHIȒIIIIȊIIiG hG`jG\LLlHLHpHnHoHOGbQp@- M1`P0000040E?CS@ E@{x40ES@ !S 0000nx0 0 306 P $R!$0 S@000 0 00 @00000l00FxDx Bx@x=x;x9x 7x5x3x` Ѝp^gQ<0@-@000 0 0 30 Ѝ^0@-@X1MP(00040)S$,9@= !0@ 00 0 303 g _40)S00 0 00,Q 40)S Cw4)Q<wx wU`Ѝ0^LnHcQcQC-@`3DMP[0<004 1R00 40;S8 0 0000$ 0$00000000200ww w~w|w]y$vw0tw rwpwnw lwjw_,Sr0  0 004,S bC00 &0Pw40]SpY$ 000`G40v80L`0n``V n 008 W0 004p80 mw 0 ppGk$GqkpGP0`$0kp00$0`0NwwGw Ew~$Bw@w >w]Su \ v00 <0 30 W0vuDЍ^hQ@cQ FGILTcQO-@43LMPp{0D00 00S YPbPܢ40}SES   ESxm!S ` ,\4 0 0}R,R00ER0S ,  v`0V , 000 000040,S9 {v,|:u   0F0)0F,    `,1AA 0 咓#`0,  S 8v}5 0 00 0P 0 V %v #v`0 D0 30  v,1|^ v vLЍ^ncQOGcQm۶0@-@0MP0 00(]0000$00`00u)uul^ 0 0 30 CЍ0^oHp@-@1M[P`000 *]0 000 0 000000|00uuu uP0 0 30  uuuu u^Ѝp^gQ7@-P0@(000m00004)Qd R ,Q h P 5 _u \uu] 0 0 30  Ѝ0^cQp@-@00MP0,00`0`0i0` 0im0 @0i0 @00`0pu%ulu !uhuL0 ,0 30  _uu[u uWu]0Ѝp^DGȌIC-dM1`p0\00u 0C!SJVCQ000 "@ U0< 0CCU:000  PEC (1@(1X001PX@@(z3 t/tH0 \0 30 $ t t,]dЍ^$I FGRQ@-M01@0|00G:P4@@ 0 B80P <0 B l0p0 0d qt  ktpitjw0 |0 30 Q ] 0S p o0S a] OtpMtNw\a]Ѝ^7@-@0P&000(4 1R   )t,0 0 30  t\ Ѝ0^/</P/I/:/U/0p@-P(0`@3/ @ ? p@zA-@pPW 0)[`P0 0ЍA/ 0p07/p 0`06/0p DЍ`dQpLA-`pP@8/ 0`06/0 'Ѝ@-@P`p7/:0  ЍA-@P`p8/ 0ЍG-P@ `Tp :/@P 0 P05/ 0@ IЍA-`pP@8/ 0`06/U0 &Ѝ@-@S Ѝ@0P`p7/;0  Ѝp@-@PPpp@0p@-P(0`@3/ @   p@@-@440S 0@-0 08cQ$EGcQ\Q40S @-"dQ0@-@0rrgQ@-@"Z@-@rx0@-@0rhQ@-@  Z@-@P AZA-@p`0P0000Hz05c9=?0U0HHx8[ %}?}G0@-@0崞gQ@-@ Y0@-@0thQ@-@ Yp@-@`V0$0CC1GpPm۶p@-@`VP AYp PZr0@-@0gPgQ@-@Y0@-@0d0fQ@-@vY0@-@0fI@-@fYp0@-@0000000V00800,0 0 30  rZЍ^PgQ0@-$Mt0P000L7@FD0@0x,0 0 30 _x|Z$Ѝ0^8L0 @-@ 7f 00  0  0 /p@-`MP|0@00@000T0`04q40 0 30 )q5ZЍp^hZQ(\QO-@IDAt4GAT0!03@`#*TP 2T@!P0 0000X  B  S0CW AX QPB000OG 0CHC1@LP*@-FQ10* S1 !/ /m۶$IO-PM0p 0 000 `G0`@ q0  000 0`x 0CC10H#P0H0 0 30 _ZT$W^tZYЍ^OGm۶O-PM0p 0 000 `G0`@ )0  000q m0`x 0CC10H#P0H0 0 30 8ZT^,ZMYЍ^OGm۶0Ub0@-;g@,M C@-YkQwkQ@-@-K@@-GM1@P`010 P `pew aw0F/1!!! F? 020围 00 0P 0S $0 1 30 Gߍ^1C-dM0\000s, `q@` 0T0SP Q0Dp ?o 2 0 P 00 3/OP 00p0S P0 \0 30#  @OR0/ 00?` PX0@SPacaP\aXdЍ^[OkQ$EGkQkQA-@`QPp`0S CUPEp U 3/P P 0L03/Pd0S @!00 w`p@-`P@Tpֳ 0 P03/0P@DPC0S p/0S0 0 /////////@-,Md1@0$00VP `z,Pu u,V   PP ,0u/s =a ,P0 $0 30+ VP   0` VP h z` 0`  PIus a , @uW,Ѝ^#%lQlQ4#;lQp@-P@T 0@D @0@p2/@Pt00 0s@ 8#p@-@:4 02/PUpp@iP@-@ 00@0S 0L03/Pw0S  000: , 0@-Q,1,M@Z0$00# 0,0P ` 1Pu  00 0  t0 $0 30,Ѝ0P w` t,p p )p 40 $0 30 ,Ѝ0@ tW^TlQjlQ,#wlQp@-@P00k00p0@-M0P0 00f@pd @`+վ+Ѿ0000 0 0 30 Ѝ0^lQlQlQ/d0@-@000+00 PǤ0S 0 0 30 Ѝ^`0@-@000 P 0S 0 0 30 pЍ^7@-@0P000U00  pD! ׵p n00Zk000 0 30 B Ѝ0^0@-,M1 0$000P1 $0 30d )0 P?=깜p@642 +$pP' % PPT'p PLp 00 0K㐜L9 2  p m 0@00 0.,Ѝ0^O%mQ mQ0 @-P (mQ@-@p00p@-fMX1P@010D10S 3/P ţ001 1 30= 0 01Rn00R 0U ` # shf? 12 1} E }`E? t0PS000`0 ]fߍp^w`^@  0 0M 9mQO-|MP2p0t00$0$ D C@  `0S\ 0D$ G`P ^Pᬼd0  `@00\rDr(2 t0 30  000`0 PU 0SQ U YL GC@P0 0! P o[ o000PoSs[  P  0 0 0P.0S+ ܢ00PU 00!  Q00 0 \}`W\.rD,rT@|Ѝ^mQmQ^p@-0M0@P0,00~0  `00@兲0  00@卲0 $00`0A0 @@0 |$0t0`0l0A0 @`0γ0 ,0 30 ;0Ѝp^poQHi`hC_mQO C_"nQnQEnQ^wnQgnQoQ:oQ^05 0 @-@p:00@-|M0P`0t00xkP k'0 t0 30 @pq@pk y n `P`@@|Ѝ^oQ pQ ᢼdpQA-@\pP` L嘼 D0@⓼8ᐼ ጼVA膼^MpQpQpQ[Op@-<@PPp@-@@@-@P00@- @# 婿ֿ @-)@-U0@-DM0@ 0<00P \P囡 ] 00  0 0R011>001P \@8 A0 <0 30 @DЍ0^pQPi`pQ0@-DM0@ 0<001s B!QPUU00 R  B!|2   P ~  ~0 <0 30 DЍ0^rQ_qQpQ3qQ0@-DM0P@0<00 mPT @DT0@00@0 0S0 <0 30 DЍ0^0@-DM0P@0<00 FPTd 0 <*00080 <0 30 $ 0 wDЍ0^rQqQqQp@-P<7@P @gp@-BM0@01000S  `P@ P ,0 1 30 l G RBߍ^h`-4M00,00lp0 l$0d00`000 0T00P00L00H00 ,0 30 B4Ѝ^TsQ C_qQhC_ $qQ0rQirQPi`,0, 0S 00C?o 200/^vQTi`40A-`W@ @hqPTi`p@-@QP@Px@P 8 @ 0000*0`00 040 0$SP 3/@ptOrQTi`A-`xp@0S P \ڵPTQT1 R  t' Tt+ t $  1Rt   0Rt  TT @DT"` $P $h $H $X $4TA衸ޟ8 A蟵\T| lp0Plt `\XTPLTi`sQ^vQsQvQsHTsQsQsQcIQQ5UIOIOIOIOIOO :sQp@-`P8 ` 0000000@3/P @kfpU iPt`: P$ 0@S PD PP彲003/PVQTi`Hp@-P0@Qp$c00p@Ti` tQ$0 P/0S/:$Ti`0@-tM0P0l000|S@P0T l0 30 :oPt  eP0: SP L@tЍ0@r l0 30tЍ0^VOAWrQcP/000/  R /e 0D0/ 00/ 00/40@-@P 0$w 0@ 0/Ti` 0$0/ 0(0/ 0,0/ 000/ 040/ 080/ 0<0/ 0@0/ 0HP/ 0HP/:4P/-400 ?o/o2"R4 0QH0/A-pP@Q `00P 003/00j40S W 003/ P _e000S$00 S *$0S$0$0AqTi` tQ (/0 0( 0/Ti` 0A-`0Pp3/@P 0 r0席P Y@ Y0 r ~YzY壭Ti`mJSG-PȀ@`0SpP pᔐ唠X^Y凭 0 0G/ 0w WxKY гGY0 wAY ƳTi`mJS-@-$Ml00 ,@000 `m00 0 30 WmO$Ѝ@ Ѝ/^0@-M0P0 00w@P ͝&00T0 0 30 p soЍ0^VC-4MQ@1 q⨁0,000!p@a匭! 0| 薭x1 t$0l10d1P0\1 @00L1 H$0@1``0410A(1 @壭 1 $010 1p0 0E@ @0 $000p0@@ @`六0 l$00@00 @000000E 0 ,0 30 4Ѝxi`^hC_ C_tQlQ^JtQ $flO{tQtQtQ$"uQ)uQLuQ wQ|uQnuQuQuQ2vQ$vQbvQwQxC_tC_vQvQvQ00@- Q  ЍTi`@-@P AMO-Ѐ@IDAt;PAT0!03@p%*T` 2T@!`0U0 Yl IPPY Tv PX AnM`aP`BOGA-`Tp@PUV8GTh`P/Pi`1wQA-@Tp`PUV8,Th`PPi`1wQ0s@-PQ00000 @r`P k00 [l0 0$0 0 30 ? ";Ѝp^^EG7@-@Pr0 n Ѝ0@-P 0 00 ЍJ$EGJJO-P-5Mu$000@`VTU~Wbt5 0 30U U@`PhW ,KbW`ll0 \lkVW@TtlkMlml0 0T0ylukTsk?W@T]lZl0 0T0flbkT`k,W@TTJPlGl0 0T0SlOkTMkW@T7 l4l0 0T0@lfX X3 t0 30 Q@PUI@@'?P 003/P 0    003/P   S RXP` 003/PP$ 0P`P`0S  X3P0S H0SP0 0S؁HQ  `P P  0|!@4H  0 p0PtXPmQ?@PH&V@0S  pQP-@00000 0 0$0S  Q   [?0Q[@$/@Q @PHQ%@0S  (@|Ѝa`^Q$EG9QgQԆQ&_C-$M41000(1PPU/ CC.`f@@pp`PUhWP 0Sl0 0 30 GP@T 0 P 00P$Ѝ^a`O-M?(000r@0LL0P lC;00S (0@ 0 8000oP080t 0 Q <  R(1`0`F`v04 P0娐0P,0p` 0 D⏪ 00+P% 0p0D\0S5diqPgqL>@^0S  0妜0$0 偢0 `V hPd0PE"uq y+D  *UH0dh0L0l00L0H0D00D⵸P6qp0S Sd0PT 0P0 Bh00CR 0&40P PQ%0CS0j dqPqP P 茟(    0 0  Pw뜌 0  90P i`gp0 000Qc 0|c`PP  p0s+ @PP0T@7P8 1`P  D0 P 瀒Q8 0  v+D0S ›გ\+  c+ 0 pP \+0P00X W 00pP`T00CW*0 b ^YPs  >+00 Pe+  .+0 PX+ ;YPP 2 *SS%0t 0 S02 0 S0 00t000000YP% X9x0 C0P$0 0 <,0*, $0R(0   +P XPp{ 0 pP *0P00X W 00`Pp8 T00C3S~x'XPs   *!0 P *  *0 P *8 XPP 2'SS%0t80 S080 S08 x00t% ' ) 3 5 7 zXP% 7 0vB0P0v 0  < $0O*$ 0R(0   u*P8 TXPX8`{dko100Wd0h0l0 (PWdlP Uhd00 00d07`VdP3 U1 0  00PdX<d pBP 0( 0 ,(00 4` BP (00<8@0D啀5 0 30  0ЍOd0P. 00S*APP& (d P  0Pp  CT0Pdph0X0l00X0T0P00p0\p0S dp080D 0 dPH8DPP 8P0D0D80S 8∅MPUP 8gp8ATP0 P000lP+S?P$P @ 0` 5P8P0T S :2F"02B8dCP *P :0S P0T SkP2PLLP8 ZPPTP00%(! c P P 0(0T (0 , 04 8#AP P 0(0T 80 < @D q嬁 RPp  8 0P Pp0 P0 T008Od n0 0 30Ѝ8A0耟 pQp0S 50 PvPPT`U !0 Ỗ!d00  !0> ᩖ6a`^w`Q FG^J.HRtdUyJ,QVQ$EG9Q4Q0`Q@3$mQQ|0SQ 0 PvPPT`U !0 ~!d00  P` d0!!0` P`p0 000_`P 0\mPD QS;p; 0_LA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0@A-P0M@`0p000P`⃺TRB:O 0 0 30 Ѝ^@-0M10,00}|1! !A ! |! x! t! p! l!$ h!( d!0 `!4 \!8 X!< 0P! 0 H!0( @!0$ 8!0 0,1R 0  P 00  0 S  /   0$00H0 ,0 30 0S 4۴ܱ90Ѝ^3$i`7$,3$T^`/$9$V$DU$L$8$$|7$pN$:$P$9$10P]`Q>S GG@-@Q/X@R8@-@P @K8@-@P ///p@-P0 @5P /PppUwHP0P L  H D  @  <  8  4 0 Q0/8j`m$l$k$k$l$k$k$$xj`@-@0S 00', 0((0C<Ѝ@7UQ$EGBN C 0+ (0L S 00S$ ^ 5$5BY 9B0 Z0*$2c "02=1pLР00 0 ($$,4P0*1k!01 0R gQV!0C  1 gP` 0BRʡ @1$!0$1fX80 A pA^  Q: A$r2 p 00 S,$ (4*|0x 0xp0 Q *[[X0p(&,Ѝ^Q?Q$EGQTT CB> Y0Spp@/p@-@JzHP03/Tpp@JG-(M1@_0$005z3`p 03/0Sa p 4 ,Z P:|W5X4S Z0000  b4B~ C  0 000:ؠ :4 Y0$03/0 0 0 00 TP    HP@ǫ,0 $0 30 G@(Ѝ^QyJa`G-MTt1U000=@ P! p.H1傯⠐T$PU4Sk` 16P $4RP d0 0 30* P 0 rB> =P`=Q 55PT>0 ?55Ѝ^a`ŋQA-VyT`SPpP00@T 0A/ 0 Ja`4^`@-@ۛO- TM`0 P50(0 0-y+h 004p`^CP 9P`%Y0 R s/Q T0K\0 0RX0 T0K* R  <0KD0 DK BDK\KDK(R\`4 W Y M@W0D/ R 0/S\S VL`\RS 0:SV/S S3P0 $lB P X0\KQ 3 (0 30 3 V0 /- W- R* :Q', K0"+0K/P0 d 0, KS$ 0P-d0 E$ 0Sd0  W d0#\R/R R  :R W @/R\R W@ /R\R ` // !P P0 /R/R/R 0` / \!Y P 0 0` / h $pW  7/0/o"/ @P0 0` / V@P0 t0X SKᥡH\K-Q3X@ 0>0/SV @, @  K^(9`=M5YI*)S!gYtj` XQK-M0Pp`0 0 0wiP W0S .R@CW@  M PZV0C.R 0 | 0 0 30 /K^@-@$1 `0 00PUO0SP. ᕔ ,P 0@ D z 3w|H$`Pl6/0P`c 0@00a 0 0 30 Ѝp^ Q,QK-M1`@P0 0 00,0 Tp@> l100SB \0 P \S/S S9 0:S60 (K/S(( ,KJ(K#,0S W-W M pUoQ0 $K$,K$ /$K,000,0 ,Kd0 0 30 ,KPJ,KU00,K2K^(9`=M@HG-HMP1@0D00013/P@P7  0  13/pPU@P% a 8/P( v00 P pSZ P P0  C  ZpP0 @@P+80 D0 30 P 62HЍ^O-M0Pp0000@` 013/P  g0 13/PY  7/P 0` @0@80 0 30 ۴P1Ѝ^O-,M\3@X0$00HvF0p3/{P $#$3PP 0R |0S 0 0S03/|(0S 3/PPU P  cHL0P D> 2P0`0@V H00H0 O004S 0P@7<@0QP< 8!PPT`@ P(D,ЍO@1 $0 30' ,ЍOQ P12@: `&2`ؐ0@PTU! P`p帐PUV|0 $0 30  2 NQ1s: 9110 $0 30,Ѝ^a`0` VQQQ4^`̍Q$^`O-P `[P V h`AV 40040 P 84,(U p@XW :UVPPP%@t@TٔW' ЍO/V0SP $R V U R  ᾔ@ P L@Pp@ ЍQa`2CH$QKQw`jQ@-t40S 3/u(0 @^O- <2M`0 00y[P 儔reV@ TtPPi1 X1 0 30c =YzPUPU00S 4SiUb ☦@11PY *10P巖UP @000qP Q 0P[9 !00& \0 03/ЍO.^$Qa`̍Q^A-Pက`|p@ TP` 000000H@ 0S08Z0W0 0 AC(9`Q5YItj`Q̎Qp@-@Pu; p@O-`4-\M0T00tp 9@V P B됔GPPPEPU X <I<0  2S VPP< M $/<My/ <'<0 0 $0<L$L $ <<0 0 $0<L$L\ $P <<0 0 $0<L$L $  <<0 0$0<L$LPU |2XyVl T0 30l 2S Vクh"* gPP(4C,$0 B>  ހ K  ؀ᗀᔀ,003/4P 4S!!0 00 0l혀S tPD 00 0 0@!텀4 #  0 |ፂ T0 30\ЍOY T0 30 <)L$&LSg T0 30l\Ѝ^2CHa`Qi(XPVQ&OVQQQhMQ&Q7VS G^`x$u$ C_hC_Q$CQQ$QQ~$AQ t$QQ`QQQ^P$ّQQzQQ(9`Qs$̒Q$ޒQ-QxQ|j`qp@-D0@QQ000 Jp FGG-M0Pp`0|00 0܀ 00 00p̠Y0 |0 30 X 0L 00x 0p0 0`SLc,03/L$@zЍ^aIIV?I GP]`?I?IO-Ѐ@IDAtUPAT0!03@p%*T` 2T@!`0U0 I IPPY S PX A*`aP`BOG@-@P A*0p@-@PQU  R I0 0 000p P P 00 @-\  @\@ 00 00/O-p4M`P 000@ P9 @%P1 p00000K gP! 00S  R$030 R 0S Rڠ0 $$(,  rN(p, X: $000 @H40"t80,|@0*,G,)0@T X0@4 ( LN0 $`T 0Y  H00048$0(,弧 ,00@0 000p  X  R +,)/+$⛧H P+0S H0 0 H 0 0$  ( $0 , (0$ \!,0@00 7g 5P! 0 0000F0S  07瓇g 0!(R 1@00000$D Pd0 0 30  @ R ( <,bA jЍ^a`Q FG^EGiO-Mh3@ds000  C0 HHbZ 80 0004080H09 0 0PP0 .  P2"02 `F V 00H|  `2 NK|HE|G$2 0 30 'H05HG20S" ~30 03/P P|00 ` C0 C x0R1 S9 `|`90S |0|1|/0, P& |0000P`0ES 00UPEER$0@|P0GS | `|00|| ^0pPEH`UPQ**|0WGUG)|Ѝ^ZQ$EGAQQ0^@-,M0@`0$00P p ^ 0P@P  0P `0\ 0XX09 G)@00 G 0 $0 30 g,Ѝ^Q$EGAQQO-PR$M1@H@000R@U@T4`P/ p`K  TLXppU@@w 0S p 0 0CN >FL0 0 30 "`@U00p0S@$Ѝ^@-@FFp@-B@P=p00P/'A-@P `U  !]GPP`VP A'p|F,P'0PO-Ѐ@IAtPAT0!03@p&*T` 2T@!`0U UF IPPY PP PX Aj'`aP`BOGG-0`P@Pp(0X P @P(02l U p@-P( @).0 00apiO-P 0JC2j#BSAS@!@3@p*T` T@!0` P9Y0 UX A'00@d&`@$0P  00PꫪOGp@-@PU ⸤E,&pQA-P0@0` qP q(00,((q PdF0S`( 0 bP 0P10!0 0 /Q .R P/ /R0@-@JLP0@ /R  P/<x @-@0S00 S  R   Ѝ@00m 00Yj`(oX$EG9QQ ULQ QnQs@-`/oV0" 000R x`0F@0SP E00 |E0 00 0 30 `Ѝp^^EGp@-P<`@P 00@0 pj`D17@-00041@T 1 0 30 6 Ѝ0@q Pm0Q gQ b P 0 C0Q R63M0QGtD0l l0Qh<0 0 30 Ѝ0^a`QٕQQQj`!gYQ Q5QMMQ^QQQQp@-@PhK05c9=?0P p@HGp@-P`UK@RKTp 'PP/P p@-P 0 00q ЍJ$EGJJ@-10.@+ꟖQj`[O,1s@-000@1 @P壅P P0 P 8 H &P P @P ᭏媏TᣏPPU $ (0 0 30 S@`Ѝp^j`QۖQ Q6Q0 /j`0/^Pp@-0Qp9`Y C_$hC_$TSQQQj`Qx$vP?Qt$,O]Q$ߝQQPQ$yQPLd$QQLQQ^Q$ޠQC_ $QQ,$T$Q QQQ^8QP0p@-P C@  0 000000 W0   p``j` 0@-j000@Ea```O-TM10L00Y@T:P }@0 ⾑`V" 0!1 2 S ↈQ}0L1 $0 B0CS00 1 L0 30< $ Y0@0Tp$`( 0 L0 30TЍ pW `Vp GP@ @BP p BP@`F`P@WT @ TЍOɷa`^(^^``Y;RmP/Q@-:PP 00S@jH0H0 LK=HKL0S Pt@P X 0T:S0:SS @D FF MF0@DJ@DK D0`Sp0 P0U@0?! @80K@0 E @K$K00S/S@KJA@Ki@Kf@ 0`,@@K>T 2(W  `0@@DK⫗LKwHK⧗M!@K>DK⢗LK Kj`^Q*)SC-4M1@QP0,00000 0` 0000 $ 0S R 0p0pp0/SE0 A`P">0  0 00[0 ,0 304 ۣX _E0 nA 0S `0 0P P0 000ҎX> # 4Ѝ^*)S0@-MP@0U0 00$ v0S0 PP 0/S90P00SP0 40 0 30 k  Ѝ0^*)SL0H0Q O' Q0Q  @- /^HQ¤Q9QO-M3PP0000@0D0H0h0  C " $ & LC0Pl00h@h0,30S0|0s80E#4040T!@w}2 0 30  LHL@0PPXT X0\0`0$P0T0DP@@_}PEL\}2Q+ 0R0S(`T00 0 @*<}؁J)0 0 0}r0SX0,080(0 w0S 080< 0X`\0R\V`R  G T@>H؃ )0 0 0<2ۈ7 Ո(ш؃(0 0 0&ň؅(0 0 0#0000S00U0S #  ^8@D@|Ѝ^a`j`aQm۶Q3PNK$Q[OQQ'Q?QSQNJo`O- ⨔|M0 4@p`0(0 0(4P`@l徳 @@JpP 0SC0Sg 4 ?p$p;pP3pP @K☱0K p'pPpPc@C00M >B0K 0 |Kx0 0K\ KpTo`K넠K?06Z0yPcC#k00dM0`Pᤱm2 (0 30 šWڨd0Kl0 lK0h0  d0K0GWP KhK0 PS 0C1]|0G0 0lp0 @0 00CS0S[@d,}ozoS<KvoB@0S K#uPTL0K T0 TK S  S S R@0@TRoTK <0 S0 Sp p S  CR @0s0<K<K9oS@p0S,o@000 00 0<K ;\TK; ;D Kj`^a```,OQhD_!&LH[OQj`Qz7RȥQ̥QĥQM ЍO-M3pP00000 0$0G3 0 30 R: (0(}(@ QU0+( 0`L00 S @00bB/P QQ0Q A/S 00Q Q.R 0S ~S/|hI@B16 $0(Q ( ? AR \2@+BP00 9QQ/\R0A 0a/S$S 00"@0$S (PkP&A e၁80: S TP 0S:S0SPE20ES(0 A  ::(<0PPV: ) P 0y 0P @s A`sqp⡓E0 S0_ A`(7F5⌓Ѝ^|]Ow`ϥQ!gY j` p@-(P@0S p@=j`p@-P@(UTh01iXPX TʮTpHnlp@8i4:Pp$j`TS_`Q[OQj`O-@`0V 00000 pPЀF R |P0 E 00S0 0C0 R BX` Af`PPP0 OGC-,M(30$00P 93!0PS W 0S}2X@@@DTʬ P  0  BT1 CQ}P AP0p 00 00 00` S P A``l `•0@Ap`Z ` O V 0AQ D,`P A P A☕wP0 ? 00?0DS00ms*E 60 $0 30 ܞX``T 0@D 0PiI}U E 4,Ѝ^Qa`j` Qj` HFL^``Q$"Q/v@-@PʼnL1 CP*@- Q 1 *Q1!//O-M -\ 0\ ` `@ 0T pFor^  R S8 0L\ B^ C:\R  & 0@D2 LTL A/4@@̠ @P/U[Q+ UU( 0Ѝ 2PEUTR0E▄$ T@@@DV\1U 0U Spp\ppWZ  \ ~ "07@-@0000 (R0 0,0P^0S )UP`D0 0 30 ۝0 0DP Ѝ0^ 0A-P0@S `S0 0a0   `pP 0Q0 0L0 Qj`00S/i_cQl0p@-P0@STP`0 R0S?S\S03/Dpi_Qj` @-@0CS 4 0 0SP(  (  00 CB\ 0  C C @-@0CS4 00SP(  (  00 CB\   @P/G/p@-`P @0CQ^4  A 00 000 0S(  (  00 CB\  pp@-@`> P0CQ54  A 00 000 0S(  (  00 CB\  p 07@- @P10P  Ѝ0@Ɓ    Ѝ000S/Ji_QQ@-PC`)"0!S 30Sڌ6%D ЍPp #0CS(3400,0SP  P @ 008 CB\ 4 0 7p ~0@P`f`F V $L$X$`$x$$$$$$$$$$ $0$D$X$h$$$$$$$$$$$$ $0$8$02 (2 g 0002 11 W1 1 1 111 !!001 k!001@|!00l1l1h1 \!0081L!00,1<1 01 (1 -1 00 -e &0000 0 0 @00j`i_ƦQGiKGbiKTiKGGYiK>iK%HKiK WL^gI^ gItLrOަQQQiKLLLLFM?MQLQKqiKhiKLL R 0S@ S8 4S0,00S/  III!gYi_QKOp@-P @Tp0 0!! @P/A-|P@ A\`(0 St10S,0 ` ؀D0$0HA\&U 0`VV0 00400U4S00 4 B!64@A0ꠀ80 q}(0Sʀѯ}$@B `U@  Q  B!6j`i_5Qj`k_}Q0p@-sPp@_0@S_pA-@p3PP2`)2t00S0 k0T R @ B]A21`2`UC^i_fO 0 < @ /j`G-p@`<0S@0S@0<0d0R0C S:R P R`E0 0M0⣁0< !lK5l`V (I`lKҊV 00 ;P0U< @ x  Q R  W|0 3|0P x  RP,0S*80S0`4`(.80Ps 8KP: (0 30  8K P4:p00`5;5;0|0S` \ 0  0   }P 8Kja[PUP 儫 mP 8KZ [ aP 8KN[x0 p`SP 8K@[P x0Q #Q   x0 p=M ``-(@  `  *`P 8Kd0 %\ ( Br RY" 0` ,R%0 0 p 8Kg P]PPP ;R Ry0P0|0 PP" #R0 00P 0;S <70S87,P\P 0` ,R0 0p l0Kp K P P8Kl0 P0p000]8 0K0 0x0 0P z8 0Q,4 I o 婒=Rp0 p0; ;Rp K00|0b|0l K`]p Pr l0s W7 R|QR00P0 #00 zS`P 0RQ 0R  0 RS00uPP  0/o?o" 2 0  zWV\  YP80s 8K Pu  |0S|x(0 P U 0  z P000V+U 0 "$r0S 0A00  Y: z Q 830S, z ? 0?Pf? Y 0 bx(P00v 0VU0 S ?U0 M u0  G 0K sR uR``  cR00 bR0P0 P0l K;il0Sl Kcl0Sl K\l0S0 ;R00P 0  yVPH 00hU 0 y0 0l K;6l0PSl K/l`VPEl U M^j g 8K 0P00 0x0 S0x00 00-S0 0:R0`0 (P^|Q(^GQިQQ$qQDQ!gYܫQxQQQʩQ  i_Q$Mj`\S ?S0S(0 03/p0 p:S B- 0pl K,l0 SE0`opDH00 d  0 0 0R? 000 0S;SU ,SZ'P00!?! 0`<000S000P> (p 0CXF+ 0`F0S(  (  00 CB\ 0  k/0Sh x R L\x QNR`U 0;S  g&p   pGP   8K3sXuH oP0ᨂdK(3l h * 0S 0t43p K005;500?0p0Sx0  `0 !R& `嬓 0S;S0:S l0:R0l0 l0S x00P (`x0p 0CW*00e0p K,pp x0=@S04W㰀ȁPx (` 0CXy*͈l%` 00S(  (  00 CB\  0=@S0X5 ! . 0=@S050WdKl0`00l 200 \R ?R0S0 3/00Q 1Q 0=@S0  61210 00AS 0Sڌf0Sڠ`2000p K,000C? 0p0S/ [ 0000 ;R$0p0\S ?S0S0 3/dK;l0`0l P] 0_SZ 0vS4 -bX(p fX 0 0lR " 0 R70S(l0 ,$ l}"00:S lp 0 ,Rlp00p K0;000p ?R 00200000` :R R00 0lp/S0200000:Q00p ;Rl 000Gpp,Q Klp00p K0000? 0p0Sp K;vp 0R20  090 ` 0l Q q0SH<3020p!Wr1>!SWl 00FQD$W@x  x  02RFP#`M 00S(  (  00 CB\ 0  -X c 0=@Sd"P (`x0q p0CW(#` 00S(  (  00 CB\  0=@S0 $<, 0=@SDP ؆(` 0CW(#` 00S(  (  00 CB\  0=@S0 <, 0=@SP (` 0CW\(갆O#` 00S(  (  00 CB\  0=@S0 =w,m)l0 px ,00A S2%P%%%%%%%%l%0=@S00x0 12x 1l00l0 x00Cx0 s 0 lKd0=@S000=@S000S?P p0=@S(`h0S 0 \R ?R0S \? 03/ `F,0h0 0 ;R000 ~RR  +R-Q000 0%SD 0p 0R ;RbU+ 0蓟``F 0 -@R # V30S 00 6# 0x0 ;2x0PP Gb`F#bdK'SPdK'T  rR0 08Kx 0 ;R VPB 0W - V.  0 A-Q R; 00 0l Krl0PS0 0B-R Ql K0;00alY {0X0 P/ 0  ?&a x^W cllKG VRpc sR\ SR`^0 KܫQ$Mi_QQO-`0:,M,p P0$00000 ;RD0S? |a 0 0=@SPYP h (@0 ` 0CVq& 00S(  (  00 CB\ 0  0=@S0 9 * 0 0=@S08 c@0 :R0:S000 oR pR MP 0\SM03/MD\k0!0CS&0@ 0SP0 @ 0  00 CBP 0 Y  DC.0 \R ?R0S03/I00:S P7 $0 30 ?S0S ,0.S 7A0@000 ;R 0 R  0 2UP _U0 00I0000Sz 1S| 0 \R ?R0S03/0DQ>Ql0*S0 .Q ?Q *Q0 ; 0S0 \R ?R0S 03/00;SS 0 :R ;Rx00000000 \R ?R0S03/0 R;Rv  \R ?R0S03/^nPN00000?0AS$%0&%%%&%&% &%0000000000000000SuUr[/0 1 /P 0_S 0_S 0 000Sڀ6㲑 l nP \)P 0 _QZQ0!U!P ZYR(z 4  0 (804 "0C S* ($ 4000S,PP@008 C A ^40 (000P@ ZŒ000@00T000000 0C00B#0C S*j$4000S,P  P @ 008 CB\ 4 0  (0 0S20  0 00 00S  y/@P 00S 0M)P0@ Y  ~R x (00L000i@,Ѝ^j`$Mi_^^ʪQxQQתQQSQO-M1a000P2S @7P0X 0p(6P0P2T1 0 30N ( :Q B  WPP0 0㹱P@i   B_0  00FSQp0W: `(Ph0d 0``080  00FSQЍ^j`# P$EGKQQO-Md MP1pP`000@0;ST/10S00 0"R*@0 0 30' ),S"000\S ?S0S0 3/ @D0!0 00 S00@0 ڍ Ѝj`^i_aQO- \MP?p0(0 0` 00`0 +0I0[S ᚠ]'P: 'YPX 00h0 @\? (0 30 ̋:X 'X P@ ?0S;X:Q P0 Y00:0C?o2d0 ( 0@?>d2S (\P 0tS) _S eSh>$ T>0STvS0T 0SaX  Bp 00M00l 0lp 偡HK)H=0X0 X  ( Br RQ"R  X  C B3RS5%=%=%7%7%=%=%=%=%=%=%=%=%l9%=%9%:%@<%=%=%=%p=%=%=%=%=%=%=%=%=%T=%=%1%=%=%5%=%=%=%=%=%p=%=%=%=%T8%=%9%p=%:%=%$=%H0HKH T0 ~TZ H`K, 0 P D KHL 0 dt X0L` 0CH`KP0 0L HP0DKVtI00S0 >#TKk~ =R 0`XK1 0O 00 0@s  X  iR cR eR 0 1 0rRN sRX P,'X"XMppGgX0` R R、"p? ``00 [p qY#0CV !4000S,P  P @ 008 CBP 4 0  ,/X00X0 ?o8`#p0CW !40,00pSP  P @ 008 CBP 80K4 0 XP@0 Ux +PH  HK@K$H0@ 80 @ [%H0@ <0 @ K @K$`p 0 o00XH? 0 01 0 0 0Eo0\R^0  0 X0 ^X*b 0 XK1 0X0,S XKqX ? 0XKI0 0p AXKQ0 0M 00S +O0 000X0 ;R0C `,P !0 0x' "R  R 1 0;R Rp 9P, '(`0 0CX  00S(  (  00 CB\  ` 0X0 X ;R 0 崀  ` 0R0S XK 00 Sn 008#   XKQ0 0wXK0 0P 0#S 5T00T@ FR;0X0 XKNM2p< ">02`P\4d2SX`s%PT`o%P0`aIP00!V?0D*0 0 R?0 n$007XK~n 00$SXK"XK 4\"p  21",0XK\21p0 0T2 S, /PU 0S`+P 00Q3 `0!20CS%P\2a `00 @ XKM0p 0b  R0T0S0h0 XK;d0S PA0 00p S 00CS 0=@S020S0C."h0S 0㠭Pu<0 ,SpB0 0` 0 R z 0 #"0CP  SS0 S0  0 `XKtV0X0 d0PSupB0 0 0 0Sd  E 0tV[ 0KP <0 ,SpA0 XK0p 0$XK2p< ?02XKX0`" XK90p XKg 0 ?^Qi_Qj`QQ3yH(^$M^EGK8TKb{@K"80S}H($Pz00C K// ////0/ mQC-M@Pp`Ѓ+0p `*p Q @˰ЍCЍ@-` 0P@SD0SX0H0+ PtЍp@'hX00 P Ѝp$\Ph00l00p0$Qp@-` P@T `V:`@`P@Pp@-8M|0  0400@`000"T (  " 0ⳂP 0 40 30 08Ѝ^8m`.`0@-,M0@  0$00Pp0 00!000⋂P  00 $0 30 ,Ѝ0^m`A-M00P @`@T" P3P\P VpP p pIP80 0 30 ņ@:@Ѝ^A-(M0@`0$00p؀P ⑚0S P P!0 $0 30  aP T00 ?! aP T00 aP T00 *!(Ѝ^QQcP\Qp@-@M(1@  0<00 1` !00 $  ,00048 ( 0ρPP 0S 0S 0 dDP d0 <0 30 >  P@! P  0M@Ѝp^n`.`8Q@-00 `\ Ѝ0s@-P 000@ yP `VVP F0 0 30 Ѝp^0P/A0p@-@PQU  R 0 0 000p P P 0@-P 0 00党 ЍJ$EGJJ//////`0 QL H@-jQ 0000Q1000/ HQaQQ^p@-@P<18M0400 0S?$0 0P0 0  0B$0 0  0$  0 Q    `@^      00 40 30 He8Ѝp^QRpC-@M0P؅0<00` @0T $2D(0S$x0 <0 30 d SX 00 0 0$  S,R$(@Ѝp^PKOˬQSp@-M0P @0000L0  0S P `T oT#2P VP F40 0 30 ̄Q Ѝp^Ms@-0`@ ,04PS# 80< 0 09PPЍp@Ѝ/`0G\ 0X0Xc%WP @0I, 0(0@UVB  Q$EG֬QQ;QX0-|M 0t000S 80 t0 30 r|Ѝ^0 !!z !!/8m`0/8m`0/8m`0z/8m`0/8m`0/8m`P0P!R @   /!0@- z_@!1A 008m`C-,M0PЀ`0$00pU0 $0 30$ &᎐M@T0SP 0 "R 9" ! 0S y 6/xM@,Ѝ^(^A-0M0` P0,00pXMP@h0 ,0 30 !0 TU 0j~y 6/ KM0Ѝ^@-@/P[@Np@-@0PS0S p5P 00C0;P 0P000@-@P00000 `X. 00S0T0S 0L0 0 30 Ѝ^"MsQ0@-@P00000 X 00S0T0S 0&0 0 30 fЍ^"MQC-tM6&P0l00p6圖`6&唆{`6&v`6&q`@x0 r`lhF0 ~ok`X6T&T_`P6L&PH`9^04 (PX`0@0< #@pD01[7P ,p00(0 {% Pu0%`0p2 ^j]2[P 00(00,0 zL%H.hP%pH 2]@L]82[,P 00(00,0 z$J$p<2t]-]4$_&]4$`t]4$`n]4$`h]]4$`Td_]$0 p04`]x4t$`0[]h4d$`$U]X4T$`O]\@4<$`cFF]T0Hp $h0 % F` dX2[P ,H0(0 nz# \2#~_`\0 }_0 xcw_t#XpY_ d__`3\#0lT3`A] TR_834#`\(3$#`\3#`\\3"0`\  &_x\  _n\20S 2"$_2` 0 2`02 `020202] \|2 x0p2 `0h20d20`20\20X2R](p020,0<2<0820 z@0 l0 30 #tЍ^̎%ԭQHC_Qc%SI.`QP%xQQc%Y?S*lX8m`Q|O%>QLQe%7QkYQ^=Po`4%R$E%@Q%R@%po`4Qto`\%Q$D_I%QHG%RLQd%IYQLd%W-Qș%NE%Q8e%o`dc%OQeQa%Qb%SQ%Qb%ݸQ%%MC%S\Qo`bQKQC_P|%QQ|%Q({%QL%Qz%HQXQp^%O@% QQh_%sHp9`վQ%v#M{`Q{`QpQQo`տQ C_QhC_>% QQ0Qo`C_o`C_4o`To`o`A-MX3@p000PlL43l0x0p00t0x000S 0S 3"02ӕb 0 SS OP 0S 2"02录ǦP -Rv0l 0 d 0S \lľv0l 0 d 0SS lⴾ<T<0l O뢦N 0  000P0 0RNR lCL$1$ x 0l Oꂩ~\10ST1`0d `<e0!0[0l 0^00`0C ?o2_0<0u&mlJ0 0 30 vQS0l K<< a_&LlJ{Ѝ^1S*O$EGQzQdQQSkOD_hMIGXE_VM4`4`tQp@-PP@ @00S ``%(0 0 0pp@4`HC-``1M@ 0000Ppp00}P T  PV 1 0 30< %KPTePt B P(01000@klP 0S@T (K`88e(BPЍ^bQjM,?%QQA-0M0 @0,0000 00$ 0 000 (@0{ 0S 0S 0x:`P p 0 0000p(0 ,0 30 0Ѝ^m`% JO-EM1@$0 10040480$1@<0<0000 D{$0S 0S$04`$8PP00(0H0  Cl0 !    C " PV  l:H8z0 1 304 A JpPVd   v 0| 0P1!1S`V LLlHRA.Eߍ^m`% JQjM,?%QQp@-P@}Tpp@_`@-@".P ᡓ@Q7@-P0000啓0 0Z0SP@ 0* 0 (0 0 30 ~ z Ѝ0^Qh0@-@000֚F 0S 0Q0 0 30 ~Ѝ^=QP@- @"M@-@㝱_`@-@㖱_`p@-P@T p@ㆱp@_`@-@Ꮪ뛵[P @Q7@-P00000 0ZZ0Sqo{P@jht 0a_k 0 (0 0 30 ~ < Ѝ0^Qh0@-@000C. B0S 0ᾒ0 0 30 }Ѝ^=QP@- @}"MA-``Pp@ᄾ Q 0TtAO- U`W\`.`Ppv]`PT4P$0LL4城D V8b]0``10  00sR]pPb_ 0T`w\`s`P3l#0hh3f>P᧯P 0S. ͯ T_ 0T D\_@⚲0S_ޢ 0֢0S4|_@P ˧`0`L00V <$l1 0 30Z CyV/ 2 P( 0, 0400@00(0000,00 0(0SY0\ \TxY_$_Tx [`\Q0` S Sec>  \p@Pw0@ 0^u$cl Ѝ^HRDQ4Q#RmQXE_2MMKnPhD_^QSWhQ[O6MtQQQQQQQxQQpQMQ$EGQQZQdQmQo`QORQQQ}QPQARNh0@-@000ЯU Q 0`p0 0 30 xЍ^=Q7@-P0000K0 0TI0S블įP@뱔뽯 0먔봯 09 8(0 0 30 gx / Ѝ0^Q@-@Ꮤ뛯[P@QP@-@"MA-`,!MPS@    CpP! m0U00pS  p 0 0ø k0S Ṹ0 0 30 x P . PU m ᡸ000vkЍ^p@-@P<@Tp8^O--SM@1DH01L090D108S`QEP D09Q 谝PG PC |P? @0p40,4+C?oĀ2@0[0S )00" SWPM`I 0L0S P 40: S8(0||8Cx(`HZ -P! P 08ḝZ $XE? 8EtEP ĝ8 ĝ P ˆ'0$FP|⽆|'0PTⳆX'0PE 720Pp` 0Wk6 D1 30 wtP0P0` V<T0P XZ  & 2&\PHZ D? 5SE☍0S W6 .[pP4<0S &   p<h-H%h0DE8DI%B$5X $1>(1QP 0,101I@10fZhh0I/EDqDH0S" *P  8P4i4$00|40p$GT0H00 0 0 RGO0HD[U W ڜXD:DۜhDžh0  EVDP 0h l0pt0h0 EǜD˜ ?D͜<0S X @0R0S " 0 ᲼P DChↅh0 DDP w h0l0pt0h0 DI0@\A8CX\i2Q~FI@\/XMiS;W9 {P  +P\12S1Z'z0 [8 jC0 K ᏛP 02S+S0 :/4pp04 !z q6D0 D1 30gSߍO P<0NSߍ^Q8m`Q$EGQQ7QDVQXE_Qv#MQ5Q[O2MPnP1S-OD_MKcKMQOQsH}MzRhD_!&LHz7R,ONKbNi(XGw`wN@-`pP@OCPPP00 00=U Q E Ѝ@ Ѝo`G-P`p@ 0,O-@2Mbp"`P00000 0 0  "0d0 `0 嬐.q X0S 0S,喉( $" 0`0 0aT VB 1 0 30h t@00000@003/0  R3 0@S 0SE 0S  Z M@`FBM@+[] @ 0@S0S 0S 0 Z  $B_ |YЍ^8^8m`.`QNQHQC-$MX1@`0005P< P^pɇP W  p`PU L䀟pNⳇP 0 0 30& tH0PS I/U@ h0d 0``0ɈPEL{@TU0 $Ѝ^"MxQQlM$EGQQ7@-@P؟P(坈!0  Ѝ0"MQ0@-MP ßPh 0SX儈 0@PD d@X0  $@Ѝ0^0"MQQQC-M3@0 008:?PpG[PR TX 0 FわU@ 0 0P2Pg3P P7kWB`V}@᜜PU  U 00 S U  ᯡq0@S`1@pjY" UZPxq@`hq`\q`0 000 Dهh 0ZT `F p(UVP0 00އ`Щ00 0PrY L0 0 30 r0 ЍC0 0 30Ѝ^aNQQ!gY$QOQQxQQQ$EGQQO-M38pß H`000dC.Lh 02 "0$0l L8#Pt |0h pp0x0刀$nP 0S"00(0 0,@咞PW,X ᩎ@PD @"0 PS!0Q PS608 S42PPR <R .R )0R 1!0110 !0P0S,l1 0 30T Pr?X00S d@PX T J)~000 X0PƆ0XSoY㨂X |@D0 UXDXP p<"0  2tTP  K 0CSAgb0T00 0 `@`p ``8㌱`@ 0C1Y:p` 0C1W+*Y0  K 1 $0 30: pq 0 Q p`0 `  0>P P3#p`Y P:0PS P? KV,Ѝ^Q$EGQQm۶ FGa`p@-PPpb@P8مTp0p@ +Q@-@P$ƅIP@PQoQ@-@P 嶅9Pᰅ@PQoQ@-@P 姅*Pᡅ@qPQoQ0(0/0S,0@-x0 0 噅 0000/*Q$EGQQ@-@P  0R/@-@$0S00/0$0/0- , 0/0 0/0 >S SL!C|/=S /^S |S/=P/1V(/o`/J0@- >R& R(! BR$ %l%l%l%l%%l%l%l%d%(%l%0%l%P%l%l%l%l%l%l%l%l%l%l%l%l%t%8%% Ѝ^RC |R  <R00 =R00 >R00 >R00 =R00 |R00   &R00  90=S 00j, 0((0Є QuQ$EG^Q5Q@ A-p`PPPE Vd000@ PP @Tp P000C SV@!gYA- M`  Pw;@ 0IP9 p X 0 0 gP 8Q(0 0 30 o0PЍ^QQ@- GP(Q o` YUQRA-`pPBQ<00@T  >PV@!gYp@-@P p@RA-`@0pPB0 @T P@!gY0P/0@-P0S00S  4$bQ 0@-@00 0000000000 0@0 0 30 oPA 9Ѝ^IQSQ$p@-@P @eJP0000̎PA 0P00ps@-`/oV0" 000R x0F@0SP r 00  0 00 0 30 nЍp^^EG0p@-@PQU  R 0 0 000p P P 0p@-@M`P0 0000<a7P 0SX0T 0PP0H0 3/$0 0 30 ynЍpo`^Q$EG^Q]Q0 @-\  @\@ 00 00p@-CHpp@-H@L`0pP=0 p@gp@-H@L`0pP/0 p@YO-M`P6@0|00r0p +R00 -R00 900000C S 0600Y 0 `,1 ,⫐, P 000Z 00s0S夂  RP i000 rh P<0 404 0800C  S7X# K l0d00h0dl0 h05c9=?0[do d 8 d4 4ddJ8W h" ?X*T4 8 4qCpp 4\;P% p40 dhp80dS4W  PP  OCp40."0d0"d4dL4ddp2p0LY p1^dL4WZ 0 000 0, $0,0(0000000100(ď($  1 ,0$ 0 ,0,000; 0᥏0, 000 (0庌00,,010ᒏ,w(u0r( $mP $bpYpp4|_|0 |0 30 l~ (OP (D000<l,Ѝ^QGx HQ^QnH\ H HVQQG-0M5p@0,00P5%05T000~S-S !0Cs0Sx%23P P0 08P  (E(0S $0$$4 ,0 306 cl(800`!V~V+FYl 0S  000C SR J} P X  @-0$00((Ύ(x$Ȏ$-V 00( 0݋(0030$$ⵎ$ (  ~V  00( 0忋(00D3!VE 00( 0屋(0030`F VC $0$`S |` P SP$ JP   b G`k (AP (6 00007]kGw `P   $ⷀ$0 0.`7 ( Pd0I  P P0  ,80(S'b|0$ 0(00$01(($O|0)S 800C0S ?|L$(0Ѝ^Q$EG^QQ+QȍIIeGQoQQQ$QC-P$Mp2P000x27t"0pp20@`S |00000S S ᝍ 0S {`V)V eP 1 0 30h j :P [R0@`s08S00H0ӕS0S {0 0S {(Y 0  S8 6 K00S {0S P  @r 8R0 H0ҕW h 0 # $Ѝ^Q$EG^QBQ(QQ4O-a(2 0S\`0Y 0000 \zQ2 (a-p X! 0I 0C1"BSSp!p3p*W Wp! Dp 0I @ @   Y Z ` A/X 㒷#\`0 @  ` p`0S -S000C S+0@S(p@ 10BSꜴ%Դ%%ܴ%%%%%^ Q$EG^QQ nPQ!QQKQo`OGP07@-S@0P03/P P0SX0\T 0PP0}LP$0S@}0$00P0%(0CC1 Ѝ0Q$EG^QjQo`Qp@-@P Lp@لs@-@ PB00`0 ~00ЍpO-tM3匀0l000X0000YU dp@l`!WX 0 0L30S43 l0 30 h0 P PptЍO_ 0P0ȁ 07400 0 00ਐ B0 UPp20SgM\PU!0C BS(20S}2 l0 30 tЍO p  0  00S00000  000  B, TP , KT P ,10SM 4 T]0 <]hpT< $0080 0( @00 00< H00P0X0\0`0LT8pT Qp~8 z<T0 l0 308tЍ^Qi_QQIQ Q@PUpUOPad\EpKdP000 0U ` 0 R0 P0 3&0 0 p`p 0Vp  $;Q 00$p  0(00P 0 00Ol0֌#&900 <0 30 B[.]@Ѝ^Q %(QQ^Qa`P@-T @w0 @ PP$o@iЍQa`Q@-@M00<00P 00@T @To0 <0 30! Z{!A6 $j00$0000!8Q @S $$@Ѝ^a`QYQA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0WA-P0M@`0p000WP`WWOOO 0 0 30 ZЍ^@-0M@1S GG@-P @M0C 00(0t00@0 t0S 00  - )`  jp` 0 0Pp0s0T bPnQ V :( V *Ѝ 0꧈J-Q@-@S0@s@00 /R 0CP/ ?AQ {?QI- MPx0p`0 0 0  M @ V<0 0 30 Y @\`K^A-@@`?<?80@Up@ ?QQ=Ko`@-騈@~P @"nQ(0 @- R}00S@:o`w`AQ(0 @- S}00S@w:o`w`fQ(0 @- D}00S@h:o`w`Q@-@,P$@ 0P@QLKUQOp@-@P`kP p 0PpP/0Ra`P/$00P/( S @-S$x8q0/0P/( S @-S(x333fffA-P@`T@pP 003/@P/(07@-@PO0 ^ Ѝ00p@-@PQU  R 0 0 000p P P 0p@-@P05c9=?0P p@G 0B RS<0@-0Q ,mR/o`Q@-P 0 00$m ЍJ$EGJJ0P/A0 @-\  @\@ 00 00p@-@PT(`p(@ "F000@-0000 0S P@ 0Sl0`$000Vl0PpW M0S LP 0SH (0 0 30 W P Ѝ^o`QLQa`QzQPD00S/80Q ,0P/R00@o/w`^RRR@-@0S400 0,,0l000 Ѝo`Q$EG-QQ00@-M00000S .@PP.@P0 B 0S@ @@@v40 00 0 0 30 WЍ0^4`4`4`@-eP #A-@0C`;S(p<400,<0SP  P @ 008 CB\ 4 0 < @PL#`0CS*~4 4 004000400,PP  P @ 008 CB\ H04 0 0<00S @{0 <Mt`Q0 /80 0SP/0$P/ 0S/o`1O-$M0001 0S P@ 0Sk1`$pp0Vk0P儀XL0SL *PGPC 000p0V0 0 308 V@0S|L0S( 0SU$   p  0 S030#Y p0#02S T00S 0 700 @ P$Ѝ^o`QLQa`Q&Qw`C-@P1000> eP# P 0S S50 0p~P 0S 0`$000V0 00s|@oh0 0 30 RV0儐 Q: L0S +P  Ѝ^o`a`1O-M0 001 0S 1 0 30 )VЍOd<1`|p$000W V H1 0 30Ѝ@0SK0S> }P: 0`P0Т(  8< 0=1V08 z90 001I08< 0$1=08 a90 01P08$U9 @^o`LQa`mPeQ|Q[OA-`pPP(@y$0 0V:@0V03#p@-`@PpPxV:V3#p@-@`PjP   $00 @P@SPpp@-@`PSP   00$@P@SPp\0p@-` 0PRS @7P P p@po`0C-0000 PU# 0`pP$000X @0S J0S P  z PP @0 0 30 U KP @ Ѝ^o`a`0A-0000 @T 0`pP$000U@|0 0 30 T@0S J0S  5 KP @Ѝ^o`a`G-PPp3(MlC0$00$0$L0(0 $0 YZ  S 0  QYi!0< q-#SR0` 0p)$0( Q  r Y+$ Y'0X0041@ 0$ 0 Q$ Q 001 $0 30v aT!d01  3p W 0`PPP!0`Q&  -0 (w!0$# -(0`1$ v1P$000U 0(儀$pXId0! !0 d0! !0 `V P 0 0 Y — \$\ 00(Ѝ^o`QQQQa`00d0/@0<0ST00S0@- 0 0h/Q$EGQ-Q`07@-@P0006P 03/ 0 0 30 S Ѝ0^SO-0`16 00`hQ0: 00PL ^ERd@%0; 00 PP0Ap 0l0P Sp@@⌐X @T ЍUQ$EGQ-Q7MkQQMO-4M @`\00p0,00d0lPp$0(0( Ud0 ,0 30 v,!00 0P\0S @MP0 0 P 0RP x|0RP \0S 7p pP\0S 0S W P  0R\0S Pn6 |!f\0S @⹨80 0 30 qQ@7⭨Ѝ^o`XIi_XIAQaQQ|QYI@-M\1P@0000 0 p P @/ap0 +`P/DD[ @D 00 0`P ec 0P,  , P DeD$0 0 30 QЍ^ Xi_QQO-@-$6lM< 0d000<0@0D0 %X0\0bTq=0000,0q4@0kP 0f 8Ua0_8 00RXPyeRP 8re4%00 088P +/84"D0qH]Por Re80D d0S QD X (^$T؂j(0 @(P8`@$@pU@T2$0H 00L00000000 0tP ('pP0`@0X@000\0PT 0@00000 0 0X@T 0D$0QP3L3UDdU ! 3P*Up UP!oPp D 0D0   ` ` T @DY2A0B3#@ \ ATp0u'X@\pJ`P @d(80Bt`n 0p` e p ` @ 0 y  0M1T@`

3Wp! j>sP F 0F 0   V `[ `F`  A`RP (` `pil@Q   Ѝ^OGA-@-pP`T 0   R  `` 0$P$@0 0 ` 00`00`0F 0CG-S4A(p ` TP @T A@D @DP (P ( 0C1S V @E0D!/o b ! @T\ @@A H`U+ @ 3  FG%O-P-3\M 0T00d0S[0  0^$ 0F  [  Q(( Q00<w 0C #aSxW0H0HL0P0 H@Vp !q(0Lp0S GGC_pp` C_aQI&yQ ]QK&uQQ&&QQLG&*QQ5QQfYhC_Qx&1QQ%/Q=Q&`QnQl%QQ0%2QQ%kGQ%Q% QH*&QDQQQd%Q%QQQCQC_^C_QQ^QQxC_QtC_QRUR@-@P Ap@-@`VP AݼpPp@-@` PV P A˼p>P (¼P@-@P A฼@-@P A஼0@-S@03/ R/ O-pЀIqQ0G@!@3`@)*TP "T@!0`0P 0W  B  S0CXp AeQP ЍB0 0 OGO-Ѐ@IDAt尪PAT0!03@p%*T` 2T@!:``0U0  IPPY   PX A#`aP`BOGO-P @IL1DAD1T<qTH!3`@*T T@! _  '@K0P0 XYW A0㓤#0 Ѝ P 0P0 Z  »m۶$IOG 0CH1@LP*@-Q10* S1 !/ /333qA-\0@QP0p00a _` ` FGp@-@QQ ppdQz_pp@-@PTp(@OO--@!,MP`0X00 $ ! 0@ pF p Y50  00,0 0& ;( 70` 0C1(0H#P0\0 $0 30 a?@T 8Uv,Ѝ^OGO-4MPL!` 0X00 , ,!H0p0C0@F 0 0 40  000 0 0 0 ( 0`0C1>(0G#P0X0 ,0 30 ?T +H4Ѝ^OGO--@!,MP`0X00 $ ! 0@ pF p 40  00x0 0r ( 0` 0C1(0H#P0\0 $0 30 >댼T R롼»,Ѝ^OGA-@`PpP  P0 0P 0P 0 0 t0P 0p@-@`P5/P`p00Q/A-@`pPU RP U  EPQ /A gG-PQ`2 B @UɁC\*MU@!@1@*Tp T@!]p  BR  Aι@YPpQqPp\GO-p0BP`?@àZ F/T00!!@`Do`X(03/P 1@ 00F?`(⁰K !P  11 @pO-@`P0E@SCYpHp1 `W pG05   E`B!0ES Ѝ! `0E! p pPpK pGP X:I0 P0p  0R 00S @-އP//@-P 0 00R ЍJ$EGJJO-DM<8@0<000P 0儠ݙ` a0 "0 R "" "#"H "`V20 ["0 0 00 00 SBT"P 0[80S Ya( "40S w`400`S Ia "ؖ"Ԇp0P00U "! 2 0 "`Pp"0P0 0 RD00  $}""0S t"" k" ec" ]0S W" P   M"DJ"(!PP00j0!`0`p  `q  0 R2 '"!0   0 V 0 "R. 0 R x4x$0  p`$8P05/0SH$ DS@$ 04!4$0  p#8`06/!a#1 2S!Y 3080$013 p 00$ 000S000HqG^|( t% lQ \Q  5^D 8P -^( 40S  q04 00 0P ^ 0T/PPpI;^P0Q]lhЍ^a`RoP\nPNK R GRRRRR;ReRuRRRRWO RRRRO-M1P0 00CU ᷃|1 p 0S\1 0 30P `9$000X @U?뱿(`媿! 0Y0S.!뮃P堠n뜰`Vh Y` ῕l^끿   T T PЍ^a`RRRR(R2R[O=KBRO-M10 001졟W1 0 30m 8`$000V @!Q  0Q Q\QL   0S7[?(  0 Q(e[ ^[ , ,J. P0 \ 0Ѝ^BRa`XR}RRRR R:RkRRRRR/R@- @0@ ,@ 0 &@ @0 @ 0 @ |@|0| |x0 t @p l0 h @dЍC_<RX&TR8& RC_ Rw& R Rt&uLC_ RX&2 R= RPs&n R| Rq& RO-@4-\M0T000Pt\ Tn\OkPf\ F`_\@Vd3 T0 30d 70S 83 T0 30<\ЍO(_@ <-<0 X< $-< <-<0 0$0u<q$o $- <-<0 0$0b<^$\` $-T <|-<0 0$0O<K$I $m- <i-<0 0$0<<8$6RбP㰡p0S Yh1 T0 30\Ѝ T 0 R?   0 0 0 09 0 R2  0   00 0 0!/p1P<$ Y^ R RD Rg R R R2 R U^[V,O RIY%Q R R,VuS!gY[O0C-@000ڿT N0Y0 0 30 6$000X 0`V , PU` TP}XP Ѝ^a`O-,M3`s@0$001P᜿ @  P/ c`_PdrKG W@DP@ L0-S F ZKP >0 S 6N P# .P )P @x"OP) 9뎳P)42$000Z  *1 $0 30t Y6pX  000; 4P+ 0ST @0 〱C#00T 0YF X JB 0` 0 S?0$!0җ d0!! 0 0[ V 0S0  F0B!\P X  R xp0@X,Ѝ^OuP7EJuP"vPHa` R R R R RHU RH[OO-$M3@ᐣ`000)pt哾`@PGPT WCP4iJxN@pI 0S APTJ:6 0S .PAJ'`#|PP 0-SD)JP  ,0SpXpT00S J P# P P JP! P( T (T QP4I / 1$000Z@$% IPV[ PU P* X ᛑP@ P f⺔0 0 30 4$Ѝ^vPOuPuPuP7EJuPuPuP"vPHJ Ra`d R P Q@-@pSR P RU U``\`V0/////0/0/@-鳲oJP/0@-S@00p@-P@ lop 0R R @-WP// 嘷G-p\P= 0@``F 0=@S00Q` `F V0=@S00``FV+ 0 0P P 0@0 00`F@S 00 0P  @0=@S0@0 000`F 0 06# P`F$M-,M\0  0$00 @000!000p/0 $0 30 3,Ѝ^tp`0@-,M0@ 0$00Pt0000 0 P/P ᎗ 0—0 $0 30 3,Ѝ0^p`0@-,M0@ 0$00Pt0  000 00&/P d 0ᘗ0 $0 30 3,Ѝ0^ 00B0 U # R  T 0S @oPQЍp^a`R$EGRRG- M0P@0000 0 0 `^X pPp0p$000WL0 0 30 - @`P# Ѝ^a`O-p0  0P@A% 0A ЍQ Pt0PKdEQ@` PW : ( \`` W`u@6: [:tt@@ꫪ7@-X@p1[PⰯP 80P ]#$ ] ʨ Ѝ0tp`!gY^>q`@-@C0@,0/0O-@x0`P3/TPH (D2SGϳ003/pQ F 0 F0x03/0 spP D2S"PQQ0d (p@ Ѝ0S@TD2S tp`R RvO@ P 530 BPQ/Bo/0  /4`@-@,Q,1`0 00$000V`$000V`$000V P$000U$0 0 30& ,0 |P" P~"0 iPt" Pk"Ѝpa`^M@-4Mp L0P0`0,00P@p0 ,0 30 ,  xP LP0@3/P 4Ѝ@Ѝ/^xM@-M@$0(P $0 0 (0@3/$0 0 30 `,Ѝ@Ѝ/^O-$M`P 1p  000P0r@P0S`bP匁`$000V$000[T5D1 0 30I ,,ᆈ u!0Y! `V  ,P'nk "0P  +P0S @0S@0S 0 0S00U0 U`P@$Ѝ^a`t0@-0000P @0 tP 0 2! 0 0 30 +Ѝ^@- 0 0000P0 0 30 +NP 0\ 1 2 S 0S Q 0  R\Ѝ^^0@-DM(P@1U0<006 0 00000S S S00 $B$ $ Vp0l 0hh0@ wP  P00 <0 30 K+PDЍ0^XRTR#RC-1$M@`000P pPKPF  _0S ,00 0 pP# :0  `U :0   0 0Y 00    lUPn:`0 ,0 0 30 *$Ѝ^!gY@RhD_!&LHjGOiR@-LM<1P8a@0D0000000D2S pW@a0 D0 302 *!p   #,:,,F #D2S 0S 00  D OoB #*럧LЍ^tp`zRR 000C S & &&&&&& & &&&o/@o//p@-`10MR@0,00000001Z!01 ?aV  PR V 00S t1 000000(0 00S 40  .$V+ 0! 000000(0 0 1`2S 0   s ;X0 ,0 30 )Vc *0Ѝp^R$EGRRI1S!gY^:S0 0@o/ PP/P/@-0@@@H@0 4/Ѝ4`@-CPD0K@ 0<<0d>8 0H@ 4/ЍR$EGR'R4`@-0@S(@-0@Sp@-@P ,`PPpPUpp;R1@- R 1 00!>P0 000Q2H"L0 000S0 00 0S0` 0\00Sd0< 0800SD0 00 Ѝ^(R$EGRR?Rtp`CHYRyRRR0@-  R 0 00=Pڀ0l 0h0l0Q2H"PX0< 0800S80 00 Ѝ^R$EGRR?Rtp`CH1R@-0h SS P0)L 0H0H=P<0*( 0$0( "H2T Ѝ^R$EGWRR?Rtp`!0@-(0D$ 0 0t=00 ЍR$EGRR0!000 0/!0@- 0W 00W= ЍR$EGRRp@-@P ` ᙦPp0 S CpPp@yp@-P` @PPp@ pp@-0(M@0$00 @D` PP @D 0,0 $0 30 @(&(Ѝp^A-(MP0P` @0$000 $0 30" '( pP @DBT@T@H H@D(Ѝ^MG-(M@`L0P$10$000B?p Wጒ% PE_\ PLPPL_P VrbP 0E?P HRP $0 $0 30 '(ЍGЍ/^@-DM@`pP PE0$ 0" 0DЍA-`$1XM@p 0T00V0 < PዥP 603 70 8P Q t l <` < 40 T0 30 J'< eXЍ^hD_CRORwNH!0 0@-`0 0;/R$EGTRRD1@-M000!0$1f !01;0P  1 000@p`$000V!d00  0S0   Q !0 P0 0 30 &!d0 0 Ѝ^R$EG}RRRa` 0A-0S Ѝ0p`!0 @P 00S00 0儀Q0 000"@P0 SR0`!d0A0P @P(1p@-M000!01i!01L; 0@ 1 2S 0j 000`P$000U  0S  Q !0 7P0 0 30 \&!d0 0  Ѝp^R$EGRR^ Ra`7@-@P% !0" QP/P)0 00: 0 1 2 S S S !0   0PH Ѝ0 0S R PPPU$0 00qR$EGARR^'MO-`P@D2SRp p[AJ p 0 p 0 D2@P S@P&JH  ЍO|S1 Ѝtp`RQvOO-Pp@`P  Ѝ輠D2S T I@ 0h 0 D2@S pT(  I rPtp`RGRO-RM@01!01(:딡P`@D2S|ΫpM l1T A0 0 0@Ep00X D2W@&S5 2 0 @P P  P W p D2S nIp kIT0  00ЍR$EGR$Rtp`ERRRvO,RO-RM`p2@000\2X"0TT29PpPD2S Q ("U$2@0 0 0 `0 T@D2T S 2PI 1 0 30Y $S! h!Ud1@0 0 0 H` 0 @PD2SD2S PT) H0 y 0  0 P D2S ުP H@ Hp0 [ @L L0Ѝ^R$EGRRtp`RERVRRRRR>R RG!gYA-R M`080000 008 @Pp Q 0 +0S ,0 0 30 $  Ѝ^R$EGReR00@-M000 0S0@S p0l 0hh080P00  0$0P 0 30 #Ѝ0^R$EGRRO-dM2P `0\00 04Pp00P140S0 BPEt2 P0 $0 0000 RU6824@$0<0<0Y- 0 400`0P!<YX0R 0V#3V #2QP @T  0EPG PX1 \0 30N w#0R$00(0$0 S(000#03U00S.0 0S0,0(0P$0 0 @400`040WP ,0<,0P@ [T $0T( P000  P<dЍ^a`p@-P@ p@RRa`C-P1LMph0D00` @  00 D0 30! >! 0 ؂ `P   `$PLЍ^-0HLM D 0 D0 30 !LЍ^0@-@h0LMP 0D00000" "P 0 D0 30 LЍ0^O-02M@P000 00@0 ?0@ (00!j<,YdHLg 0 S . 0\$00@#P!?* @P0 0`0M 0 tdY00`X0gY0SH7 90S& 0T$00:.@0S^0^ SQ 0A"0SR0 0 30 o 0[P0 R0 @ P` 0T$00@!P! @PЍ^Mp@-PM\P0| 0L00x0@00t`  00l00 $" V   d LP$0 L0 30 " PЍp@Ѝ/^O-MPh6000H0  C(0 S   v0@S ) R 0 Sl 600Ecqb P 1 P 0S Q 0 0000S0p$0X 0儰2 3#0 00!00`4PV/ !0 40p!d01  00000(000c00,00(00P P  P PP "P  0 /P(0S  0 PP  p00` 0HPL0d 0\0h 0`0lRS( 00. X 0 R Q Z : Z0*p00 0H 0880 p@(00000@0( R ᄽL0 `h P0\0l 0$0SP0S& 0 X S0 0#X o!@$fP 0 op00` 0HPGL0h0\0l 000,0S 0,00EX @0 0 80P <80 Pp00 0H R Q : Q :0`PL0h0l\0 0!R0*0 `0 0P p0 $2P`U 0S P 0S V ]T0 0 30 `P2S 0\Ѝ^a`LA-@`(P ,pW 0S  (0 S0` 0PpP  0|0 0 30 L!R0 *PP0 A 0  0`P W Ѝ^a`@-@T  $0 0 30 Ѝ^C-@0P0 00` 0S Q؀ЀC sA 0|$0@ 0 30 Ѝp^ cA-@MP10000 0$ S$0cᢦ00 3/PP Q0& 0020  0 p00 00҇* (40 0 30  ÚЍ^R$EGRRO-p  0 102S@ 0  BR `-@R0P0P 0 U Ѝ05# R 0P^$M 0@- 000000u ЍC-M`0P0p@0 00`4 0^P 00S 0 Rx 1 2 S &Q40 0 30 (pBЍ^^O-@P4M0`إ`p0,00P0 ,0 30& P 0 gPUW$P Y 00S 0 00Y 0  X4Ѝ^@-0 00000 0000 Ѝ@-@ @000 0000 ЍO-1M✱`pP000㡠UU @TP (P @OP% (1 0 30B 3S xPW x0/S 0 00=1 l ጚP @0/S 0 0|0<zP @0P 0  0p Ѝ^tp`R$EGRRRO-@-l3LMp `P0D00p~D#$`(@kUCP 3U#030] [ K82$000YU0 0~`UR Z @ 8000, 00480,0D<pP P  2WR , 0004  80,0WP )]!@00X U( \1 T!000, pW 0S2 00\' 0   0 0X 0HC0S<\崢XW  $m$0S  0As0QS 000CSS bPU0 p L$08/$@(TS D2S *`> )0S-0 S 0 P \0SS 0p $߲$[ (!D"R @ = 0 ,0 30, ~ kP 0 x03/*.D2S e  $#D2$@(`S ПpT4  = (NP4Ѝtp`^GRRR R@-MP@ 00P  0 0 30 3Ѝ^G-0MP@000pP 0  "`P P `0 0 30 `T 0@S@ 0   V Ѝ^A-P(p`0@ 0 000,0 S0 W UW 1P000 ,0 0 30 Ѝ^0@-AM$1@ !000 0 12 S  0 0 303 P00 ,'  0S Q !0, 00 00$0 0(0 00T0 0 0S000 ,,둕Aߍ0^^T&O-SMQp1`,@(0p6 t0D10  `7\ ^ \^0 S^'\`& "\P L6 D1 30 <"^'^00S`u Z_Z00:Z0P0S P U`0`00 0t x!5R0$ $0 T0T0 S&h5`$0T0T0VT@, X t \ ( d ^/h D,%TpH 0Dp040t 80<0@0`0 0`| 0VT ,0SPj P0p(P t00(0p+0CU0[S  t0QN;0Q ၳPP(P|PU1  @$ ;$ 00$ 0 0t0 0#[S sặ]WP 00t0t0 {U0`0PUT Ux1, 0(00000t01Px`'X7x1SB T2003/7#x!R(0t 000(0t 000 00S 0 00R(0t 000PP0S`V P P& tQXZ  \XdP (0t 000KXP (0t 000?x1S40t0D@<@H0L(0P05  P_0  <K ,K~ <KVZ' 0CS( 0 0S((00CA\0  ` 00<<0 zV0 00 0CY  0 0S((00CA\0   ` ` 0 00<K" ,K ƒS K^&&8&h&0Qs@-@000PG`P 'V  ߳Q `V` @ d0 0 30 qQ`PQ40 403/Ѝp^@-@1P`0 000000000R00S   坴P 0S  cx0 0 30 -0 SO ï8Ѝp^A-M`@00pP000 400h0 s,0 0 30 jЍ^T@-@ 8 0 0 30 Ѝ^4`A- M1P 000@0  0)0`S@ @@@ pW 0 <0S0 30S 080 0 30   뱑 Ѝ^4`O-H2,M 0$00 00 0p0W1 $0 30x p) @@,P' 0 0S0S" `VP 0ECRCBW U% `` PP ,@ 0 ҤP 0p!0  P!d00 ~tR~T ! 3@*T ~t>C#030`   UPZ PEP  AϏB`P@>C,Ѝ^OGO-LM1@ pP0D00$0,01<$00K<( 4 0!@8    p(0 ,ᒵ`0WV`` 0 `@_ T0 D0 307 p 8P 0SW  <0?o 0 +P 0@!0 dj?o2S`!d00 LЍ^&ܓ&@-$ML1P@000000/S300T00/S 0 00(tp`$000VP$00U0 0 30 > 0 |P 0 00帳P$Ѝ^ R$EGR9 Ra`@-\000000000 080 0 0 0 30 Ѝ^&O-EM`Q81p082@<0 100$`<@0 00r(p0,0040080(0 0 1 0@ $0[eS R0 \R R@@ R'S` "Sp12\1 1 30P 'R"RP0 U (PEU:PtB 1P:U U PEuP3U V:_U 0[[S!0[+0CK@V*PT J  _UU 00P0S0S:U [U0Z+0CJ `  뉏Eߍ^h&4`C-P1@p0000000` xP0S  R 0 Q 0  t0 0 30 6 Q b  0 " dPA A Ѝ^0Rp@-@(0 0S Px(0 [0(0px$땿H@-HM410D00PP 0@00 00000 00 *0S R & R QS    xd0 D0 30  xRDS Q,HЍ^ YI Y 00S 2S>13S m P< A P 0 12 R S S0 00S 0S 0R1 d0 309 ) 0 12 SPP 0 "R0S00@,0040800@pT S , P , $ 0,  P p0@@lЍ^^tp`O- |MP<50(0 0p0K K CL0K K C 0 KS K K K4$04%P@X :P# `d _V$V00V0P0S0p`0 W W P _W$WppPpW&0 `S8d?S S$! Cr ?S9 (S 0)S C%\S [S2 ;%|S 0^SpW;  _W$W0VppPpW! S0V S+p0*S [S0]SL%\S0]S 4%0:S $ %0]S % S ӱ 2M`A+2pK0S ``$w2 pK⃠0P0K0S 2LK0S ``w2 LKr0,0Kh`` pK` $0|p xp t` 0 0X|000 0P~s" 3zLKvpKvp K 0K0p`L0Kp K AP K0 v00S /00Z00V R) 0S&0S#,0[S  0S`$00 0I 00~$0 C0p K!P KdVLKvpKv$0 (0 30  K^\;R$EGR !R5K!gY1^8!RV"RK!R~!R!R"R}Qr"R4`Ha` FG"RO- MX2PPp0(0 0h0Kp0 l hK/ :Q@P 0:S@ `D0 0M 0 ᣡ늁`v= Pb P @P 00 T0  0 |0 x0K0 t0  /@ 0@0 0 KKLKIK8a88UKKKJpKҩ1 (0 309 !0S|xk0 XK0 XKpKhXK⺩p$: 0x@ @K@KpKU@K⧩p:4KKnKpK▩  K^[L"R"RO-p 3M@RP`000 0S@ h`P0S2T1D V 0  Vt l0@PX 0 0S $2 0 30 V0Sk  0$0 `@ 0巣!0 P0S Yd0!0 2S J!d01  `P @0$0( 00 4 꽗4h`0$0L@0( 0豖cL hdo@P 0j?>Ѝ^t;R"R7#Rb#R#R!gY#RD_D_#R-4M0 0,000100 00$00(0 000 0= 0S 0S 00 00P(0 ,0 30 G4Ѝ^dq`-4M0 0,000100 00$00(0 000 0 0S 0S 00 00(0 ,0 30 ʊ4Ѝ^dq`-4M0 0,0000 p0( 00$0! 0S 0S 0 00 ,0 30  4Ѝ^T&,'R^='Yt`l& C_'R''OhC_$^C_ (RXH.(R$>'&*RL='0-R'd-R|-Rk-R-R-R;RG.R0R2.RU0RxC_0RtC_d1R0R1R1R-Q1R 2RC_;`*2R\;`|&<2R2R2R2R|&3R2R&.3RC_Ȗ&F3RC_u3R3R<&P]`aI]`>S GG10&D^`&T^`ht`O-1LM@p0D00P E Q$W( pHp$( $0 )W pG 0 t0E PE S(1 D0 30C  Ac E bP P   P  P I  `P  H  {P KV :pG 0 PkP  &LЍ^C-PMP2p8`@000 Q3U#RP2VLD`0 AP `VG @F0"/o b S/1VR1 1VUR1  1R 1V0   TL 4 @V01P `@pV 0 0 30( U  R 0J 00 ̻c R }xP 0 d0 @Ѝ^3R3R[O3R&4Re4R4R4Rc5R5R6RM6R6R7R|7R7Rv8R!gYq9R]9R$EGR9R@-8M0@ 040000 0$000@(00,0(000 0? 0S 0S 0 00$ 0|(0 40 30 s8Ѝ^p`@-8M0@ 040000 0$000@(00,0(000 0  0S 0S 0 00$ 0F(0 40 30 =˄8Ѝ^p`@-@Q1/@f@-@Q@]H0@-@0S000(000000c4`4`0@-S@ X02@-@-@ 00Q00!000/(0@-@070 po\;R:R$EGI;R /G-Pp@ `X(P0 0S ǍP Y  & 0  ᱍ00000`0P O-Ѐ0I2s.qAS@!@3@p`)*TP ?3T@!&P  V  J \ 0XL  A RP Ѝ?C K  ` K OG@- @Ѝp@-@Pp@p@-@Tp P@fG-pQ`@T@ 0 S 0@#0! SR 0SV& 0000 0 Q@0 00PQ`  `@ @E%00C0Vt`t` k;RI'9R>R0^C_M'BK>R_@-0L  < 0 03/ 0 0 30 }Ѝ^$UR/0/p@-@PU 6#P0P0 PPp(0@-@0  BT0#t`A-` pPW@ @P@-G.Q 0S @ |@yCRCR@-P0(M0$00/.PyMt 0 000 @0 0003/ (0 $0 30 ᷝ,(Ѝ^,DR4V0@-,M0@  0$00Pl0  00!0kP f 0,m0 $0 30 ,Ѝ0^t` @-@0CS 00SP(  (  00 CB\ 0   @ 000s@-@`SPPPșUVpЍpᾙPPVH0 0S00, 0((0ZЍp@/!gYt`DR$EGDRUDR0P/ss@-3l lI"0 @-\  @\@ 00 00A-@PP``tpᘙXVpW<20S$2 "02 ЍA/VhЍ0SqXQ 0Sh@0!00@pyP 0"0D:$0 0 30 Ѝ0@ Ѝ/^-QRHQR!0G-S`@\ 0!00 CR񟗌}''}''S ,Q  P$r$P$0EXЍG,  P1!01   q+ s1!01P Q 1l!0h1$ l$P,\PL $\ P x E$ s 1 000S 0 00`$ |pxBU 0 P$, ||`BU $@T XQRQRQR@R?SRRR[OQRkGR$EG/RRDRpRR|RRRRRRFRVxSRSRSRBR@-@P A s@-@P sO-@IDAt\aAT0!03@`!*TP 2T@!P0 00X  B  S0CW Ar QPB000OG@-@N1L^*aQ10* S1 ! O-@IDAt aAT0!03@`#*TP 2T@!P0 0000X  B  S0CW Ar QPB000OG@-@MKp@-@0(`$P0V$P ,A[rP`VP AQr P`V P AGrpP 003/0PP,TR@-@4/rO-P @IT1DBj3CT@`TH!3`@*T T@! 0   @0KK0PX0YW Aq00㓤#0 Ѝ P 00PmsZ gw t,s0 qꫪOG0@-P0P210 P0 0| 0xx0 BQBQBQBQ  ЍBBBBQ VR$EGURURQ@-@0 00 Q0!>0@1!c>>sc0\Q  S:T0ЍQ0 BVR$EGUR5VRp@-@P0 M00002 00P 0S03x 0t000 P `S@w00P 0 0 30 l Ѝp^WR$EGVRUR)WRA-QP@L!Q!e| 0`0Plc05t`50Q  B`\( 0NpS4\uP30c0PPQ  BO-@Pd1$M000P1L!0H1H 0S81Q$!0 100 ` PS@ 0pS0P0 0 5 `V0S` XP0 0 30  V 0  0 S$0S0IP `F S$Ѝ^WR$EGlWRUR)WR 0s@-0S p0l 0hh0 `@PP@ 0 0t0PЍp  0SWR$EGURWR0@-P0M@000 0+0000ܑ!B B  B e \W84 $q 0 0 30 rЍ0^XR 0@-0S l0h 0dd0$ 0@ C C 0C0  00Ѝ@㨭WR$EGUR9XR /@- ˮnXRp@-@0MP0 `0,000 @   @  @ ◰ N P0 ,0 30    0Ѝp^XRp@-@00MP` 0,000 C C 0C0 خ L0 ,0 30   ⳳ 0Ѝp^XR0@-,Md0@80$00<0S DyP x  0 $0 30 ,Ѝ0^XR0@-,Md0@80$00<0S DZP ?  0 $0 30 ,Ѝ0^XR0@-0x ,M@ $ @P  5/  P @#$0 $0 30 r,Ѝ0^0@-P0M@ 0000 C C 0C0خD0 0 30 N↲ⲳ Ѝ0^XR0@-,M@L08P 0$00  +0 $0 30 ),Ѝ0^A-MP @`p D T T @D0D hTؑ'''T t뽪 hL0 0 30 돪z0D h∤Ѝ^XRp@-M@`P0 000eD a 0P0@!W0D hⵙvp00 Tq'Rh Rp 0 0 30 Ѝp^ YR0@-0 0 ^xYRT4YRUR 0@-0 S S ,0( 0$$0KP ЍYRTURYR 07@- 0 R L0H 0DD03P@PP0 Ѝ02ZR$EGURYR,cRs@-`/oV0" 000R x4\0F@0SP ڌ00 P0 00 0 30 4Ѝp^^EG0p@-@PQU  R 0 0 000p P P 0@-`1DMPR@0<0000000$ 00S  0 $QT0O+* { *  B gp ↌V/u/]P 0 00sn @peG0ESQ0 00}@0LS,0$0  $R$|$UE(0 <0 30 DЍyPD?^SZRZR$EGURYZRZR@-P0,cR 0@-0 S@qPЍS 0 0 05YRTUR[R @-0M , R@غ,@ox0 ,0 30 UR  P0S0p 0# 000Ѝ^YRTURM[Rp@-P@`0 0p@/p@-P@0 0p@/@-P@p`0 p` 03/ Ѝ@-P@p`s0 p`03/ Ѝp@-P@e0 0p@/7@-P@ Y0 0 Ѝ0@/C-M@p80 0 00S 0| 0x0x R d0P 0L0P`D04    p07/Ѝ[R$EG[RUR-\R@-p P 0 0R L0H 0DD0e@`0 P$P05/ Ѝ\R$EGUR]\RO-`"U]Rf]R]RA-@1(M`p0$00P 0 00S  0 % z ZT1 $0 30G(Ѝ S S (1w$!0 1 `X  00 S S " 0 00 0RPᲹ᯹0 @@04/  !40$030 a(ЍA yl^YRT]RUR]R0@-j0 0 T^RT]RUR0@-q0 0 T^RTw^RURG-@P-L3(M0$00834#0003PU UP` ` 0 :!ᇊ0P+ 2" + pa  @  {g 8 {  z{z 0""42 $0 30 @ H 0000 0 w00 000 o0S ZH000 \zxHz@ppppW 0000 0 H0 u0Qʁ 0 7p  0Q͡ A+z' pW' W 0 Sz*GzG 0$0S W 0h2#W  0 pG(ЍO^WR$EGUR^RPu`Hu`O-@P-24M0,002Z!010S1!01` P0 Plm {z1 ,0 30X .P $0pP0`P @  0!z'800 0 : PP 0U 0PE$0SP  Y 000 PHPPe Y 0  PE  I@ Ȋ 84Ѝ^WR$EGJ_RUR)WRG-@PH38M0400430#0,,3PU UP$` ` 0 !0 P& 2" ;+qb@ p Ѐ !  0""82 40 30 @  `  0000 0 00 000 0S $\ Z` 000   p@ @ ppppW 0000 0 00Qʁ 0 p  0Q͡A+  pW W 0 S{g*a 0$0S W 0h2#W  0 pG8Ѝ A^WR$EGUR_R`u`Xu`O-@P-24M0,001Z!010S1!01`P0 Pk! t1 ,0 30U P 0pP0`P  @  0! 800 0 PP 0U 0PE$0SP @ Y 000PHPPe0 Y 0  PE  I@ b84Ѝ^WR$EGE`RUR)WRG-@PH38M0400430#0,,3PU UP$` ` 0 !ᯇ0 P& 2" ;+qb@ p Ѐ !  0""82 40 30 @  `  0000 0 00 000 0S $ Z` 000   p@ @ ppppW 0000 0 r00Qʁ 0 bp  0Q͡A+ S pW W 0 S{g*a 0$0S W 0h2#W  0 0pG8Ѝ A^WR$EGUR`Rpu`hu`O-@P-24M0,001Z!01:0S1!01`8P0 Pj! t1 ,0 30U ZP P0pP0`P  @  0! 800 0 f PP 0U 0PE$0SP @ Y 000LPHPPe0 Y 0  PE ; I@ 84Ѝ^WR$EGFaRUR)WRp@-@Pn p@kA-(MP@0@`0$00p]L0 0    ,0 $0 30  wg(Ѝ^p@-MP0(` 000@ 00  ` CS0 0 30 Ѝp^@-@0 0 00 0 0 0 30 Ѝ^@-0 0 00 0  Z 0 Q쮭L0 0 30 p SSCCЍ C^p@-P` @ƅγ p@O-$M@`1PHL000 0PpT`D0 ?T T @D T '''T) T- T  p  p `++0 0 0 30 C@00 - P @  a ^  a $Ѝ^aRaR@-P\0 `@ 0 00 00 ~0 0 30 Ѝp^@-08 j0 0 30 Ѝ^@-@T0`0 00PΎ0 P0 0 30 Ѝp^@-@T0`0 00P᪫0 60 0 30 Ѝp^A-P00M`p 0,00RL0 @P 00S@0 @,0 ,0 30 ^{f0Ѝ^5SbRp@-@PDz p@\A-(MP@0@`0$00pᶲ0 / 0  ) ك,0 $0 30 ( ЃEf(Ѝ^p@-MP0(` 000@ 00  ` CS0 0 30 Ѝp^@-@0 0 00 0 0 0 30 Ѝ^@-0 0 00 0  Z 0 QL0 0 30  SSCCЍ C^p@-P` @& p@O-$M@`1PHL000 0PpT`C0 >T T @D T ꨻'''T) T- T 7 p  p `++0 0 0 30 j뛳@00 텥 P @  a ^  a $Ѝ^aRaR@-P\0 `@ 0 00 00 ~0 0 30 1Ѝp^@-08 j0 0 30 Ѝ^@-@T0`0 00P0 P0 0 30 Ѝp^@-@T0`0 00P0 60 0 30 Ѝp^A-P00M`p 0,00lsA0 @P 00S@0 @g,0 ,0 30 ^d0Ѝ^5SbRp@-@P p@GA- MP@08`000p0  0 z 0+S/,0 0 30 ~&d Ѝ^@-P0 `@ 0 0000 zzgz zCS0 0 30 TЍp^L0@-000 0$0 0 30 ? Ѝ^0@-000 0zzzz Zz Q@0 0 30 zSSCC Ѝ_^p@-P` @xူ p@C-M@`1P040 00 08p<`H0 CT T z@DzT 4'<'D'T, T0 T zwzzwzgjj0 0 0 30 0 @0  P F @mzzzGz^zzzGzЍ^aRaRs@-P\0`@ 000 00 ~0 0 30 Ѝp^ 0@-8  i0 0 30 v Ѝ^s@-@T0`000P0 O0 0 30 \Ѝp^s@-@T0`000P0 50 0 30 BЍp^A-P0(M`p  0$00 ❅ 0 w@P 00S@0 @ À,0 $0 30  ⺀/c(Ѝ^5SbR0\03#/A-`pP\L00 \ @Hꫪ 0/0P/( S @-SOuOUUU @-h00 00  00 000 0 30 Ѝ^O-M9@4, 000(PE9Pp`@PP@8 T0DX12s#$0<00D0H0L0P0T0X0\0`0d0h0l0p0T )$kP0 08(08-@`R>0P@ `SD0P0 000$0U?0T0pP`tpxp|p$0$0Vkt\st\P000`0%0C'10`0 0 0Shp\40h@l0C?oX20Spppt 0S6 73p'0ll7ؠ0 S 00* 0 \ )* 0 R(  (5005T Q  *\ 0: V T (00000(0 C P =0S l6T&0P\6th\PD8a ,0T ᩧ  1#@0 T 0=0S 5%05k0,TP P  ≧[x@囁(t0 P S !DR 0P% % *|0T 0p0 0p(@x@`1%t_tx0 D(000 0 0p(p g0 cY@ | A(`(0 t咳#x@|0p0S P0 Z:p@^0:2IZ 00#03Q030"S?Z 6*@ T A @00@ )#뀠0 D$(0,&    ( Z@  A_$0 〰咳#@0Q* `0@}0Q 00p0 0CQE P B;h\PD81 0 30q P@);X!D@H@0DXU#0p 00,000 0S  0 0E0@  0S P R0 PUE@0DU p0` 00,000 0S   0 0E0@  0S P`:{\ 0U:N Ѝ^ t'#dR$EG dRcRdRjdR1dROGdR@-@P A^p@-@`VP A^pP: 0CH1@LP*@-X H,0 0F`FSP1 L0 30M c0 PE%F  rP  lP  dP  ]P P 0 QP0 E$ PH$ P BZ:H0 ` 6P aTЍ^P/A-pPA@h0` 0ol c U ] UPf AꫪMM 0 Ѝ 0 /V///0X /0X /X /X00/X / X  /////////-R :R03#//MЍ//MMЍ //M0Ѝ/MЍ///  ///0X/a`//  // /0`MЍ////////MЍ//MЍ/MЍ////8R@-3 00p13/0@-0 0 dRTdRdR0@-0 0 jeRTeRdR @-eRdR800S (0P/Q @-/T^xu`eR@-eR@-fR@-fRP/qp@-@ZfP  p@ꎥQO-4p(,0`P@80ZS''|'''W  R ^ (* R0 YW i7fRifRM@- @ D0 @000(0 0 30 Ѝ@Ѝ/^Qs@-0pP@e`|0T:eHЍp@s00S e` m@H.WrLO@-ufRA-@h`eP\R 0CU:eA<Ie0 pP CH.WrLO fR fR 4gR dgR0  T^0@-@03/P 0z 00Ѝ8N$EG8NQ8N@- 0P     T^qvN@- 0P   T^qvNp@-@D00S P0 P,0(0 p@ p@T^2Q,H}gRgR0@-b0 0 롘H$EG\HH@- P@gR@-Ns P00R@-0P 013/-4Mh, $T(P@,$}0 ,0 30 4Ѝ^( @-XhRdR0BG-@?0M`PÀ0^4PE_^ P0#N,PPP Tp0PN_PVN,) 0R0"*0E?PpN.p0G \ p1G, p0Ѝp@-@`MP``F0Fb0  x`Ѝp諪p@-@0M` P0 40V0: 0Ѝp0@-@ P AYP AY@YP/p@-@0M`0PV0Ѝp P0*T   E0Yx 0P0P/0@-P0U00S  4$bQ 00P/( S @-S3G GHUUU p@-@P05c9=?0PG p@||G0@-yo80 0 SQ QR0/0 0`@-O0P2hR@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-@-0@-M 1@0 00 Q PU :I0 0 30- <0S *0003/<0SS T 01003/<@ 0100 IYЍ0^@-0@@-0@0P1/@-@0@100/@-@0@10<0/@-0@01/@-0@01/@-0@01/@-0@01/@-@{0@101/@-q0@01/@-h0@0@0/@-@]00Ѝ@/@-@P0@100/@-@E0@100/@-@:0@100/@-@/0@100/@-@$0@100/@-@0@100/M@-MP`,0@ 0 0p,0000 000 7/Ѝ@Ѝ/p@-P@0 1p@0(1/0l9`@-00L13/@-0@0T1/@-0@0X1/@-0@01/@-@0@10 1/@-@0@10,1/@-@00Ѝ@/p@-P@0 1p@0t1/h0@-P`@0000 0xq07/ 0 0 30 t Ѝ^p@-P@l0 1p@0|1/p@-P@_0 1p@01/@-T0@0|0/@-K0@0L0/@-B0@0P0/@-90@0T0/@-00@0X0/@-'0@00/p@-P`@0 0\0p@/s@-@`P 0 0`01/Ѝp@-0@00/@-M@`pP0( 0  `p01/Ѝ@-M@`pP0( 0  `l01/Ѝp@-P@0 1p@0d0/p@-P@0 1p@0h0/@-M@`pP0( 0  `01/Ѝ@-0@01/@-P P 0} 00M ЍhRTdR]hRh0@-P`@000z0 0q07/ 0 0 30 j Ѝ^@-d0@01/@-[0@02/@-@Q0@102/@-G0@02/@-@=0@10 2/@-@20@102/@-@'0@102/@-0@02/@-0@02/@-@ 0@10 2/p@-P@0 1p@0$2/@-0@0(2/C-MPp`@0@ ؃0  p`,23/Ѝp@-P@0 1p@002/@-@0@1042/@-@0@1082/@-@0@10<2/pC-P@`؁0 0@0pC/@-0@0D2/@-@0@10H2/@-@~0@10L2/p@-@Pr0 0P0p@/p@-P`@d0 0T0p@/0@-M @PS00P`R5/Ѝ0@-G0@0d2/s@-@`P;0 0`h01/Ѝp`07@-P000@(0 10l23/ 0 0 30  Ѝ0^X0@-@000010p23/ 0 0 30 Ѝ^@-@0@10t2/@-0@0x2/@-0@02/@-0@02/@-M@`pP0( 0  `01/Ѝ@-M@`pP0( 0  `01/Ѝ@-@0@1001/p@-PH0 8@0S POp@e|u`)N@-0@00/p@-P@J|0 1p@00/@-q0003/0  T^80 400R/@-$@0SC00,`,`T^80 400R/@-$@0S000,`,`T^p@-P@<0 1p@00/@-10P @100/@-qP@-@-@-@-@-@-@-p 0P//KOhRhR041/p@-@PPpRp0 T0: 0 T0p80X/a` /xu`@-@p`P0 0p`01/ Ѝ@-0@01/L0p@-0S P@0 1p@0D0/ SpT^iRX0p@-0S P`@0 0H0p@/ 9pT^iR@-@P/@|@@@Tp@-P@}0 1p@0$0/A-(M@P@0Dp0$00h01`d00S 0+ 000T13/P t0.` 0\00p0 0@4/ 0 $0 30 :(Ѝ^N$EG6iRdRxiR0@-$M @P\0000'0100 A4/ 0 0 30 $Ѝ0^O-p42DMP0<00 0İ傘`wP& 1@wwP  pw0  pa6/x1 <0 30U \Q ST `0 B0RE((($({S s륻oS P$}$ c$SqTꑻP$p$ VS$ f$@ျ0 d0G[$@u0 <0<bXDЍ^0`fRiRiRjR^jRjR*kRikR7@-@PrU <0G8 0440,h0101 Ѝ0@/kR$EGdRkRp@-P`@V0 00p@/`07@-P000@C0 1013/ 0 0 30 4 Ѝ0^@-M @`0p)P0S p0dl 0hh000`(`6/be00OЍ@iM#lR$EGdRkR@-00S80w4 000000,0 Ѝ/clR$EGdRFlR@-0@0d1/@- 00   0  0Ѝ/@- 00   0  0Ѝ/p@-P@0 1p@00/0@-M @P01(0000 @4/Ѝ0@-0L00P @0< 0880P0003/ЍA0`lR$EGdRlR01/C-$M@p`Pt0P ؄0 @   p`01/$Ѝ0 0P @-A 0+0/xu`lRdR0/xu`@-K0013/@-B0013/0@-M @600Q5/P0 00Ѝ0S@-0@T@(003/Pz@oO@-0@T003/Pf@@-@_0@0/p@-P@X`Sx uL003/X`Du@ f@XXXp@SKnRenRRp@-@P+0  0p@/A-P`@XpN ?0  03/Xp >l /@X"X<O@XXA znRnR@RRp@-@P0 $0p@/A-@`P|Xp  0 $03/lXpl `0T@`Xߵ\X@۵ @TXӵPXAεnRnR G@RR@-@ P$`0$` P(Ѝp@/A-M @P0p4`0X ᰲ0`p(8/X@} ៲ @Xx@吵 Xl匵h0W@XᅵX@偵@WzWЍAtnRnRN@RNR@-K0@,0/p@-@WPArT c:0,03/WP3d  UWp@JnRoRRMp@-M(P@4` h000080000`0 0P5/(0 0 30 4Ѝp@Ѝ/^p@-@P0 40p@/A-P`@Wp  0 403/Wpl `@uWqW<!@iWeWA &oRDoR@RRp@-@P0 80p@/A-P`@NWp α0 803/>Wpl ᾱ@2Wᱴ.W<孴@&Wᥴ"WA 場]oR{oR@RR@-@x0@<0/p@-P@W`lt Ꮁe0<03/V`]< @VrVp@moRoRR@-G0@@0/p@-@VP=nT _60@03/VP/`  QVp@FoRoRRp@-@P0 D0p@/A-p`PV@A 2 0 D03/@V0 !bPVVlSPV VD6P~VzVoRpR@R5pR[Op@-`@P0 H0p@/G-`pP]V@ ݰ0 H@04/@KV ˰LbP>Vέ:VṳP3VᲳ/V᮳P'Vᦳ#VD墳PVᚳV喳:pRZpR@R5pR[O@-l0@L0/p@-@VPb ᄰ[0L03/PU`\@RT tU@j<0U@UcU_pupRjGpR5pRO[O@-40@P0/p@-@UP*[ L#0P03/PU`\@KT <U@2<0U@U+U'ppRjGpR5pRO[O@-0@T0/p@-@UP# 0T03/PU`\@T {U@<0U@tUpUpqRjG@qR5pRO[O@-0@X0/p@-@\UP ܯ0X03/PMU`\@T ̯CU@²<0U@R: kPR2RH._PR&R"ЍEsRjsR@R5pR[OA-@ Pa0 ax0A/O-M`p@P؃R@$ 0 x01/@oR `*PaR]Rܯ PURԯQRЯ PIRȯERHįP=RἯ9R帯ЍsRsR@R5pR[O@-0@|0/p@-@%RP ᥬ|0|03/PR`\@sT ᕬ R@勯<0U@RᄯR倯psRjGsR5pRO[O@-U0@0/p@-@QPK| mD003/PQ`\@;lT ]Q@S<0U@QLQHptRjG:tR5pRO[O@-@0@0/A-`@QPA 2 003/PQp1p "_@QL@Q@<0U@Q Q]tRtRjG5pRO[OA-@ Pa0 a0A/O-M`p@@؃eQP  0 01/PRQ ҫ@EQĮAQ @9QḮ5Qt崮 @-QT@嫮(QH姮D0U@!QᠮQ$圮ЍtRtR@RjG5pRO[Op@-@`Pl0 `0p@/C-`(pPP@\ ~U0 01/@PJ{ lPP^PtZPPRPHNPPFPB ЍtRuR@R5pR[OA-@ Pa0 a0A/O-M`p8@<@PP0P !0 01/PP I@P|P ,@tPpP @hPdPpH@]PT@ۭXPH׭D0U@QPЭMP$̭Ѝ>uRkuR@RjG5pRO[OA-@Pa0 a0A/G-`pP؂.P@ ᮪0 01/@Pz ᜪPPᎭ Pt劭 PPႭOH~POvOrЍuRuR@R5pR[O@-G0@0/p@-PO@=n _6003/@O`._T PO@FwPO>O:puRvR5pR[O@-0@0/p@-@OP8 )003/PO`\@(T O@<0U@OOpvRjGBvR5pRO[O@-0@0/p@-@qOPT 003/cOP  ZOp@جbvR~vRR@-0@0/p@-@JOPT ʩ003/o `70 01/Cp-^x O@CACD= }@C4C ЍC.hRR@RR@-0@1/p@-@CP.T 013/CP  Cp@ꗀRRR@-0@1/p@-@xCP 013/PiC`P `C<ߠD@YCؠUCԠpĀRR5pR[O@-`\0@P0000 q07/ 0 0 30 ¼ Ѝ^A-`81Pp@000&C  ᦝ}0 ᠁08/Cr ᔝPCᆠC傠PBzBhvPBnB<j 0 0 30 oЍ^RR@R5pR[OA-`p@P30 p0A/G-`(pPB@ QD B0 A04/@B > /PBP!BpBBU`B BJPB}BH-PuBqBЍ8RQR@R5pR[OO-@0Pbأ@0 @0b0ЍO/O-$M`pPP؄KB@ ˜`00%!0 1/@4B4 ᴜP'B Q奟"Bᡟ #`BᙟBᕟ `B᎟ Bኟ `BჟB`0PAwAHsPAkAg$ЍeRR@R5pR[O@-<0@1/p@-@AP2c T+013/PA`\@"ST DA@:<0U@A3A/p蘁RjGR5pRO[O@-0@1/p@-@AP+ 013/PA`T  A@4@|AxApׁRR5pR[O@-0@1/p@-@fAP 013/PWA`\@T ֛MA@̞<0U@FAŞBApRjG;R5pRO[O@-0@1/p@-@.AP ᮛ013/PA`\@|T លA@唞<0U@A፞ A剞p[RjGR5pRO[O@-^0@1/p@-@@PT vM013/P@`\@DuT f@@\<0U@@U@Qp踂RjGR5pRO[O@-&0@1/p@-@@PM >013/P@`\@ =T .@@$<0U@@@p RjG3R5pRO[O@-0@1/p@-@@P 013/Pw@`\@T m@@<0U@f@b@pTRjGR5pRO[O@-0@1/p@-@N@P Κ013/P?@`\@T ᾚ5@@崝<0U@.@᭝*@婝pŃRjGR5pRO[O@-@}0@1/p@-@P@`qt ᓚj013/@`b< ᄚ00T@?w?p@ rRR GR@-K0@1/p@-@?PAr c:013/P?`\@1bT S?@I<0U@?B?>p)RjGSR5pRO[O@-@0Ѝ@/@-@P?`3 $0a6/@?`#t ?P??@KP|?x?ЍpxRR5pR[O@-@0Ѝ@/@-@P^?` ޙ0a6/@N?`| ΙPA?=?H弜P4?᳜0?寜Ѝp跄RڄR5pR[O@-0@1/p@-@?P{ ᝙t013/P?`\@kT ፙ?@僜<0U@>|>xpRjGR5pRO[O@-M0@2/p@-@>PCtT e<023/>P5f  W>p@L7RPRR@-@%0@2/p@-P@>`Jt ;023/>` ;< ,@>>p@dRRR@-0@2/p@-@>P  023/P}>`\@ T s>@<0U@l>h>p装RjGɅR5pRO[O@-@0@ 2/p@-P@Q>`t ј0 23/B>`< ˜!@6>ᵛ2>p@尛RRR@-@0@2/p@-P@>`}t ៘v023/>`n< ᐘ@>მ>p@~=R]RR@-@W0@2/p@-P@=`K|t mD023/=`023/=P?  0=p@%굆RކRR@-0@2/p@-@=P&T 023/=P   =p@RRR@-@0@ 2/A-`Pm=@ 0 23/@]=pp ݗ<PQ=КM=@̚PE=ĚA=1RPR5pR[Op@-@P0 $2p@/A-`P@)=p ᩗ0 $23/=pwh ᙗ@ =ጚ =8刚@=ၚ<A |jRR@RR@-U0@(2/p@-@<PK|T mD0(23/<P=n  _<p@TꭇRƇRRG-@0Pb؂)0 0bG,2/O-MЄP<@G 80 P d `,23/@<`1< " MP<Q< @< < E|<x<:`q<m<P0Pd<`<HߙPX<יT<әЍڇRR@R5pR[Op@-@P0 02p@/A-p`@:<P ẖ0 023/P)< ᩖ@<ᛙ<p嗙 @<P@厙 <D劙@0U@<კ< R4R@RjG5pRO[O@-@R0@42/A-@`;PFw h?0423/P;p6gp Xd0T@;K;DGx@;?;;\RzR G5pR[O@-@0@82/A-`P;@5 &0823/@;p%p uP; ;@6P~;z;蓈RR5pR[O@-@0@<2/A-`Pe;@ 0<23/@U;pp Օ4PI;ȘE;@ĘP=;Ἐ9;帘ЈRR5pR[OpC-P@`؁0 @0pC/O-p@;Py0 ᛕr0 Ѓ @R05/P`;d ᆕ а@:x: t @:l: h @:`:P\ @:S: O Ѝ!RBR@R5pR[O@-#0@D2/p@-P:@J ;0D23/@:` ;T ,:@"SP::p^RR5pR[O@-@0@H2/p@-P@:`x 0H23/s:`@ @f:b:p@귉RމRR@-@0@L2/p@-P@O:`x ϔ0L23/@:`@ @3:Თ/:p@字R(RRp@-@P0 P0p@/A-P`@:pw ᙔp0 P01/ :pgD ቔ @9z9AuKRoRRp@-`@PL0 T0p@/G-@`Pp9;l ]40 T08/9p(Y JV`9>9:UP949l0T@9T@)9H%D0X@99$莊R GR@RjG5pRO[O@-@0XЍ@/@-@P~9`  0Xb6/@n9`x Pa9]9Dܖ PU9ԖQ9ЖЍpŊRR5pR[OpC-P@`؁0 \0pC/O-`pPЃ19@  ᱓0 \B04/@9| ន ȠP9ᐖ 9 ጖P9ᄖ9 ဖ P8x8HtP8l8h ЍRR@R5pR[O0@-M@ P90 P`Ѝ0@/@-M @P0`8p'X I 0``r7/@8pG 8 cP8*8p&iP8TP8HD0TP88$Ѝ-RKR@RjG5pRO[O@-0@d2/p@-@z8P T 0d23/l8P  c8p@dRRRp@-@`P0 `h0p@/C-`(p@J8P ʒ0 h01/P88 Ḓ@+8᪕'8p妕 @ 8T@垕8H嚕D0U@8ᓕ8$叕 Ѝ蛋RŋR@RjG5pRO[O\07@-@P000[0 l23/ 0 0 30 { Ѝ0^T0@-@000B0p23/ 0 0 30 cЍ^@-@/0@t2/A-`@7P#T E0t23/P7px@Cp hp3V7&7@"U@77RjGRO5pR[O@-0@x2/p@-@7P 0x23/Pv7`\@T l7@<0U@e7a7pRjG1R5pRO[O0@-M@ P0 P|Ѝ0@/@-M @P0`A7p 0`|r7/@07p ᰑ P#7ᢔ7l垔P7ᗔ7D哔P 7ጔ 7刔ЍHRdR@R5pR[O@-@\0@2/p@-P@6`Pt rI023/6`Ar< c@6V6p@Q{RRR@-@*0@2/p@-P@6`Ot @023/6`@< 1@6$6p@갌RΌRRp@-`@P0 0p@/G-`p@6P 0 R05/Pu6 ĀS@h6d6pG@\6ۓX6ד@P6ϓL6D˓@D6Ó@6忓RR@R5pR[O@-@0@2/A-`@*6P ᪐023/P6pxl ᚐ@6ፓ 6<剓@6႓5~R0R5pR[O@-@S0Ѝ@/@-@P5`Du f=0b6/@5`4ex VP5H5DDuP5<58ЍpERaR5pR[O@-0@2/p@-@5P5T &023/5P'  5p@ xRRR@-0@2/p@-@5PT 023/q5P  h5p@ꭍRǍRR@-@0@2/p@-@PU5`t Տ023/F5`< Ə00T@:5Ṓ65p@ 崒܍RR GR@-0@2/p@-@%5P ᥏|023/P5`\@sT ᕏ 5@勒<0U@5ᄒ5倒p RjG0R5pRO[O@-U0@2/p@-@4PK|T mD023/4P=n  _4p@TPRlRR@-@,0Ѝ@/@-@P4`N ?0b6/@4` >x /ZP4PP 4D@0TP44 Ѝp胎RRjG5pRO[O0@-M@ P0 PЍ0@/@-M @P0`q4p 0`r7/@`4p   PS4ґO4tΑPG4TPőB4HD0TP;4ẑ74$嶑ЍŽRR@RjG5pRO[O@-0@2/p@-@!4PT ᡎx023/4Pq  ᓎ 4p@刑R#RR@-b0@2/p@-@3PXT zQ023/3PJ{  l3p@aBRbRR@-;0@2/p@-@3P1bT S*023/3P#T  E3p@:}RRRp@-@P0 0p@/A-P`@3p5| &0 01/3p%@ @33A괏RΏRRp@-@P0 2p@/A-@Pa0 a0A/A-@ Pa0 a0A/p@-@P0 2p@/A-@Pa0 a0A/A-@ Pa0 a0A/@-0@2/p@-@-3P ᭍023/P3`\@{T ᝍ3@哐<0U@ 3ጐ 3刐pRjGR5pRO[O@-]0@2/p@-@2PS uL023/P2`DuP f2<\@2U2Qp6RQR5pR[O@-(0@2/p@-@2PO @023/P2`@P 12<'@2 2pgRR5pR[O@-0@2/p@-@2PT  023/}2P  t2p@ꪐRѐRR@-0@2/p@-@d2PT 023/V2P  ֌M2p@ˏRRR@-0@2/p@-@=2P Ὄ023/P.2`\@T ᭌ$2@壏<0U@2ᜏ2嘏p4RjGZR5pRO[OA-@ Pai0 a0A/A-@ Pa[0 a0A/@-Q0@ 0/p@-hh`嵑u0@Tp003/P mP ᠑2@{RR0A-0 P ?z`O0Pp@T0<13/P 003/PU ak\0@03/0813/P@a`R7RRp@-P`@T P@p0 13/P 400S {10 pxu`RA-PpP@X0`0 0 a06/p`0XSH00S N1U0  v`0000ʋЍxu`RA-`P@81p ḋ0 23/(1pp ᨋ@1ᚎ1<喎@1ᎎ 1A 剎8RSR@RRC-P(`,p@0Z |S0 p01/0Hy jP@0[0W@0O0K|@0C0 ЍC=iRR@RRG-P8p`@Ѓ0? 00 p01/0- P@00 @000@x0t0ЍGꤒRŒR@RRA-`P@f0p 0 23/V0pp ֊@I0ȍE0<č@=0Ἅ90A 巍RR@RRC-P(`,p@*0 ᪊0 p01/0v ᘊP@ 0ቍ0ᅍ@/}/y@/q/ ЍCkR2R@RRG-P8p`@Ѓ/I$EGy>ICL7@-@Q0 00场0P03/0Pl \呺!Q  Rk003/ Ѝ0uM$EGdRwRRA-@P003/P`u묠qQ @0V`p@-@Pp+P ᄆ IRKdR@-@01003/Pw01@-@m01003/Pd01@-0@0S Y$@T$@lxu`@-@L@dp@-M0P` 0000>U 0 00@*00 0 03/0t4 T ЍpT 7"kR$EGdRRp@-@-0S TPP  P (\P尹lqp@^eN R0@-M@00Q5/Ѝ0@-0@01/@-M @00S `0\ 0XX0匹T0 0SHЍ@c00Ѝ@/N$EGdR!RT^:R40 0S(L@-0@0 1/T^:Rp@-8Mt0 @pP04000`0P$0  C 0 0` 40 30 8Ѝp^1`@- 00CЍ@- 00:Ѝ0p@-@000P0 P0 0S8,>m!QpqRR@RMC-4MP`P\@ 1`p0,00*9t *X0p0 0`6/*`$$ P@P**P|*>v*Pn*>!>d*tP\*ۇX*Hׇ,0 ,0 30 ܣ4ЍCЍ/^RR@R5pR[Op@-P@0 10403/00Sp p@%/xu`Rd0p@-!0STjP@0 10803/$00Sp p@/T^Rxu`R@-@00XЍ@/pC-P@`؁0 0\0pC/@-M@p`Ps0( 0  p`t01/Ѝ@-M@p`P^0( 0  p`x01/Ѝ@-@p`PJ0 0p`01/ Ѝ@-<0@0`0/0@-M @P/00P|R5/Ѝ0@-@"0@102/@-@0@102/p@-P`@ 0 00p@/@-@0@102/@-0@02/@-@0@102/@-0023/@-0@02/@-@00Ѝ@/0@-M@00R5/Ѝ00@-M @P00PR5/Ѝ0@-0@02/@-0@02/@-0@02/p@-@P0 00p@/p@-P@v0 1p@02/@-@`pPg0 0`01/ Ѝ@-M@p`PU0( 0  p`01/Ѝp@-P@C0 1p@02/@-@`pP40 0`01/ Ѝ@-M@p`P"0( 0  p`01/Ѝ@-0@02/@- 0@02/@-0@02/@-0@02/@-@~0@0\1/@-@0@10h1/L00S @400S S@-P/1`T^@-PM00L00@P  QP @H0 L0 30 G@P PЍ^00! "    # % $ ' & ( /T^@-AP 8:00@" ! #  $ % & ' ( :qvNT^A-0Ml3hs@0,001T3$0L#L@HHc|~4#4<2 L0 30 P0(0@n@@<0S 0TS D0T 00@00@0<0@ BAQC0BSh Sb SB0S>!< <`P@D$ [<ꂵ0 C  R  B  QAV@ D$0Ak$0<0 0@@D0 0 0S 0S R#H 0 0R < <0 @ @0 D D00 {0S 0P A0S 0S 0S D X@ TЍ^R$EGdR˧ROGħRXRp07@-P000@DQH1P  0  0 0 30 1 Ѝ0^RO-@dMpP0`E V'ڜ1WFb$pF0pG.00  sW pG ϶0E0PE0SdЍ`000`0E4 Y0,0!*^ *;0 ,0R0:00J04 P : Y:pG PY0* Y*^0*  0`ꫪA-@t10 00㲿0 013/ UPP `H,qF"/o b o VlöXP N 0B"QP0000000`v᩶PP p `X *`  <0 0 30 b00 {Ѝ^RO-4M1圁0,00U댑`ሡ@0 p0@0 DWSF p; R6D"D R0UP he d#D   $c~d00D, P0 0  00 bedd00@IL0 ,0 30 nHRdd8 4Ѝ^ѨRRIYRT[OR//@-@@-@@-@P A0@- 03/@-@ľ@-@@0P000 0 0 0 30 Ѝ^@-@P 00P/cp@-@PU  !. PPp` PN@-@P F 0CH1@LP*@-Q10* S1 !/ /᫪UUUO-Ѐ@IAtPAT0!03@p&*T` 2T@!`0U - IPPY 7 PX A`aP`BOGQA-P0@0` qP q003qײ Px.0Sb` 0 bP 0P10!0 @-P0M@`0000p0000 0 ,+ 0S  06vf0!R 1P 00 0X0 0 30  P R  <,bQ Ѝ^0@-P4M @ @ 4Ѝ01@-@0000SQ)))0)D)P)\)h)t))))))))0!e1 0 309 f` 0Z 0 N    x l ` T H x< p0 h0 \ TЍ^RRʲRRRR RRR+R=RNRYRbRoR|RRR(00S   R 0/00`00S 0/  R 00@-S@ S 0 P0 0CoVMA-@ p 00`0PPUAЍ/PP``V ^P`0`p@-@ `0P P0PPUpc^P p/ 0 0 P /0P/ 0 0 P /0P////0/p@-@PP`v(Pp0S R Pp 0 0V T 0S 뷳R wR@-8M0@  0400 p0 0(0$ (000  ,00 嬌P 0 40 30 )8Ѝ^u`p@-XMl1@ P0T000L0 ,, 0 ,eP ,P ,,PP , 0@S! ,| `P V*TЋP D0   0 0 @ 0 QP ?40 T0 30 ΐQ XЍp^u`(07@-S P@ύU 804 0000w@P Ѝ0 1 <0 30! Q ?ZFP 0p C ~ 0  [.Z0$$'Z$&"Z@ЍAZ X xZP 00 $0 <0 30@Ѝ$&. ^~RRcK0`RR[OC-dM3PC0\000P0,00400[P ,0808 0)K~RUչRv`8)R)1RZ)R`)BR 3)RR`2)R@% R)hM}R G)OC_:4QC_P)RRR7^R9NRRv`v`v`@-,M0@ P0$00p0 @ 00 0@0p@kP 0`V@@p虄\a 0` V~(0 $0 30 ֊M~,Ѝ^dv`B)M0@-@P0Ѝ^IQOVRR;RYRxRp@-PP0M000 0S0) 00ÙP @0P 0P哉 `VT@ U(0@S $0SH0 0 30 ܄$0S@ 0P 0rЍp^R$EG)RR V0`0@-,M PP00$000 0||0z000 0P@T@0 $0 30 tP00,Ѝ0^EjN$EG)RR@-@P Ѝ@Ѝ@-PЍ@-ЍO-Mx$@ ph14P@`000述<04$q 0d! 01000@00Sd0 0 30) B 0 00 000 0X 0@00L0 RddbC 0-pv`0@-TM1@!40L00Pp1pl စ 02/0 40000[([ [U40 L0 303 u[[!P 0 [[ [[[ [~[{[|x[tu[4UTЍ0^R0SRE_#RRRR RSS*RNJQ@RvRjO8NR=KR2Rp@-@0 PQ[0 L[I[ 0D[ 0?[<[9[6[3[0[-[*['[$[![|[tp 0[hp@[SSpRR6HRRlO!RN@RbRRRRRRRR3RORfRR]OR0D/v`p@- P@DD@pv`p@-PMh10L00P@H ,@D1,@,0800004080H0 Qa 0S,)Q | @0R   ĝ0 ,Z  蹝0 ,Z ,#?0P8\@,?$0 L0 30 tPЍp^1SRcR>RRQ,00S 0 0So@//t8`8^ D0 0S 80@-@,(0P0@iZgZ8^,`2Q,HRRC-M3@Sp000`(300$`T`h3`V`3`+Xg\@TXa\P"(C0S pW3!Υ넁0S OP P |0S ʛX⊲PQt-t?p0W0?$ L$⻃$X@Fo@ p嬃E S@<t0T0嫙0< X⺈7YW 1!01ψ@ptQ)0P(:tE8 t<<8,t0P D!I7t֎0 S / tp@r0 toQ 0PVQ0PXLTQ0Pᕃ:L0 t⧃f^,`,`h9`^v`,`hD_R+R$EG?R Rp`AR_RO-PP䀟p@0 0CH0 0+S0S ត00@@HH0S0H00H  C R 0S0CH0H`hhH0 RWU 0H0H0$0 R ` ,*  Yd`v`0_jRI0@-M1P 0 00000  bU0@s0 00@P 0 P 0 |0|0x St0 p00 0 01 0 01 00 0 30 sЍ0^ C_t)J R$EG?RRv`R)JsR|)J@1@-<000,AP `1>0p0  pP0S 0?o2?"WuP000s<0@Z‚P Tl0P 0 30 r0SP .00 Ѝ@6 0 30 Ѝ^;R8^v`GRSR0L/v`G-8M4@d,P0400 t42A렄xL뜤J똔V맠c$0M04N@ x4x$@ x>d4d$`4` \4\$ dT4 PLH4 D0<4p0440D0 @@_N4$O4 04p 04030303M3 030303 @00M3 03 03030303O3 03030|3 @0@0Nl3 h0`3 0X30P30L300QN@3 <043p0,30 @ 3@M3 0 3p0302 @02N2 02p0202 @02M2 02p 0202020P0M22 P0202p0x20 @l2AMh2 d0\2p0T20L2 @0L0WM<28"0442jL0LI^2 2 UpR`P(0$ $@(@,@ڋ$ ?q"S ?k0 40 30 {q8Ѝ^v`!gYhC_ C_pC_lC_`R l``@ `o `V_L}`r)gRq)L|RRRp)Rq)(Rr)0RRR,`Xq)ODRRRHq)Ts)RRR<^8q)DRVRRGRXv)Ou)RRR(q);RCR}R@^q)GR=RTRo`q)jR|RRR,`q)WlO̟)CRRR|8`Ȋ)RRARrRD^p)RR_RRC_()QRRH4`XR4`cRnR0SO- sMQ3@c`0(0 000 , R30SPP P}T/M0@ *0H  8 @0ST0SX|0T00`0 30S 4|00 _T0HeK0PbKh0S|00|00 S 20SڠnUlUjU0倀 Co X00S P 8/HM0 Pb0Y 2 K|T0 @30 CI0HxT0HK K qp $0KK0000@ ~p;0S dNKc p 0SK_|-  0  P0S 0C R0 0 0KKK|K KK|K=|p@ PKc\@KcX00S {$0 (0 30 p K,`^!gYo`wR[Ov`h`{R!_nO@w`L0p@-@0P00P PꉔP0Pp0P,`O-4M81@4a 0,00JP0$X$0=0`pH  H P  P  T  T H@P@T@@X @5+x)x'x =$ J\0 ,0 30 oxxx =$ I4Ѝ^,`l9` 9`@-p0,M@P`0$00;t0 p0000 009,0 $0 30 {o9,Ѝ^1S@-(@P堔P|0P@v`|8`t_`0@-@0 R  Q 0+ 00( A Q ( t08\ 0XX0X00S C 0S  Ѝ,`|`t)R$EG?RRv`R,`//0,00/s@-`R@P  0S*`0\ 0XX0σ P 7:呔,布V000Ѝp]R$EGHRRR-l0@- 000 !P:r0噃$0 0 30 nЍ Ѝ/^Rp@-@P0 p@[OR7@-@P    |  0S l0h 0d0dYQ T0q@ 0<00,00 Ѝ0@/[OVRR8RxRRR$EGRHRR@-@P ̭P@ǭ 0S/0@-0 0 (R$EG$RHRp@-@P0 *P 9 000pER@-@`0 000" P 1p00  00 P p 0 P  0 p 0 30 n Ѝ^p@-@P`  @Pp p@A- M2@P00000000  !0 %!0  y u q m Pi e `V K \ X" 0CC1 00 $`(X9# 0CC1 00 0`4V4<`V $ 5 1@`V  ( $$ 0CC1 00 jdV|0 0 30 smp  p @  Ѝ^s@-@0`000PX TP0 0     $  ( ,0 0 30 mЍp^[OuR0@-M0P@00000000   0   PU {  0 0 30 lЍ0^@-M0@ 000x0  o   c0  0 0 30 lЍ^l0s@-@000000P`  0 0 0 30 lЍp^0@-M@P l00 000P u0  p0 k0 0 30 wlЍ0^0^@-M@ t0 000000 N0  I0  D0 0 30 PlЍ^@-Pd2LM`{0D00TP q7P ɑ  P@2  D'|" Ʌ 00S @W7屑 ׀<0 " x ph1 d00HH1 ,{,40Q0 R 00 0, 000,0 s   P4 pP ,4p,000S@6M @sc0 D0 30 kLЍ^R<^UJJHRRReRRRARRR&R[O}XXR_R@-400lR//0Co/`0 @-@000000 SPI0 0 30 wkЍ^@-@0 >PI0 @-@3PIR  厅RG-~M2M`@p 070Pណ 0RE D   $q0S j `V   0` ܑ勼bWE0`4弑XpI<0S `}.H1 00v | ?@0S `HX1}. 0 f < /D`H( Vp+` CPP >0 0 7 30% j - 0    " 0   }> 0 000$ 4 ~ލЍ^RlPRRRSRPQRP/@-`@PT $ 2p@  f` pT<  0, Ṅ0S  Ѝ@ Ѝ!gYRH-MP2@ P00 000S,211 0  00S` M p  ' 兄 偄 R{ Ru$ Ro Rti( R `c, R L]0 ` v, S0 ` l I4`V  M p  ׎ 50@T  M `z  Îp ! M0 0 30 iK^(Rh^WQ1Q5RARNRXRbRnR{RRRR@-@#P@@-0Ow`R80 @-@RP0+HTa~L^w`RO-M1a@0 00 h ?3S0SP01 0 30D i P 9/pP RR VR' MR/  0 0pS *  /p 0S@ @  0p ?R@@ @ 0 0pR}Ѝ^w`L^R0C-`P@000Vpp P0 0 30 %i h*  P [*   Ѝ^H)C-0M  㬐@R ;t*  p~P 0Sc`p00 0@}R$0 0 30 hЍ^L^w`O-4Mr`0 0d0X0<2\h0,00 X@@2 ,0 30} ha@p@!MRP&'*? &HpP (*2 (^(0000 0ST X000( @#R0(PP0 T 0 CR8Ի))4)t) fZ[X20000 0(00?}P "0R N P 00#03R 030"S  > P 0030#R 03 |4Ѝ^w`L^R$Rp@-P@   op@-h@0s\0X 0TT0|2S004@g0 0sЍ@L^cR$EG$R@Rw`0@-@000/\ ᒁ00S@ 3z ,|0 0 30 gЍ^PJRO-AM 4M@0 4000 0T|P/0@/S &`00P @ H`P,FT ꪒTLsL3` @s0S cP B|00i0`̢Ȳ@00@ @0$@(@,@ E  RKTV xA>@03D$@@2P  |0@ $P 004A P EP (E P @@ s xrt{0A@S#DP{Qw,e?00S{ 㞕fe00 ![Z0SE{POEKh GLA9> 0 4 30 fAލЍ^rRP^w`L^RRRRRRRw`[ORRR=RO-4M`@2 Qp0,00#PYl h2(PU T *PU `W P1`1 F ` 2 ,0 304ЍQxYE{( p 0 I1 ,0 30_ f0'P   > 6 p$T 0:PT*PUW 0P11\R 0 T0 0O R*[^ ! 0! 0 M0 00P00 T *[0[ p11 0 P` Xp0\ 4ЍO`z^bRmRw`RL^H)K-`MX1@`0 0 030S4 R0p,$ K$0KRP=P00M 5U(0K$ KZP' (00P003/PU 0(  0 3/\0 0 30 ev0(  0 3/PKw`^H)@- G   R  ()R@-@c  X)@-$M0`000ぐ01 宯0S@p  ᭤0 0 30 ne@T IPP  E00S (  Ꭴu$Ѝ^RR@-SP(1M @000QP2MP y,VP0Q00  q& g&  pQ !A40 0 30 e0 Ѝ^R//R0@-@0R@-@O-Ѐ@IDB~tPAT ! 3p@+*T` >#T@!0噄0` U00 i IPPY d  PX A~`bP` Ѝ>COG/MЍ//@-:A-Pp`5ty@WT0S RP R <A y0  0p3/#AmRR 0 AKR)RO-@5-p`pGPUV+1 P P 0-S Hw@`T  X D0 0 30 wb40T0 ,H Ѝ^\RgU}RR!&LɀYRp@-@PU 003/gp 0R 0rS#3/P//@-vR@-vR@-@|%0S@v0SY0 $0S ^v 0SBRaRRyRP/+ 0@-@? @w`R 0@-@? @w`.Hp@-P1PM0L00 [P 00 @$`P-@Ҍ? ҐT ˌ뵐 Pƌ 0Ɛ0S h彌ʐ\U롐<0 L0 30 a뮌@b᷐PЍp^RRR0+w`0 2w`08d^$0 @->P@Evw`R$0 @-1P@8vw`R$0 @-$P@+vw`DRp@-P@  hop@-0vR0@-@P0S 0C #11 0 0 ꫪ*0/0P/( S @-SUUU 0P/( S @-S ꪪ UUUP/0s@-`/oV0" 000R x0F@0SP 00 +0 00 0 30 aЍp^^EGp@-@Q0P0   p@0p@-@PQU  R 0 0 000p P P 0@-$M0P@000`0P00p  U  R f0S H00  0 0(080` K0 0 30 `$Ѝ^^EG@-KuR@-@ P ATP AN@J0 @-\  @\@ 00 00p@-@`PTpP@G-`P0U 0000PpEJAtrT0!03@*T 2T@!0 000 0UPWPEP A1P0BOG/w`<0A-`dp`@WPP @@\Pw`00 d`0Q/@0\/w`p@-0S@`D Tt00C QS8tP|ZP_UPUpvRRd0G-Pd``@TpTTV @0  @ @@@w`RkN[Op@-8M0@0400000/S`pvsQ P 0P0000C Sl00 0 B Rp@00 40 30 _?t=t8Ѝp^RRT0p@-P0@S <E0  BR {!!!pw`1RXI,0S/A-pP@8000S,0@T脁`000S6 `V-,M00$0000040000<0 080 LS'P| x 0Sh T0 $0 30 _i*'P< , 0S s,Ѝ^FR@*}RRR$0@-@0S 54 $  d74$7-53#03|5#7#7@0#p@03@53#@d53#@^53#@X53#@R53#@L53#@F5@x0 Z5l3h#@@`95\3X#X7T3P#P7L3H#H7D3@#7834#47t(0 7t0 7 3#{73#v72"q7"0x$ "p  `@ @@'62 $ 02a02@020052 $ 02a02@0|20 05p2 l$ 0d2a0\2@0T20P26L2 H$ 0@2a082@00@5$2 $ 02a02@00@51 $ 01a01@0 0@50 ,0 30 Y0Ѝ^w`C_$S.#SoR|*SR8P C_R*RhC_ R|*R C_*RGS)ySS*SD-*S%S+SD2*SS 1*JSD.*,OS-*.H*SH-*HRS8-*aIIHS,-*VS`*LN)ST*SSP7*SS)S)SWGNS@)H S) S S ) S!gY SH S)/ SD S S S)R Sh SS.S)2QYS%SJSd^H)nSySS)SS>S)ySSS0@-DM0P 0<00 Yn@P  $Ji@00 |0 0$0R]0^␙$40 <0 30 7Y⅙$RDЍ0^S*O-3-SM000@fV & 0Ch#C3  ~X\0@`84tt0 0\0&t\\tt0 0 \0&t\\tt0 0 \0&t\&f||\V  &`0d R02 0 30b X@ ) \\Pt7D0Mt D0 'tV\T{D0MD0 }'M(0S { P `0p'&P Ly& 0<S0SDh ,g,!D @`ЍOP&t\ 1&wt\ 0 30{Ѝ^w`$ShMGO4SAY<SmSiS[OXE_KOODSO-pP44M0,00V `1i0S#S@@M #0:PP t2P  @0/S N||0 iP0$S1@ TP D P 0 P  P  P,0S   0,S 2 ,0 30 W먲L@T #P!^  0$ !Iq$$'P P 0 wp 012S CM@z Rl$O S5MHl 0(0#(L($ O@1@P- 60hPK@T0S   0,S #P!  0$ !p$0(0#(($N@1P Sh (ll( 0PRlk1Ptb(04Ѝ^!gYC__S@)PL(^!HnJSiH.#SpLSS))S)S@-`l1P@0 00``v `00081001x0S/ f`X`$v 0@H0000 0B0v- @000000@000T0 0 30 V@ WV Ѝp^xvJw`ISCI0}C-M41Pc0 00P *PPk0 0 30 VЍC @Sv 0 @@D0S0000@0 0 30Ѝ@.^TSp@-P@Tp``D@<0$ h`O-6-UM0L10@}l6 00T|"L0 0|0#||0 0(|0#||0 0|0#|}% P| 0 0 |0# X0 0|0#|$|0 0(|0|#x|v#s@pG`:" 1 L1 30^ T!(@1&""V""0 1 ??#`!0CCV:(2"dq```P 0 H B0B!&# "( o"⿓PY|VUߍ^nSSSSB)MZHUHPHӟGHG5USSSSQD_v#MzRHhD_!&Lz7R,O[OSS?OSS@RDV SSSO-`2TMP 0L00Ux2 L0 30 cT-je0#S! @00@@0,"6pPi.P 0S 1!01i0 P. 0P0H?o20S 0/Sl刑刡刱,0 ,R00$e,@p PrpW 0,S  P  P, Pa$000W 0$0 <0 40444@p:Wz\:zwTЍ^C_!gY1S)S$EGyRJS@)SiHSnJnQ[Op@-XM0@0T00000P 9K&`0 %;<0  40 T0 30 S ٓXЍp^w`SG-P1000:P QfV @@@Wd`:l1 0 30 bS\ЍGh0 0m/`, qX!50$SP`0' +P@0 JdP@0SPEESd@@d@ PE1X00&"h0(0'#x080 @U@d0TLgp$0 0 30Ѝf,^Sw`_`*SS@-0 @0 00 0d0h0 \  d0@0d0<0d 0 30@@ R0 `6Ѝ^d^w`G-XM 2`r0T00d `0S@T`0d Rf@Sh1 T0 30h R@0P PP 10S  |80@00P 0U %0  4$!0 <bQ< <3 nP |0 $tb$ z$  P"080v l00S  d ~@ T@ @0R(@@XЍG:^w`Sw`ZSTS_`S1@-$M0000P 0S Dc@0$SP hf`pLP_WP 00 P+c0@=SS f60=SP`?n*P`@P "SRP'u :8 P$`X0 0 30 Q P@$`<Pu $$Ѝ^SOSS_`_`OS   吓C-$M4C43000wp0S 70S 0S$Q񟗔**$*@*H*P*\*2 0 30 Q$ЍC77,Q 7 |(t( ,Ri `74 0RiRi D7<Q8 Rd(78 R<d?B(77@0S7D0S 7HQ 0S 7LQ 0S 7Q: 7PPTX` 0\@8 t!0 0p+ V0H!  08 p79 P&0 0 30}$Ѝ}QV7S7P7L70 0v+w`^SSSSS(SPSsSSSSSS SNJ8SaSSSSS@BSS:S`SSSSRStS@-P0M000* @vP0 0# 0S y9` P@0S8Ptqe0S EP%0S <Le0 0 30 PЍ^w`SSJS@-M1P`000vp?9& P@U P w UP e0 0|0 0 30 pP 0S000#SD@T`P 0, 0d3/@Ѝ^y^{^w`R0 0S @-ew`USO-P4LM0D00 0pSd$0 cR 00 00S * T4 D0 30 PC0`VXN6($o@T0S`(X EP$k260S D'P  (6# 01"P 0 PS R؀Ѐ:0 0 05/50A S *D*P***** * *@ **x * *!*5rP.s 550S P 0  h5P0!U0:P rzH51 003/!0 5rrr 003/5h!0  (#xt5 0S Q *0 0ЁX }5z5!0  ( 0d0! !0 00R 00cx) z:6rT5@ LЍ^kS4`kSSS(^SSSsHS1SMSnSSSSSI,PQ5-PSS#SN^HTyR3S]SO-$M<2p@44000000 0T@ bT0s{∍1 0 30q N}7 d / 0R 0R  0Rt@QPPP P0  4PU QP`,()PUzP`P}!0Q  0Q00 k0 P00`@} )0 4 ) <4@:}$Ѝ^SS^`S  Q  / I-LMH3p`P0 0 0TKrLKrTVT`0X0 DKE`Foobr<Kr䂟@p0:S $KTP)FQ,Kr@pSQ@p XQ4Kr@4qXK X04  .4 40@b@D0 p 0<0`00XX0 XK 1 0 30o MAV@ $KPTPX, ,K$SV $KPT{PJ, ,K0ZV>$KPTn`:,K=r4K:rA00MP; qPn_01P <D P @ P  < <KDVV$KTP- 0bXK K^`SAQSSS@-M0@000hx0 00S 0`A3@Gv BO@0 0 30 HM@A`Ѝ^d00S/0@-M@ 0 AsTP $a Ѝ0@ w`SLx`O-p2M`0|00040@ᰐ蠢88PtV bP0SB400*  0sVtp@@p0$   Y a10S 34b`HV40W   w k0 SCP< PX0 C AX!X0T  D?  4?Y P0SEXXH0 P@@0 I"||0 |0 30 L-P PX0 C A\ X0D OTDD-Ѝ^8-Mw`Sw` S^`~Y_H.HS6SR[SS@-@`PT 0S p#P 0 #ЍpxP p` 0U0P0S@ @`<xP 7hq`w`iJSSJSRJ0@-@XMPFT 0S  P 0 Ѝ0gw`0@-@tMP+T 0ST0@tH`g@`P 0@P Ѝ0w`w`SC-M2P`000UP@ 0SIip0 ^*TdpX4; WNdp`T@0,08( S+P< 8< @D0RPT8 1)/1z#p##%px/x100#!*dpWT3`@ @pp@% `(`@0 ,0+P 8< @D0RP 1@#QDU \ C,0 0 30 3KCЍ^w`,SQNKQ'Q{SRSS@-4MAP1`0,00PU 0S 0 ,0 30 K4Ѝ@G1,pP 00 +\Pff(` (H0 ,0 304Ѝf00w`^SA-0M<1@`0,00(1 R 0S|_T 0S 0 ,0 30 J0ЍA0,PP" 00 ן[pf@PfpF` 0pu@0 ,0 300Ѝzf@pP-^w`RS7@-`@`0|P000U ]q|PW Ķ$0| 0 30 eJ Ѝ0w`^@-AKU@> Lx`C-$M2`0002 0SZ r@。 |P0S7UmPI P^THE po X>$Bdp`PUx pp p2pV `pP00 ^o0 01 0 30\ J R PR! Rx @! R  ^D^:>0P 0S10PP%UP,>@T00%>@TU ᣉ(0(0S 0| 00}^Pbo(p@`P 0, 0d3/@@Pfo$Ѝ^ S: Sy^!gYo S Sw`d^!S{^ S S^` !S$EGyR Sp@-P@_00 0SU 0P;^p@*w`Q!S!SG-p 1(M@`؄0$00P 0 S0 P0EZ Ḧ0 $0 30% \I E#P 0  S 011 \0 1 B Q  00 >{(Ѝ^O-81@-0Mp@S  ?k$ 0]/P0 U  PPw.  ЍO]   0 E 0` p 0 {YP  A 0 `b&P`Ѝw`!SOGO-,M@PP h4` ؅0$00`D 01p2 0C S ;*L;*;*T=*<*<*T=*:*:*:*:*=*=*=*U>3 $0 30 H 0 1",ЍO.B>Pkx3 $030h !0 !D30S (> ?#0 .0 00S 2 $0 30Pp 0 ,ЍO3 003/20S =. 0 00 S \P~*,2 $0 30 ,ЍOz.=1 $0 30,ЍOm.10S =@ 0j#0 [.t1 $0 30Pp0f X10 S =@ ?L#04 =.0 $0 30Pp 0 G=0 $0 30 <P 0P=. p0  000u 00 $0 30,Ѝ ^(^!S!Sw`!S "S3"Sa"S"S"S#SO-@`0V (000| Mt@FP  + '0`(0C1K0`X%POG4@- MX0@000k((0 0 30 kG Ѝ^0@-M0@P0 000x000Ѝ0@O-\MpP0တ00@060T00Wx6 T0 30 8G(?X(H&@0()`P($[ !P (0,00/S,`(( X(` PZ (,((0S  ( 0,S pz Pt\ P k,0 0A00# PZ,0 0L0 P#"L,"444\40880040a8 (,(4h nP#"B(0"/`000+S 6S3 'ShP #0X mMP #0M`  ^p`# 0|x2[p30S d,#  #Lbo00P #0! -# 0 0 0( D0<0<o<4<0=3`,0 00 M,0 #4q44408800408i( D0<0<><4[<4\i P- ( W#(" 00 ("_0040#r44088004085430e=(0S  ( 0,S 6 P 0S1 00Z0 000k8 4<Z05=8<R4\Ѝ^!gYC_1S@)SnJSiH-#SPLpLlH\HyRw`5#SdL))#S$EGC#S#S@-h00 00  00 000 0 30 kEЍ^0 \ 0@-@0  000 O-@4,M␔P0$00 e$ ; 00R00000 S` `L0000 P0 2 h+0 0Q000D`F`FV0S0S8 R+5S 0S J+ QA`;R0lp0V00 P 00S ++0]ip`F000 " 0R 0S +pp` 0C"C1Sp㌢!0CCWJ:0S  P|q0S 0  / 0 0 ? 0  0 0C *0S 1`00 0 {J g 0_p 0```gt0 y_/01 0 00S `000  0 `_0 0 00 0 0NS /0p00` 0 000~0#b00 ` 0`@0@i40 $0 30 2DiM,Ѝ^w`#S[O#S$S$SX$S$S3$SB$SM$SA-@P`  $(,048< 0PV?0S` U 0aB`VF*0R0 00CS` `Fc p PaW A` P\`P 00CS` `FcP 0Q P A`P\` P4>(<? 3A-pXPG@aE!1/o b [U$x!PhjWP  0BA QPUC0E0CC1Q$ 0!! P( G  p0W0S0P0P\ 0x <p `W A ` 0e%h&P`( 5#R0諪@)\G p@-0M0@P`0,000000#,:$!$ P `+! P ` b `(T(0 ,0 30 B(K0Ѝp^p@-M0`P000@\\ Xn\Pf\40 0 30 B\Ѝp^p@-@`PTp@P50@@(0"D"E00!D!E00Sp@-@`VP Agp@PB@-px0$M`P000@8}0 ,,0 0 30 {B#똿$Ѝ^@-@P A6p@-@`VP A)pP@-@P 3p@-@`VP ApPO-M1P`000p 0$ 00 00а嚁Z$b0 0 30 B 0T 00| 0 t0僁 0aSʬTI$G(0 3/T$@>Ѝ^aIIV?I GP]`?I?IG-M0Pp`0|00 0܀ 00 00p̠OY0 |0 30 A 0L 00x 0p08 0`SLݾ03/L$@Ѝ^aIIV?I GP]`?I?IO- J4AS̫AC`HT!3@*TP T@! Wa P  C@ @ W A@@ @ ЍPU Kh뉾0OG0@-@0000P/5O-`0FC1syAS@!@3@p!*TP 2T@!aP0 00Y  B S0CX` A`QPB000OG0P/~ 0CHC1@LP*@-2Q10* S1 !/ /᫪ O-P0` m p F @00   s o0`h0C10G#P0 Ѝ誾T p뿾mOGO-P` _mpRF@   < 80`d0C1\0G#P0tT :Ol뉾몽KmOGO-P0` (m p F  @00    0`h0C10G#P0 Ѝ5T -Jk mOG@-@|0Mp P @D0 00 `7/P @D40 0 30 )@ 0Ѝ^Q/A-@p P`UЍ P U  E  P Q@-@ R@ @ R _G-PQ`1 BU@C\* U@!@1@*Tp T@!_p BR i A@YPPppPp\GMO-MPp<0`01@ 0 000B?àZ& `FoT 0T$3#0@`D<0 o`WT*V$H0 3/P 0F@?`HT$IY!X"PY# @(0 0 30 b?ЍOЍ/^0@-0$M@ P@DDA0 E0$Ѝ0諪@-0ЍO-p 24M@0,00` PFU"1XEQ$pE Ȁ$H#p  0`X H0 0F `F SP1 ,0 30M ? 0 PE% F  P  P  P  P P 0 tP 0 E Pk P BZ:H0 ` YP  o4Ѝ^p@-P`@@0 Sp"20p@-P@ḭ@p@-|@p@-P8㪭@Pp0@-P0@ "@00ƒ /0@-P0@ "@0O- 4ML0 1 4 `H 0(0 0H 000 SL1 (0 30L M>@P?ou20S  R@ 0Su ?D0 H0pL0Ə000@0 00P0 @0U00 d& 5T 4 0D0Pp8 P0< M0 ጟP<  Ѩ 048 K^C-@`p  P02P Ѝ2"R R R 'R ? 0M- Ѝ/- //O-DM1P 0<000@[ᚯC 3S)p sr) 0`  R  ? 0 sr0 0 㭬00 000 <0 30' |= 3/P(,0$0 0 $0 00ይP  ,`)! SR pDЍ^ 0@-S@ P ``33/ Ѝ@-@@rp@-@P p@Y@-0P`,qpV 0Rp1l!0h1UB @0CSE 0p0S(  (  00 CBP 0  0% @0C#S$( 0$0SP(  (  00 CB\ 0  C C0C`0p0X00T00P0 0L00 Ѝ@誩0S00 0 0 QK%S$EG$Sf*h*h* %S$S@- Q 300 S@k*$k*$k*$k*$k*$k*$k*k* k*$k*k*k* 0e 00YQ Ѝ%ST%Sn%SO-@`P QE  p2  \ 񟗊l*k*l*l*l*Lm*Tm*m*m*k*k*m*m*PQ@@30Y  0Z  0\T X U@ P@W Ѝ>p=pQ p30W0 0G/00 "W0 0 R R R0 0p00 00PWQ0 003 0AA0 xQl0h 0l0 30bjP0( 0DD0a_] GTGG/&S$EG%S&SD&S%S%Sm&S Q@-X0 S1 H0"D 0@@0P0\ 0B RS Ѝ8&S$EG%S&SA-p(` PU@P0 A0@-$M0@P 0000CAT0 00UPS S    Q  BC#01(0 0 30 u; $Ѝ0^}'S$EG&SK'S0  /^0 ! /^ 0 0 /hx`^0 " /^hx` !'S 00S !!'S (S !9(S h(S@-@ 0S00 @-@0C S S 0 0S(  (  00 CB\  P/@-@- 0@0P!cIQ00000S20/p@-PQQp(@B`  $ Tp0!p@ (S(SG-@0P 0P G 000 0 R 0S G^ G ]0p0 00 0`00P |!ad la  \0\P`X ` P804! VbL )S,)S(S(SS)S(S(S(Sp@-` @@0P!}05=] p@, V[O1)SG-Pᤀ`@ 0=@S00( Rpp@ 0 -@R   R04#@ $p t'@0Sp$MO-`ᴀpᰐP 0=@S00 R40 1 012S @0=@S0040 0 0  0帼0S@P$M(^A-@ 81P0 00@ `0 H衼pX4 P`npP' @g`!0CS* { 00000 0P,  ,  00 CB\  0 0 30 9Ѝ^0@-M0@P0 000S $P L0 0 30 9,0 0 30Ѝ0@Ѝ0^0 - l /4`@-00@@@8@0 4/Ѝ4`^@-,M 1@P0$00p1` 00 00 00`0PS000  0P S  0`00 00{d0 $0 30 .9`ppQ E P000,Ѝ^1S!gY@- ML0@H000H4 0 0 30 9 Ѝ^XE_XG@-MP)S0@-$Mx0P@000j`  %\0 D(0 0 30 8$Ѝ0^M)S@-P `@ 0 QU{*{*{*{*{*z*{*{*@{*{*{*{*{*{*{*{*{*{*{*{*l{*{*{*{*{*{*{*{*{*{* pR:P @dQ\'  0 P@ud0R Ѝx0u0d0 Ѝ@/@LL Ѝ@A Ѝ@{(*M$ Ѝ@14`d LY L)SGp@-0M1!P0,001A`1!x1|!00tPwl1h!00TP_T1 P$0H1@ 0@1`081P001,1 ($0 1@ 01`01P011 $00@ 00`00P00D0 $00@ 00`00P00D0 ,0 30 70Ѝp^l*jI)Spx` M-Sd*-SC_-S-PC_-Sp*.So*.SH.S^p*t.Sp*}.S.S^tp*.S$p*.S)/Sdp*T@p*/S/S@- ML0@H000JG4 0 0 30 7 Ѝ^XE_0S@- ML0@H0000G4 0 0 30 7 Ѝ^XE_-0SP0@-@0 @0@ 008*0ۑ뫴ЍXq*hdq*xq*@-@0@Cs@-P0@0`ὑp0 l 0h0h000S  @OwЍpXq*dq*hxq*p*@-Pt0000 0  PS!`P .40 0 30 57 .O Ѝ^C-tM844D`0l00(\0PtP P0 0/S@0* 0 <P<}SMxU lU TU0 dU(02 MU$ Km0E S0**`*****H*****(00(00PU 1P G(00(00(01(00V0 SR(000 (001P@_vP <00(03/NP 0@ RP<,.<jMT# E0S@ 0 Cr SR R S@0 ᕻ p@f_P0 y5@(0 000CS׼p8l000(0 0/V4)VVk8T@08p庼`(00000 7/물 00S ~{x-`d0 l0 30 .6<-K0OS]8JtЍ^^4`>0Sc0S0S0S!gY0S(S0S[OU0Sp@-@PU Rkɱp///@-@0$03/@0$0/p@-@P`003/ 0p@0/p@-@P`0 03/ 0p@ 0/p@-@P003/p@00/00/00/0@-@0^1S@- Md0@000 08003/J(0 0 30 5A붲 Ѝ^@-@ W$0@-@0 0S t1S@-@Cvp@-@0MP` 000 ]501 !  00 hZP0p 0 30 O5 Ѝp@l 0 30Ѝp^0 0 xp@-@PQPpp@v@-_"Pp@-P`@ᅻ0$03/ p@p@-P@x0$03/p@0@-`@p0000S0 0 30 ЍPP p PP E@@p,0 030 4 Ѝ@^(@-D0P PV}1S@-@+0T 003/P (00S @%0T 1^(0@-@0P 003/|2S@-@ i0S 00S /1^@-@0T 003/P (00S @0T 1^00/1S/@-@:-H0@- 000 $0 0 30 ]4Ѝ Ѝ/^0 @- 0 Ѝ*0Q   /1S@-@厅0p@-@0P Pp1S0s@-@000P 0`S ss0 0 MQ 00 @P _s 0 0 30 4Ѝp^p@-@ P80P0P0 0p1S0 0/|2S//0@-<0 0 H1ST0S(O0@-}0 0 H_1ST+1S(O@-@ᓯ0@-@062S@-@ワ0@-@0&L2S@-@s@-@T$K I<@e0s@-000000P`  U  R pm0S@ 00 0 00 0 30 o3Ѝp^^EGp@-@$P(`V $P ,A) 4p@#P0@-S4 "0CCQ   H0 003S4S3SG-p1(0000S !G(P`$0<PER@EQP  P$<7(P,0@U @00(P d0 0 305 3$EIAt+ TT0!03@*Tp 2T@!RBp0 0000U PXPEP ,A࣮$pq(P,pЍ^;4S3SOG$000/0@-( ^ @@ $ 0 0@-QJ$( @@^* Q D0"@ 0<<0cG 0 Ѝ4S$EG3S4S// C@/ 0/G-Z e@G `0P4p`F @- 0BS 00000 Ѝ0BS$ 2R!!7 r  $ 00c 2R!!7 r   00cS 1170s0R B!00s000400 0,,0B000000/:S9ST9Sx9SA-HM3Pp@0D00 |,0P`xPP P X3T#0P3PA,P @3,#0(3<0@  BR 3#020mS000408S  $P     ^$P8 0R000000C S B01P0C 02PP# 000@Sꌫ** * * * ** * *********ī************P*l*x* * * * **aPYPR@/d0@S\@>0 0  0  000\   0000000@=(@ P000$0 D0 30 e, HЍ^|x`_Q$EG9S9S:S&:Sp@-(Mx0@P`0$00@ 0T wP 00mS 00 0 $0 30 9,(Ѝp^|x`@- 00vP $0 00@ Ѝ:S|x`_Q$EG9Se:Sp@-M`P42@V0002 0S Q(6 CR Q0CZd(sL !Q1Mh1 0 30R +X!QT178144 LL$d|| d`a|_d]L[4YWU`PŨK|IdGLE4CAЍp^:S:S:S:S:S0@-@`1$M\!000PB0 00  P0S 0s P D;0S P-;|0SmP7;U 0 0 30 -+$Ѝ0^:SA-'O!`ODP0 ScSP00- 0d PcT T0@d t@@҇Ѕ@SP2:SP3P>Nl@EevJ,0@-@_PT @Dx` @-@0CS  00SP(  (  00 CB\   @p@-P@pp@-Yd0@``*P@@0@ @ PUp 0 @ Px`:SPG:S G-@0CS 0pP0S(  (  00 CBP  Ex0P`VЍP@0H< 0880*?0 p `^ Q$EGV;S:Sp@-`@PM`0 00P @ p^A-P0p`@Pp0wl 0h0h>YPPP0H< 0D0p0 00`P Ѝx`;S$EGl;SV;S Q:SG-PR`pP@H T 0@zX@4P P P @ vP   P@ @x`p@-@PTpPp@DP ps@-`@ᱛPF0P,0( 0$$0w> Ѝp@/ Q$EGV;S;S@-,(0 $ 0 00b Ѝ0*x`*C_. \4/0FS+<** **H**$*H*H*H*H*H*H*H*H*H*H*H*H*H*0*n0p@/btfreaF04/04/0S V\V\4/x` 0 _S/V1W-L0@ 0S$@0000V1W/P/%40/@\A  /\  x`A- @PDP @`pP]W``=S@-鍭0$03/ᒭ@0$0/A-p`@PU 6PDPE`S@-L;A$ /0@̎'>SA-HM2p0D000 fPR 7P/PP3P( P@' P P1 P01᡽3<aPP bPP n0@s RSH*@*@*@*h*@*P*@*X*0@1 D0 30? & q@``V 0  8 @RA00@ P P P P@0000  0$``FV`@@V0 0$;눣HЍ^4*V1WM>SA-P$p`@@P0 0*A-P$p`@@P0 *G-`0Pp@T0 @0*A-`Pp@T0 @@-0@0 000P000 0 0S ژ5P5P|`P00`003/P00H0 0 0 30 %Ѝ@^x`t8`>S>ST_@-(@0S 0000<0x`@-@0</x`40@-@ 0 00   x`t8` ,0@-@ 0   t8`x`0@-@x`0@-8M04000 03/P P@0 C D ,D+(0 40 30 z%"뗢8Ѝ^x`0 /x`0$ /x`0 H L P /x`@-@0@$0/0/x`A-@PpP`0S T3HTP @00T0@^x`C-Pq`X0 @Y T 0@0@0 ⃐Ṑ@P0^T  P (P R(R  ^ R^:V`R RV1WV0W@-<oQP00 p@-@Pl`iV op/pA-`P@>Qp!@@ 0aD @7C 0`Œ>Ì 0!"0#`RPp@-P@ܹ?P @ `0<21P@p@Hp@-P@ʹ?P @ `0<21P@ P p@ H/ R\/p@-00S P@A0  R % .00B?@00xSlP0 Rp2`  >0 B   >W B ?9 V1WV0W>S>Sp@-@ 0CUp 0`0S(  (  00 CBP    ᗿp/@-$M0@P00000000 P` 0p/S pF 00 hl0 0 30 $Ϳ⧾W0/S0/S. 0 ᚾ$Ѝ^p@-@LP=Pps@-@P0000pd@ ;`PPV WV 48 0 0 30 #Ѝp^>S>SO-`<p 9P00@P( Z 0T/S:S/QQ00:Q0S @D 0 6G@`  - - ` 0 Ѝ@-@P0KM0$100 00/8RP0 00 0`p 0/` .J PC .80U@ $1 30 A# PKߍ^O$EG?S=SH?S0*@-@0< 08087,0 00 Ѝ?S$EGU?S=S?S0 \RR/Q @//\R/0R/S//R/@-Qh0d 0``07  Ѝ0^ /^ 0QQbEX$EG=S?S!gYG-P0@4 `(,p8\N  0R0 r p0Qpq1>`PF`0P2@b0T B#3#2Q \vE@T&d0PT :qY~ 4\ PEH8@0 Y  05i10$0400 1>`PP0\H9\sE#dP R*0@-4M1 A$0,001Q01 01@0x1P0p10l1h1 d$0\1A 0T10P10L10H1D1 A0@41$00,1 @0$10 11 $01 @01@0100000 $00 @0000000000$0 ,0 30 !4Ѝ0@}^hC_t* C_L*S@S@S@Sx`d*AS*ASASBSx`T*LBSABSBS CS@^C_DCSC_D*UCSCSx`xC_CTtC_4*CS DS4DSx`D^X^l^p@-8M0`@0400MGP |E?VT80 40 30 !KI뾞8Ѝp^TLO@- MD0@000j 00/.룞^QHS@--$MX0000<6(0 0 30 h!녞$Ѝ^Q@-`/o$M0@"000 Q R % 0 0 30$ F!  xpPF0ShṼлͻB$Ѝ^\DS}QpDS0-Q 0 0  O-,M`pP0Dş C/o"$  TSR0 00XG  VP\_U`  PYX000S0W 0pW(Wppf0:SbPP00P000@@PVX@ 0@00@X0P0@00@ aP @0@ YP @T [P PP00[S PZ P000@Q PT[  :[  R :Qy0:S p2 $0 30 ^  o[  Rh 0U UPa| 7P[ PWFX# *P0SPP0 P  0(S 0SpWp(Q 0 0 @'P" @0HSV P000 (SS 00R0SM0(SIS R R @  xP@P@R  QT iZPg  P@` 0P [R S @ 0,Ѝ^V1W5K4`V0W=  @ꎥQ FS 8FS pFS FS FS -0@-$Mx0@0P000O4  P0 C )A$0 0 30 $Ѝ0@Ѝ/^p@-`p0 M@P000+ yP0 C 0 0 30  Ѝp^-X0@-@00000 X$0 0 30 Ѝ@Ѝ/^O-pQ3tM0l00 2yWbNR`2YYNP@@20SJ 20SF20, Q 20,0)A%hbNhRY@걤P X2 X20RL20S  8<)0T("(S$20 0<0`O)붟 0 !  , 3/@,Ap1 l0 30T 9  0,0$00x咟T嚢0P\e 000`S 0Cs0Z@$  0 0S$ D @0@00 D S,T⯳<⭳X W S R  52,OA,T┳<⒳tЍ^FSWFSQX@^w`,`d^,`w`o`!gYFS GSFGSGSjGSXGSx`GS-L0@-n 000 $0 0 30  ЍЍ/^-L0@-y 000 $0 0 30  ЍЍ/^-L0@- 000 $0 0 30  ЍЍ/^A-pdS`M\3@0\00000T00 T (00  `x 00,(00XP ۃ,0 D0000M(D D,20S2Y|: @P<0S  AH20 000?0r0S$20S <0S  R10S <0S yꄞ  @}1R 0R !}, ^AJ@i|!|dl R`kP7<0S1 ,C`T V. K0RpT`P 0R ,V )P 0 0AjP0 \0 30 ,a_ԔTT '`Ѝx`^HSGS,`!_[Od^HS@^GSHHSJuJ=SHSjO8HS=KUHS@-00 %D^N@-00  ЍX^@-00  Ѝl^ -H0@- 00000$0 0 30 g ЍЍ/^0 R R0 @o/ 4//p0p@-@00`0 0 T 0 0>DP;0D R 0p0S  ?Qd^^ ,`@-@ P ;0S  ?O-pЀIqCQ0G@!@3`@)*TP "T@!060P 000W  B  S0CXp AಒQP ЍB0 0 OGA-@p?`?PMpMV0  RV \:0p@-P@P P P  0P0:@pP0 Q:P0: 00 00 @-@M`AHPr?0  p 0@ @@0WЍO-`pУC?=@??9PpP lP1K!01+aP ]P 0 0R \*QP @L ۺFP% PL  ЍOκT 0P P0 8M 0%1M 0$  *7 0P @0 M 0  ЍO$M 0  ЍO$  +IS$EGISHS`ISIS0@-0 0 *G$EGGGP/G-@Lp> 0РZ 03 00*`/PP  00 S 0Qhj*dh* PL%# 0H@?0S ?ЍIS$EGISISJSwJSG-PL@Lpn>hPj>d 0 R 0n 00@* `ЀX 0o 00L 0G!YZ l* 0>`PP`)xL@PtLT 0 ЍJS$EGJSISKS:KSKSO-M@p@D!> 0`P 8 0 % R I,(务ᡮ  y~P>! 0 0l T 0  P4 )R(, @T pZ!s@h>YZYP ^>0P 0ЍO[KMW0dPLLL!PP p@-P @00CS@ 00CS 00S 0@op/p@-@`=P= p@<P @-y=s 00CSl 0@o/p@-KPe=_@HKP 5K #p@/K@TJ0S pp@-P`L=F@H=B 0 0R 0R\ K` K 2oppp@-"K@(="PuP Jp@PGKP 0SZP (S KSA-0M@`000w 0p 0 P P ?V  R  PF?A P~@`ᘦPPe e 0U4VQ$0 0 30 Ѝ^p@-P`<@<  Q00 R\ 0 RH0S2 <(J`J PpLSBLShLSA-`20M@P0,0010|03/pJ@< 0 R Ra0 0S 00 <0S   0A@ D1 ,0 30I W' 0S 0 0 UP Q 0 0U P`  0@ '@  0tP0 ,0 300ЍAW0'  X0Ѝ^4`LSLS@-DM `X00P<Q*$ p40(0\ 0,0  0( ,  0pp-$,@T (0S (b@t0 <0 30 `' 8 <  <#@$ ! DЍ^4`LS'L@-@3\MpP p`0T00I Ip ; 00SD <D0@p ER񟗁0++++++++++++++++++++0++++ +(+++++8+L<@Pֲ`00 @D0P Z8P 0S<P8@c; 00Sr0SS $2 "027' 0D S|+++++++++++++|&xtplhd`VPE  B=@P8 ;{  B=p0 T0 30 V: 0@0@0@ 0c40(D  \Ѝ^LSLSIxMS$EGIS3MSiJFM*)S5S+gI3N5gILHS4gI7gI MS MSSfgIigIlgIogIrgI}gIgIKMSS.gI1gINIVzgIvgILMSp@-XM2@ `0T00:P H : 00SP` ,0<4000D8DQP +++0+@+@+\+T++@+@+(+@+@+@+@+8+<Pӱ <ͱP/ 0C0`,@0 040 AI(PM 0S,(@S: 00S50S 01,!0((1'&  &V 0 @ $`<@P :  $ <h0 T0 30 8V: 0@@0 B (X4 2XЍp^MSLS\OI7EJxMS$EGISMSYXSiJIFMMMSLMSO-M2p`0009P9 0@0S p` R3 SSH+ P  5 0 Rp@GS%+=/pB 5N p sX}GR R RF L SS    0 ReG<0 00SWGPRG ><0 @@?G +@@0 0 30 wS44됍Ѝ^KNS!NSOSlNSNSNSO-  6 6P   p  P  0DS񟗙)+)+)+H*+++++++++++++++++++*+*+kp e `  y@ t p` k@ f b= 0 30W  00S@  M@= T p C@  > :P 5`  -` (CPpCTP@@@@q5T< 0 30 0ЍO>PpP@@ 5! ЍO=CP. 9CPPP* P(~P$sPoP  00S4 @DnCPpjCT񟗆2+L2+X2+d2+|2+sP[P SU 0$TO-4M2P0,00\@@Y@P721`32- 0pа 0Р{xXP   Z@2 ,0 30 5 4ЍO#MP IP?pP K0J/o?o"2D Y@`@U@E?pP 0000 0$0(00 Q 10 Q 1`0 p0 p 00 4p @@_]0 ,0 304Ѝ @`@?V@@3@# ? [ ZOs 64օ^QSp@-PQ`r0@000 o(`U` U  Ep FG@-@P AX0PQP/2@o/O-$MpH@` 0 -@R h! RP+0 6# 00J0PP& 0=@S010S  0 >41i? @ 00$Ѝ00 0P PU0c>P1C?@  0 P`$MO-,MpTP`0@S. 0=@S0 1P1PEU"  @Q  P( I1P " 0=@S10 0 0 0\0 @`0@X N> 0=@S001PPEU,ЍPE 0 -@R   R. !!) =$0000 0100 00$ y?`\  X 0 !PE y  001$M CQSG-`pAPT@PW0P0@PPPMMC-P p\0000R  S #"  0 S  Q R Ѝ L \`` 0 V 0!0 0@ R{P` rM0P/ss@-pp&p@-@Pᒨ05c9=?0P-q p@ Gp@- MX1P`000/@2 P =: *P P0^ 00*=0 0 0    PnP0 0 30 (  ^à Ѝp^gRS$EGTRS3RSp@-@X8TP@0@pC-$M\1p000ePP  08P/0S: 1 !017@P 0 R @A` P p8P0  S00R0<0( < @p 0 0 30 9$Ѝ^RS$EGTRSRSRS Pp@-P@` 00 S$ 09@:p\Hp@-P@` 00 S 0p@9\HO-0s5800@<0PP 0|LЍ^A-MP@;.`V Tʠ}-6@+.`+. 0a.-P".p`-- p0 `PtЍRSSSp@-@P{k P $ p@xk% J@-$Mt1 P`000 0 @T 08!1 2 S$EV 1 0 30 i$Ѝ@B@pT% 0!0P # 0tVp1$Ѝ@&7d0! !0 0/P^(^8SSkSSSS0@-M0P0000@ 0  ?60 0 00@P /P44 0 0 30 Ѝ0^-NXSSETS@-MPS@,`X-0S 00S $aN-0S;-0wP0 00,P 7-P@s 0Ѝ@6up-@P 0Sp0\ 0X00S @ [0S RC^7Q$EG{TSTRSTSTSUS@-@,0S k,e 0P @o,0S ,0S @ PA-@PK,Ep<:`P: 0H|;, 0A;p@-P4,.@P,0S , 0@, 0p@"6 Ip@-@,0S ,,P, 0p@6 I@-@, 0P00CS\,0p`1 > 0D,P 9@ 00S Ѝ@ 0`, 0P<@+. ЍzPV,0S p+`N,@p, 05@+., 0, I@-P0M`p@000~0 ٜ P U 0x 1 2S g4T L0 0 30 Ѝ@o0 0 30Ѝ^(^s@-P@k+e0ESh0Vd 0``0B 0` 0Bs0SU K@iP+ЍpM$EGTRS2USA-d9@C+=p+0S 00S +0S 3/P ЍK+# 0 00S UP` 0+0 `P0 00S c9P`d+PU`껯GO-pA@Z-M @`+{P Y(+? @0?q0p0|03/@P 3pP  10 0O8@ XЍ *LU h@3pP  10 0-8@ XVUS4`pUSx0@-p@P003/`!00C0/0  d3P* H Ѝ4`x0@-p@P003/`!z00C0/0  C3Pt* ' Ѝ4`O-@p`s8R*L P0 NSR E*? 00S ]8N^ 0=@S00`ǿ 0 V P ` 0 0  [W P P0`#9 Ѝ$MUSUSp@-P0~S<`@P@Dᠢ@PᜢP P ppUSA-p`@) 0P 0Bs0S70 @`P* )0 Pz 00As0S Q x tRn 0APazQ }~0S~蟂~)VSTRS@-MPQ@  0/00 0)U 0S p`)!W`:0S M:@o,0 ᗅPP0 0 30/ )0S 0)0`P 0p0S) 0LPE)D)0S  )0 00@)Ѝ^@VS0@-M0@0 000x03/P|̀PU P0x03/<(0 0 30 & Ѝ0@ g^VSVSVS@-Q 7}}~O- @D.2  0$0P Ɠ$0@P  @Y  < 0RR$P X(S0 S P P b0S:@,@ U,P @x2 40 30:<Ѝ2 0 x@TxXx  0< W  ^1 40 30 <ЍO] W |(@P- 00 B?C|0SX1 40 30 lcP,P0 ,P  ]W@ M(`p-@> P 0|J 0 -@R  0 R !!    6"000p 0@Pa`F\^]S$MaH4`^S$EGTRS7^SaH^S,_S^SH_SO-M @p P@0\ L|\T!WP? \P  0, )  0 Ѝ00# 00 0=@S00000Y 嚹+`/o"Q Rȗ X@ P:R  P:RP ЍO( `STRSaH_S$EGv_S$M_SO-LM ;P@0D00P U /@: D0 30YLЍP> U` P $P  P 0 L ,], , `'@00 0     , z,r 00S 0Pd9 D0 30  0LЍO~ 00S }w 00S vp 00S j 0Ѐb,`hb @00CS 8(08< P,@[XCpLZ= 0 0 R R R-0 000S- 0 P0 P  4TeU  ! @@T@@  +7'0770|03/P 0 R0@` 00S` 0XpаI 0@ 00S& 0&@&p+  ᝙+  ᔙP6 D0 30 7LЍO  00 S ;6 D0 30  " 00S } X/ X KR[%R+   HQ P@@T" k+P2 _&@U+P 0KQ Q $@P xHPk1 [qQL[+ 0SP" ,+00嗾 0@``0 ,`&@C`,(V,x< 00 _+0 D1LЍO&R+ 0lD1LЍO&[*`@V ^0 Z  0  X(KP%1! ^0p"+?W` G 0gwB8CP0pw@W@h2 D0 30 0 =KoXP *!%@*00 0yXQ * 1 D0 30 0 X X1  Q\@X[1 h-@ 0 @KOoB*CZ3 @@@ P ^$ P ^ 0 D0 30LЍO0 D0 30 LЍO0S 0 HD1LЍODL000STT,^5`S`S$EGTRSl`S`S GTGG4``SaSaSMaSyaSaSA-P`@;* 000CSPp  0Pܷpٷ@ 0 0B0oCo #BoS^R^S^RP SQS0Cs0S\ X 0_AaSO-TMP4p@0L00` P0S CSoᩒ S 00 SS 00S 0=0S S m) 0 R 0P0Sh) @3 L0 30 TЍO, ᲼P 2 L0 30TЍO`0S P  /P 2 L0 30 |80@ 4owpP` 4Q8Q' @D P  Q# 0@# P$0<0PF 00S\ wl@ D 0@81 L0 30}TЍ 5P <0 0A($GsP<" p@P<Y 0b 0 (P& Q <00 p 0@ AP4^aS4bSaShbSbSbSbS,cSO-M7@P000Pp (@`0S P`br8l00CSg괘+0+T++++P(J-PB6 0 30 ЍO],^pb baP <6o8&0446*VIpEEP 0 (0SS H0PH080pP l$O $ ppp?0p Z0q~  3 # W # 2R  p Wڰ@0| i( 0 |0 0-| 0 jRPp' Xp  qh0hpXxbpS p0pp?0pq~W4p|000,00 0(00 0 VjP (0S ,0S  'ef 00|$00!4p|000 0 j2 ᾌP *'0  'p,0p 40 0S 3/rS P'@P"D'P  p@ 0`wk]%Pc] 00S \ 0@XR 00SQK 0f00P8 00LBL9 0P 0BQS00 LL0* L0 R G% BR`l0Vp0 `P`00P0 000l00 0L$ p0RS 0R p00 Ry 0P B x00 B!xPt1S l0寴 T% 5%Q 0P5%05 0 p x000000xl0tplS  ` ` Y0PJ;P P 4$04P|%U|W|V|PP$00v$0S;`00pPPpPP`P00,0SE nP<0, @T/420.|,x3 0 30 n,0G 00S XX0X0XTY  ᦉP 0 t到x010\0 00000 0nX \Z  0 s =0"J|⓷Pd+l+++[$0ST" 2 "Q 0 0uP [$0S T! 1!Q 0 80S lV80u Wl` P0d\^  L Lq00(0S L0< 10ꔻ@4呻 0L R 0 0Bs0RS~LL0( 0[ @@W0`0`Ѝ^0-J$EGTRS%eSeS!gY`QeSfS;fSTfIfSafSfSfS'gS]gSgSp@-@$tP`VP A=hpPtA-@pG00`00GHpPp S`C  PP 0  R  /@-@P A hO-M1P`000p 0$ 00 00а+Z$`+0 0 30  0T 00| 0 t0+ 0aSVTG+$E+&i0 3/T$@<+Ѝ^aIIV?I GP]`?I?IG-M0Pp`0|00 0܀ 00 00p̠M+Y+0 |0 30  0L 00x 0p06+ 0`S}VL**h03/L$@*Ѝ^aIIV?I GP]`?I?I       /O-0JC2~sUAS@!@3@pP*T` >3T@!J ` PY  UX A;g@b`>CPs  PsOGp@-P@TpP 003/@-@P AgQ0@-@A  ߅0/// /(/// //"// /$///0/0R0S/p@-@PU00pT gS %hS VhS hS hS hS iS @iS hiS iS iS jS (jS ajS jS jSG-P`p=LP@ @0@ P `.L0G S00P0SP@D 0P/|p@-@P@Pp  `0CS῁ 0` 00 0O-4M`P3d0,00000@\@Slг+0+++4+d+̴+垐 Q0CS*ᘁ  00 02 ,0 30 Z冐 Q0CS*ခ xy Q0CS*sP Hl Q0CS*f  _ Q0CS*Y R Q0CS*L E Q0CS*? p<PPE [ PP>80JS<`q P\Z8$ Q0CS* 哎 00 0 0CS 0 00x0X P T P0 1 % +Z|`U00_P0H\00  P 4Ѝ^zSzSzSzSzS{S {S{SjSIQ/@-8@0 S $ 0 @^jS kS P 0@T @DOo p B ZP P !  0@P(Ѝ^XE_K@-@Pt1$Mp000\T!&`81 0 30F $PWP #0S P(A`P #0SGP 00S xyp 0뉲P /rP`  $Ѝ^XE_lSIlS@- ML0@H000N4 0 0 30  Ѝ^XE_lSs@-@(0SPPSPU 0`t03/P80*4 0000g0t03/dЍpemS$EGPmSlSG-XM`P1xp0T000S@P $ZS$0S)0$0+ 00 h `! `H1 T0 30K _@ 0 P "0S #0S =P 0$ X` 06/p0 P &P0 p03/P0 iP Q @dd0 0 eeXЍ^XE_LOImSA-p P`@P0 Ad@-M0P`@0 00 P " pR0  0Tp07/ 00=P 77(0 0 30 7cЍ^4`C-`x1DMP@0<00딵UL1H!0DD1r0sS  1$ 0+ 0 00 <0 30DЍp ! P 0 <0 30 DЍC! 0 P <0 <0 30DЍC` 0 ^nS$EGPmSmS4`0b0C@-@SA+P++P+P+(++P+P+P+P+P+P+<+P+P+P+P+P++P+++ 0 Ѝ@0000 00 000000000000 0 00  SKPmSO-`<2U 0@0!p1>! 0~ P0 0а000[0 0t [p0 0` ;`P  0 `& 0`0S- 0 V8(08 Pp% p dW Gp 0G0SX d0SR ,8[ 0 30j08 000ЍOJ 0 30YЍO0S^ ).0S 7'07 0 d1:@ ЍOpW=`  0 0 0LH0$0g0S6 0 30  00 Q) P e0e 0E a0c00U S0 R  0 800P轔O8 0PP)pS S!:  0 8000彄0O8 0P0 00S@ 0 / A a1<20aP` Pd0S px0`S 5$0 5 0 ᗧ4 0@00aXY 8XP0 8(J!P ¯6 03 0 30 W0@03 0 30  K dk%80S0P0pW0S 8WpPp pုP 0 `0\X22 0 300 d0ЍO/0SL2 0 30 ЍO0SM Plᙪ 0`ppط|80< ||l|}!R05%l |f|rl_]| |zl|z$1 0 30N  p1R 0030HЍO<84!8 p  0 C  09T0 0 30  t+,0 0 30l ЍOe^PI5gInS$EGnSPmSyXTLO4`,OoSnSD_mJS{G)oS/oS.W!gYoSC^-P)H}QrnSynSQ{IXE_LOoSO- M`p,2@ P0(0 00 0 000M?P  0K 囟K9TPK0K K00KK⯟`P+ 00 0PJZV㬠K Kp0K00Vp0K 00K0 09,@ǝx 0000t0P0C|D H0R H0 H L}vaKaK2@0 (0 30 ?aKaK%X\ K^    /,y`C-4Ma@1쁟0,00!0`@ԑ;`P0 Q0` ! 0@7Pp0p ޹hlq0P ׹\!?XɹD!?8$p$p 0(0 1 00P 00`00@00ʻ0 00P 00`00@00庻0 `~0 Px 0 ,0 30 4ЍhC_^C_oSJC_TfY C_oS,y`pSSUpS^+pS+pSpS^+pSط+pS/qS^`qS<+pSrS+O-@",M`p $ SP   5 T2J"025Y000S% TxH-0YP  00  0q  0T"$ qQp  c"$pXmH000 00 PX P  yY D  @ 0H YBRB:0CS R Hq0@T:,c 1 $0 30: PZ\!Œ| Y  q BJX  q;a^[Q 0W tb NZ,Ѝ^RQX$EGPmSrS\GiJ FGrSO-,MP@\0pX`01P0$00T T @!Gx@ 00 0 @$0@D0@UT1 $0 30M tAY 010# 00?0@@ 0 IR !P  F 0 %$  C#T : 0S0 0DS:00T 0@ H0pP0 @0 0,Ѝ^O- M 0p`0 00 x20(0 00x0 冡 c0vP 0 S0!| K x K  0U|@ 0įT0 0xD G00v0#   00 M0` y>P G  0?o2T0S0 @KlT+ 0R?0SS  00     h` 06/0SY 0 (0 30 tK7tK04K\KE0K\ K@0HD0 l@KMw@KJwxP Y K^4`XE_rSO-CM@P41p 0@10$088<010㶦Pt` @@2  !0@- 400 0,,0U?x ? ЍK~S$EG}SX~SO-dM0 $0L5@0\000`$00 5N%050 0QT0a!1>!R0*4Q$04$0AT0!1>!R0*4S$0|4 0l0<0$0 l0L0 0 x0D0$0 x0 T0V4 \0 30 -<00L00 p?ď 0?(00 0`,00,0 090 00` 00+0yp\ (0Z000#03S(00 p(00000000SI 00p? ,0  2 "U  00,P0, 0 Z 0 YP,4^0   R0Y4\ YPQP l 0 h$0h0% 1!01 0(  0cW# Br *0C30c 0  G0" JphȠLIǠ| 1 010p 0 00ꪡ穑 * $ BR  0 00 0h 0x0p |0H 0X0!pP `F P @dЍ^~S$EG~S}S~S<SSSS6SPStSSP/P//#//$//#/L/p@-@FdPXh05 p@-@hT/@-cS'R/0@-S뻀S0@- 0 00h ЍK~S$EG}SS/000//010/-^Q //%//&/0@-S 0 00o ЍUS$EG}S S0@-S 0 00] Ѝ䦁S$EG}S{S//07@-S(LP@U # Ѝ0PiP Pd0S P0L 0HH02PW Ѝ0@004 S$EG}SS0S/@-Q 0  00 ЍJS$EG}S S/0@-S 0 00 Ѝ䛂S$EG}SeS0@-S 0! 00 Ѝ䛂S$EG}SS/ S/{`H00H0/s@-P0S P0nL 0HH0@`P0 0N`00 PЍp S$EG}SS07@-St1p!0l1lS00P@0S00S 3/ PPᶞP ᱞ0S᫞ 0dPPᢞP$ ᝞ R0S 0  p0\ 0X0S T0!< 080႞ 0 Ѝ0@9 Ѝ0^S$EG&S}S|SS40p@-P @TpqP @{`C-M0`0 00v0p PU0 0 30 b  Gw@P  j0@ q?P PP gRЍ^{`p@-P @j00 0 @ p{`p@-@PP  @p\@-@T 04//@-@P@/0@-S L0H 0D0D0 R 00 000 ЍS$EGS}SV@-^ \0X 0T0T ^ @0, 0(0   Ѝ/cS$EGS}SVA-@Pp`P6V ẽPTp-V ᱽT@-1@a 000_pPW0  P`UR P0S S pW T ჽP P :V00 0 30 xP /VQ Ѝ^{`@-00P QRAoQ<0Z8 0440 B 00 Ѝ DŽS$EG}SS@-00P QRAoQH0eD 0@@0 B 00 Ѝ/DŽS$EG}S-ST0p@-P@ 0P0 *_h0h0h0hS oTPpO-@ 0`44ע 1p@Z@TNN@0; 00_PP0Q^Ϡ  Ό >ZQf@E@V d 0D011 0 F f36@S  ό, "   0s ЍP刁᥎aG-HM|2P`0D00P Pҝ @pW W2 7 2l Wu1 D0 30; W W; WhUPVP# 1 A@P0` @ 0]@` W004 0`@41 D0 30HЍY  >=HЍG,`@嶪0 , 8 , (0 0000 0!@ `,ND0 D0 30HЍG8$ ,<+P^`2 bSWO-`00p 4 XP UR0 00놱 K@P ЍP ?@P ?  P@80nS$EG}SS 0@-0 0S2000? ЍO-MpP@<8@@`iD I 0i00?0f00@1>001Z@NN@0pqpP  pP$   ⪡ၮ <= RAd T K kkn [ 8l^7\8P !KO-0p`@ ÏZ ЍP  T00  ? R࠱ P0* V? 0\ P#PO-p08P@`Dj눍00 0) 00@ 0@oP0. 00!oP 0/ 00hh  QsAl a0`l0`0x x ЍOyS$EG1S}SSŽSO-MPP@`<0@8pHP 0Q 0 0 0p0 9Yl PlPAQg0pO8p0x xЍOGx@-x1R.0 Q>! ЍP {`O-PLapZ 0P 0   @ B  L0PPTPh0Pl0p0t0x0|000 U  H  P! /  Ep 0 @U0 0C0 R BYP  AJpqPp0 {`OG@-@!000D07@-P@003/ A? 0㘴 Ѝ0@4`@-@៏ę      C-p1MBP000 2 0  `V#  V00@'  0S Q U 0P0W ᒒ`u ⸇ @T0 0 30"   0儀!0 `0 000.p 0_!d01 ` `Ѝ^ 0@-` $M 0p P[@0@UR0#`!P00 ?$ЍA-p`PF@w 0%S@-  400P0 0@ 0 @DOoB @SO-@P%pV`<Pᓗ 0S7# 0(0+ 08% P 0 @ ` ,3! k 0 KK@3A @ $8 Ѝ 02 `2 JSA-p`@P 020@-P-@ M 00 S 804 0000@H P Ѝ0M$EG}SSp@-`P@ qpp@-@PCP @pp@-P; @(000pp@- M10000 0 00S S P1L!0HH1v01 0 30  . ` 0P ⵷ 0S. ∅ 00Q0 @ 0 0 30 Ѝp@!0 Y 0p1 Ѝp@^!d0!0 0$  2  Ѝp@^ݏST}SSQp@-P@P00 @phA-@Q@P00 ` 00P* Tp@&P !0Sr`P`00 PЍ7O-@P0U 0000P pE`0 0000U0 0C0ZJX  AG@a`0 OGA-P41@0q 0 00PP`PP00PPPP`UPEp0 0 30& P`FFaV `FSPEe V*0p0HZ ` HЍ^{`s@- D@P`P=Ѝp l{`5O-M0|0005%051@R| x0R d5P%0L5p l0R @5(%0$580< 0 LP0 $c#PЃ#``0004 |0 30# 70SpT 0P 0 ` ha瓏 0 p`SPp004 0PH8`/ 35#03 < ^gP 3E#03 A0PS0 0[?P P#]0 0R0:S=0 `00%إ#:#`P*0S 8py  sKH0MJy <p\*p2 d`\0h0`0h`x`Q:S P8)JUPZ~1>!01 ` ᜠ 0 \m\j `P \c\}00S, d\S S 0ᘥ8 0\D(\A \>Q PP \5`V\.0S `0 \p \kDGS h0S c03/x 7Ѝ^L$EGS}SS6SwSPSSאS-`1SVKSM}QM7NM/MmJsHSQS7Q9S0@-@ qlp0@o0p@-@P d 0CS00 T00 1>SQpplx0@-@ Chp@-@P&R  pdS0A-S@ T`iPhp InP0P0%%&@&O-P(p@`0Ѓأ  (p 0ЍOJG-p0P MS@0 `004 @X0p\ @p0@4pt Ѝ"X`%\ !ʍ! P0@-@ @9p@-@PI&R  GpdSp@-@PPGPpPpUSA-@PP&P 000CST 0P`_ 0p`p0` P$Ѝ@-@P֗ 0 R R 0@,00|03/P @@4`@-P@@+p@-P@`T! pT p0P夗 00Sp@-@PP0 000Sp@"PP0@ 0 0Bs0RSPP]p@fP P`R p@!f0O-Sآ048p"P`8@0 0@PP0 40ЍO@$)P0 ЍOm (~S}S| x0@-@R0 Q uE4F00CS/JLFJFx|0P@-04]0#,Ѝ@Q020SN0S0  0=@S0`20S& 0! 4P HL0T @##X0\ 0 0P`X0\00ʏ⨁኎ʡT0@!P! 0 ,P 0  <18!04140S 1!01@ 0!Z>։0 pR00S 0 t@004 pX0\ p0p4^X@%\ !g! P$MґS$EGS}SޑSP0@- 0 Ѝ0s@-@0000Q0` PH  H P2SH0PP0H0 @yP<0 0 30  kCЍp^{`0@-@0000 0 00T r PD00@,0@ 0 30  BCЍ^{`{`Q/A-@ `0PH0CUU BuU001` cP A(B```000`00CUK 00BEp@-PT0J P0@P000##$$##0 0 S r   h`T0h jllxxT LLPP vLPUH00H00S00S 3/ pA-PPTp`@ 0zP0 t\0P!@-0CC1QP`,(Q}A@{{`!S SCS 1@-0000$S3pP@$W``00@ S_P' KP$$WV 0000 0 30 ` `00V00  Ѝ@0 0 30 Ѝ^O-@P@10AS1 S* S2 /0^ @0^ L\'0AS S S 0\0\0 R0\/0\/0 R/@-0^0^O-Ѐ@IDB~t-PAT0!03@p&*T` >3T@!c`U 6^ IPPY 1h PX AK?`bP`>COGA- MPpPpA\ \@ l0 0 30 ]L`T  NL] Ѝ^A-pWP@``W@@-@NN1NL^*]-Q10* S1 ! A-`@APDApWPpGRp@-@ `PR  ApQ0@-@A  ]0h0@-0@M0BPPЍ03h00 P : P*X>0EP/T ᔨ[S@-0doT0Sh0p@-@00 0S QP h0 00p@ 0/p/p@-@lP0E0 0D0S DT@h040Tp` \h00H 00 0p{`tS0P/( S @-S/,,D$II$ 0P/ss@-!,,7@-@P 003/ @->0p@-@PQU  R -]0 0 000p P P 07@-@Pc0 _ Ѝ00  /{`P0@-@000<0<    0 0 30 Ѝ^{`S,0p@-@P0E %DPp{`O0/H0@-@000h00003/ 0 0 30 Ѝ^l/ /`0 \0CCQ :00q/0P//h0 R (P//// 0CC1P\0/P0P00 S0/@-Q0@000 L0SP0S h0-0S 0000000 0 30 L&Ѝ^L//@-@h04 T 00$0SL0aH 0DD063/PX@ 00S  ЍԓS$EGSSS@-(M0@0$000Sh04 Ph0d 0``000 03/  [ 0 $0 30 9(Ѝ^iS$EGS9Sh00/0P/0000/ /@-zS0P@-PL 0  BR40@(0@-@00000#"0ܖS{`C-`Qh1MP@0|00``B \r41hp`pL \0 0d0h0x0$L0H 0R 0 \  h`D06/0\1`0PS0h00 0x 0Rd0D`p00d0h0Y[\40 |0 30 DN[\=Ѝ^1S4`@-@h-\ 0\ l P@0 0 30 0003/0Ѝ^<0@-@000 0 0 30 hЍ^@0@-@l 000 0 0 30 UЍ^h0p@--@T@pPPP 0S ! 00S@4C@@$@-h0000/@-Q0 M#@000lP PP EP l 0PtZ 0l 0 30  Ѝ^h0,/P L0SP0S @- 0@P/7@-00@0S Ѝ0P04 3/0{`0M0000Ѝtn,@~,-4M0 0,0000000^A0 $ t t p  d  `  \ 㭜0 ,0 30 4Ѝ^hR,LR,DR,h{`xC_tC_ҖSXR,SSՔSp@-@`PTpP@0 @- @0T@I;0| p@-P0 0080000P@PP P4P8PH0LPPPT0XP\P`PdPhlPpPt xP|PX00# tZ\P0YYYm<PPP PPpp@-@PU  P 003/:hP40Tᶶ8:tY\sP0YYYpG-`@pP܅Y2\0` S`0W40SA 0U00 X0SH \040S- `0B0 A0S fE0 h04 TP U S PQ U0XP  00C 0 E :G:U{`S{`P0@- 000000 0 0 30  Ѝ^p@-PQ1hM0d000 @j `V( TP41L4L PLP\0L` S`00T0.Y4,YX0 d0 30 {L#Y4!Y``LY4Y;hЍp^G-`M<4@P0\00L0S P0S 4$0400SU !PL0Sp 00SppUppW ]pPX0p`U `  pX0 'S  R p P`000U00 8P 00S l 0, ,,XP`)`t p0S  R` 0SPP`U`P PxX`P`U`& P0 M.U P 2!!01wX jP 1"!01x0S 0S1$!01u 5` v`PX U Pppp0p000S l 0PDpD*D6Xx0S0S` XS`  P`PP VP0Ll 0hh0/X %@0 \0 30 aQ ~:P<;Y;&`Ѝ^&S$EGSSIJS^SSA- MX1@Tq000P410!0,,1P 00PP P0`PP 0 00⤴<:P@P 0 00PE p⋴<0 0 30 Q::P Ѝ^^S$EGSʕSsIIO-|M8!\4p᠀@0t00@P@@<(@0@4@2@K@W 00`,PP 0HS H=XPh0 , U ȇ10 0P 0 p(,($ -#=:PU V,}.Q?P @ `01;20 R S :P%- 0h0$ $ P $h000(03/R0@s0NPS00B@TYh l0,Q,00h00S h03PP"Ph00003/&UZP{7hP, h0( <k77$ $$0LS Ph0 0h0@P4@/P, ;7&@e0 t0 30%  0D7 9Q 99Q9h0TL99BZ00X'|Ѝ^8-MS }zP h h0U00,T0000Jb@PSS@h040T)XI/h0 R h0@X//P0S&>5, R(PM*P@z+P@Q66X /L+ +5T  P 0 T000P @<DUSSSP0B00H0TD0D0SXB0S <r< nL@ 0S: PDXP Dd0X@S9XHh00003/L% PP0\0U Hh0H00X03/p P Lp0T0000\0\ P0^00p0 0SB 000 0$0(0,0004080<0@0D00S(QE P  1=P0^0^0S X0 00<\0Z$XVh9<R0P$NLhn`P\0PEEQPEU ^0S\0S X\01<0S 0S< Ѝ^OGSTSoS0/p@-@PpP 3 0      0  0 0/@-@P Av3@-@cNRp@-@PU b3pp@-@PU IV3p@-@NN1NL^*!Q10* S1 ! O-@0Z 00 PJ`0U0 R IPPY Q PW A3`aP`OG 0CHC1@LP*@-g!Q10* S1 !/ /m۶$I0Qp@-P P@S A@D@DP RpG-PQ0@ p BpCBUGp `p  BRQA2W PQ`P\G ᱜSp@-P(@Pp.SPp@ԗSC-pQ(,`RQC0 00P0t 0p0P EXX0*P`P0@1 P1X[ Ѝ@P@ꜴS$EG'SS]J-4Mx0 t$0,00d00`00\000 0P00L00H00D020 ,0 30 4Ѝ^iRxC_tC_,SSS{`C-$M1PR`00000 R  #!0  0\ЩX F  p `ɔJP!  0 0\ @T b 0000 p@0p @@-pY >0P0D0000p@@ 0O\H0 0 30 0xB\3$Ѝ^*)S H1S FGES0 R/  {`ZS/p@-@PP00p@-@-@-@-00@-@ R e00{`S,0 R  @- V/{`S@-0M0@ 0,00,0S?rt0 R >PװL0 ,0 30 <  ).Pǰ20Ѝ^JS{`S@-0 000p000S⯰P0 0 30 c<0 R0  ❰w2Ѝ^bR{`S0 -0@-M 020Y0 000 ]P - @YPP_0D OO@U T0 2 30 # @2R03/ߍ0^|S^S@-@P A0Pp@-P0@0000@00Y0U@0P00p{`O-@ p+ `+P++++ + +++`+P++++|+t+^3.4..S.S.S.S SSSSS S$S.(S.,S3SD-:SASHSp@-@XPP FTD0 V$T@0 @0<p{`!gYԁ`p@-,A,!0 00000 ]0S 3/ 0S 3/g00S#iF (0PS  0RP ,0S<P00S 3/h0 Rpp@N$0S <P ,0S =03/<{` _^_X-\`0A-` R fNpj@P 0S 4U4RTPBUj4 kh4FT~80S Mi0S /Tw]7jV4|U4A/T\``{`0p@- R 0R @<0S @ Sʈ003/0  bDPUX003/P0PH0SpD0SpL 00RpP0@ 0pp@K^H^{`_$`$.0 XT @ P 4 /{`0X 4 /{`@- 9    \  *  {`c~@-@\P0\0[~{`0@SO-Pp&50S" 0SE0  NUd0`0Sh`hd0h dЍOS\`ЍE0  .U1煁S S* S`F`V\ 4V uPX 00  _0Qd0`lp0SpPh`hd0ph dPh d0p0t00 004 6/0`tp 00x0S0#SSL03 R KMs0S0 U#0C?o20S |0S!P   (0R   OTd0Sh 0Cd0`|BVY   =Td0Sh 0Cd0`j0V60/M0S Eo Go᫲᪢b   0;0 VP 0SÐQVP >0S   0  SP UP0SÐ6VP d0`0Sh`$hd0h dP0|010S 0 8S 0 ЍO0 `` PYp000Y|00080S000\60 Rڂ UP|08S 0UPd0S0Ch d0*Pl|Y ( R  0 `pV h d0pSWRS^{`D.,\..\`H^@^~`0 |~{`7@-0000?PtRx@T dR000V0p@0040D (203/ 2 20 Ѝ0eh0d@@p@0S 1 R 1 1 @ qQ@ @ 10St10St\1@ R D$ R<10S 3/K1t@10 R@2S0x R+ 0 R  ;dP 3dK003/2 l  t p 2/0 " 0080t R KQ {`_$`\`^ċ`H`pG-`@%D1|P(R0Q t@[ 00  b0AG.qᄑ!|`넑 P(R P0  Rd0Sh 0Cd0|`~TSDP0  wRd0Sh 0Cd0|`iT{`D.0p@-P@ P@Kp b0@00t 0 0@t0 R K``Tt0<060t 0\0\0S@t {\`{`A-$B$R2S0000S2000S1000 000X0S :X2SvXX0S 8c+ 2S t10S h!h00C0X!00C0Laj,H0S0 &$ax1p0a'`]'0p R   0 0 0 sz`.A"Ph0d0 00"000`0D`40d :0L`S$bJufb{`^!_!_V_```H^`_OS@^-QSp`_P`T`@-@x0s@T{U\00S (3/HD0S ,(0@0S 3/dI{`l_h_P@ 1P @  T  X  "     D $L(  ,0 h 4 d 8  @  x0D <0t00H0l00L0d00P0\00T0T00X0L00\0D00`0<00d0//{``^`__``\``p`PC 1@-P  @  T  X 4 "  $  D (L, 04 h 8 d @  D  < x H t0 L l0 P d0 T \0 X T0 \ L0 ` D0 d <0 b/{``^`__``\``p` 0d0h 0/{`0h d0/{` d0S/h0Cd0  /{`p@-P<@d0`0Sh`hd0h dPp{`0,00 000!/(|`|`p@-@ PPTp@P@DY(~`p@-`dP@P t0  0bRA( 0 DQ0  Cp(~`0|`p@- @P)K 00C00p|`(~`G-P@pက`V0S XPU 0S O5O P0OP00C00 S[[`(~`(|`@-@P00!1S  p0Rh 010000C S D Q4 0#0B9wR^-.^$~`p@- P@CM 0@D00C0p|`(~`@-L@0@00*S0a@P@00W0 1  {`(~`(|`0  0 l`$`@-x@0@00S0`P@00T0 P0 Ya@PyW$010s 0{`,|`(|`(~`0  0 l`$`p@-l@l`P0S P P00S 000pP>ZU 0P0(|`|`̎`@-<@P 400S(0 Bu@(|`̎`0|`p@-T@`V P <0PU 00C0p`/ZPPP(|`̎`G-AX WqPPPPEuKQ"`V/0S` V V `Ѩ007 Y 0`S V V `¨00 I 0S0Q S S00C0S0 Y Y ᤨ 00Z S S 00 `F` R000S S S 0 0w(|`0|`p@- P@ 0@D00C0p|`(~`0P  R $0 R0 /AE(~`p@-h@PxWRPT P0@x p@^050p(~`{`l`$`p@-@@P` 0S0 0#NT\000p(~`0s@- 000'LPU`@ @wh0 0 30 kP@TZ@EU@DwbPP Q@Ѝp^ h @-UH 0508~`{` 0i    0 /4^(~`0 /4^P/@- HP\SP/@- HPsS1A-@0S1!!0xQiS RO RL L10S00RSP; R8 qN`MTM0@D  BvXIS R# R tYaS R R ;AS R R dYH .S< QU$ F$~`4^^^(~`(|`^H^M0@-0S@$UK$~`P0p@-@Q Pb400@Papa$~`0_NQ@- nQ?  /Qp@-P@ ?Q ` p` Ѝ(~`^(|`,|`|`{`A-`LQL1000P+  (1p0 000 00 $0 0@T) 0 0yS wP@@"Op000 0 30 $| p000R\ 060)@ 060 Ѝ(~`^(|`,|`|`{`A-@PdAp0SNP`ᣟPt00Sh0 lPWC0S S3R0|`(|`̎`0|`G-(MD2DRDr0$00 0R<@rP20S$ @D`t/ 0X+0 00 d 0 aVc _F0S00SaF @Dta  kP@DT  Q(1 $0 30B :0 BLp# 000 P  IP  LP(0@FY0YOF PޡP IQ@D  Q(Ѝ^(|`|`̎`0|`A-PPeA,@pWNU`՞P00S vQ0S00BžP 800S,0 l00C0(|`̎`0|`QQ& G-Pᔀ@ᐐ`ጠEU p0WDQE0Sl둞P0SOPE S/(|`|`̎`p@-M0`P000 yD@rP00S F0T0T 0 D0 $0 0 30 ]@Ѝp^(~`̎`l`$`@-PQ<0<800 S R R 00|`(|`0|`,Q;QA-pAP0S9 R6 ;Q0c00 AUfQ FQ TQ0 `V0 J0 0(|0 050tQ00000( IPڈ``(~`~`{`h`\,l`]P )P [P (@o/{P }P/////G-aq0@PP῝P10S "P0 SL0 @P TPT-0d➝P R 0ElP 0@P00CRjP0 S ZX0TPxxpP 0S 0 R p X P Ej0T(|`0|`̎`|`p@-MP`0@000T   uE@00 @ 00 I0 0 0 0 30 2 *C@#P \00S  LE0T0@@Ѝp(~`^{`h`t,l`̎`00@-@0SSQclFc@(~`p@-0TAP00S= %a00@0 p@T*@VVV0p0S Vp000S0T0Sx0 @T T @}A@T@R*0 0Ѝ^~`(|`^,|`^|`( 0p@-@ 0P0S PI**p 0<0p,0P0 1H`JAY??* H p@w,|`(|`~`{`0|`p@-@Pp\0PX 0TSS @00Sp@U$T@p@Ӻ$|`,\,~`p@-@Pp\0PX 0TSS k@00Sp@:U$T@p@Ӛ$|`,\,~`@-@ 0 T  0<0~`{`p@-P`u@000 10S 1 0R0/S000,0HPPD0T0VP0:0P0P0P)`.)i 0 @PYp iP7Pp@p^^H^`0|`(|`|`Q{`~`?Q/Q\0@-P*H@00S40 00RNQ  P~`^^H^\0@-P H@00S40 00RnQ  P~`^^H^@-@xP PP@> R/!R0/M@- @T0 H0 <0 00 0S 0 0@Ѝ/.-.^ ,-p@-@P` %Ppi0S` pp@-P@FPi0S p  p: 0: 0p8S0@-Mt0P 0 00@}P wxi00 0 0 30 9Ѝ0^p@-P0Sp`80P00@ |00S  d00S GHP8 00000p@8`{`{`!_]S~`` `{` 0 /|`0@-L@{`0@-C7{`0@-tM|0P0@0l00h03P < %0 l0 30 ĝtЍ0^{`00/0C R !Rl  E R !RL  M R !R,  D0S/!1S 00/{``,.G-pM,3,C0l000Sp[7 30PP3`'Ph RR00_R0S2  )82 l0 30 jŸ|2t2Z Y`2`0ZP"@0 0HA0%0B00C0#0D00E0!0F000G0"00H0"0I000K00L0$0M0"0N0070 YU< z0d!Q<xx!8pW00<0p0Qp W 0< ,00 : 0$0<00YP0N 0000R0 1SN0iPy00S vF0`0SP P}m0P00b< 0pЍ^`{`!_|` `^^^@^d`{`h`l` ^```^{`gSA-PP`V`$pT6PT@0000;00D P0P0TA``{`@-(@PP0TPP`{`00 ,   /`p_A-PP 0S  A/`p_A-@` pPP=0TS/ T!   RRN RK@D0qS A R \PP 040S/ 000^`Q( P JGS T   RR R@T0S<XAf(GTS0|`(|``|`p0@-@0S /=0P R  R T  S0CT:/R /R@`@-`-0M@0 00<pP0S0 0 30 SSP@ G0 ApP@P @0P0PЍ^O-PQ-74MG0,00^p8P V8P<P ,@P ,DP ,><M: d7@Rp3<B:</+=pP\ @:00$0<SX (0SU ,3/D<0~SKbP<Zezp 0Y 0W0p0X0S ( % !RZPE PPⒻ1X R: PU ( RP $PU PU ,2/@P0S 0  *^9P0S   9P  9U )0  O 9<Ѝ^`̎`p_0-p@-RRxM` 20t00 1\ ^10 00SRp x0Q0C R! R  Cx000L0SM :_ 0@S 87 03/=b@V 0S  P 0 00RpA~0: S00S 0 0R0 Q 00S/Sbh0 t0 30 7/Q S;P,0 000RpAxЍp`^(|`0|`p_|`*)SO-@-2M∂0008000d0S00P0Sh0@S T l0S d0Sl0S`P`f_@s_b_ _T`P0a.S_P.PZW`PR@0SD S$^Hp@0p   ܑ0P8@V 0DV` _h`V `"_ I_S^!? 0 B=p p 0 Pb @P h0S _T^@0 0 30 * pPpЍ^`{`_O-M2Pb@0 00h0S 0S ?0pSU h p0P0 0N Uq U0T0EN 0SK /S 0SB /S 1R@@]L0S 3/7@7Ĺh6000S/S@D/00]6p0S @h0S p `E`T 1p~0 0 306 @@T 0L0S 0S v7ⅹ *6 03/ ` @P/@]p@T @h0S  p0S P/@Ѝ^`p_X*)S{`O-M@,2T0 00g 2` R< !RQ 0S 1 Ap!7P .5Q%p$P 0S&0P O`W 1pP D`p@@`1t0SY8 p0010PP/`S0pp!R3/PU0 ['Pp0 0 30 C0!RSW SC0 0  @'@Ѝ^p_0-`H00S@0x R | R0S@ /?/!/$|`` 0 $ , /`O-Mb唂000S @TP) h@Pp 3/PZ 0'T \QP T' T@00׎P010S, [p0W0 帡ST. Z<p0SP0SpЍ 0P 00'QP "QPP@p 0P 0US  3/P P 0 R[pWpppG0S U  d0P 0Pp [0pP 0 0BS ppP N0P0003/P (|``0|`̎`p_O-M⸔` d0S!*0@S /6pP @P5P@00 Sd0S0SPEJ@,Pl0S0SN /6PPJ @pTXTp W pW0Wڨ0P 0S p0WpWp00U SPE? R00UPS0PS0S 3 < =pW( `pQuЍO<Xp@ @T 0S 0S S5@0S 0S@@ 0E000YHЍ 0Q  6Z0S021 0 U 00[0S <1 R 0S$0pS 1 00CSYpP0 @1 0 0R B < 0S 0S0S U 畓cSpt<$0S 000CSpP`0S  00 0R 0 B`p_`pS0-\`{``1G-P]`V@`@:< 5<60 @V`P0@DpW  0G/t0h(0TS`<\ %~P < 00 ā` ``p_{`Jp@-@PPDpPp@]]P/@-0  `O-, `S@PP9/pP U4 U0   Ѝ0S YP m]PU`@ @P`,PU  00-0@`T 1 q O]P@H]\`L,A-pP`0@$00,00S 3/0 S 0S ,0S P 000 S r R , `\`O-4M 5`0,000 u E9000PU 3ĵi2P0̴$S0 Z$ (   0$( 0 0 - 0@ ( P0  P0@V!V   0z30 0\0S;U #@x@000903 ,0 30 Ց @P;U #0x0 @T 0S 0S00*VV  V !V V0 R S0   0S 0$?Vk @VR S0  3 0S!Vh0 0S Z U 02-PxH\090`2@T @+10S :d2 R X 1000SSH=0S㐁 `;p;0V \ `;;0V \P@20S P 0S 0S0 z0Ā`S0 @ 0S 0 0000S 3/000x,7:U #0@90"4Ѝ^{``0|`(|`L,\`^}Qp`t`l-ċ`xSX0 R \?D @ Qx R? | R!0S@ `$|`-0?`0*`A-P2B0 002 2Rh `P "P `0b%000090,pWpT2WpL00 0R 0 ,+000 00 P9P9PPP "0P9xP0|1 0 30W fP 09000@ 0\Q R|0S (\ 0S y9P Q"00x0L" W`PZJS00P0S \90 0 h0 0`Qp80 cЍ^`$|`-{`L,(|````A-P40 004$0 DSS0S P !P c00%000090hpWp3Wp00 0R 0 t*0 0000GP P0S8P0PPP !0P9xP02 0 30 P 0 9000B0\PQ 8P !000x0!0S 0S2  0`0000 0R+o x0S|0S +1(0S S {8P S!00001S n80 \ 0S_8P 7!00 W`PZJS/o" R H8 0|0 l0u 0`Qp#0 NЍ^-$|`!-`{`L,(|`؀`Ȁ`܀`p_`Qp@-`@P ~@o a0p /Z0CN\MPPrN!PR 0Q0PB0Q0P01 .1~S00p`Rp@-  `^\3#p( @PV PU @ !R Q S pSPp QS p p^^0@- !R=R@<T ^$ =R=P000\ =P0 <R >R=P0 >R0<R=P0 00S/Q\S S/4 0 Q/Q/_G-P㵱U@\00e0000U \00C00-00?0000U0+\0@P0C00-00u0S u` 0p|  0!1R(0100  PW1 011P0 ER\20 0P0 P00W ׈0Q"U\U\000A-P8`@ pQ@U)P @`SA-P8`@ pQ@B)P @S<0p@-P`@Q@p0)P @_0P 0S @-釚 00/^0P 0S @-u 0 0d/_0P 0S @-c 00/L`0P 0S @-Q0 0/_0P@- 0S @PE}E-07@-@00000Px 0S 0h G C o$0 0 30  Ѝ0@Ѝ/^!_S`S< 0S 0C 0 0 /@-`}`S@-@P 0S0 |(P p(PT0Pw(P @r(P 0m(P 0 $^H2QS,HWp@-@P 0S 8PP -.<,pp~`@- X@U.PH0H D0< I.P0$   0 S^@^^S`_X0 R0D@-KP 0R 0?o20/`S}`A-{`@pP0S R0P@WSPPO-`T p0 R0 Ѝ\R@T CTP -RP [YV LLt@0S 0 @ @0S `MT -RP`07T1/T0@DPt@0 0BPUJPE'RL.- -- -- -- --H.-/- --.-.-.- -- -- -- -- -- -- --.- -- -- --.- --.- --.- --/-@[ \ DrP[ ?T@ tچ 00  چ0 A@V<@@ @ @ @ @ @!P0 B@P⹆ 0  PPE@"aC^r W0CAC^70C00Cs0@ Pr P @P@P_ @e@P@[VP@ @L^O-P<"M@Q   `0R0S @40,p 0@P V  P"0P0僁1SpQ0P 8S P 8080D`U1 0 30?  X X ! Q 00  0 [ S[ ` S8Q  HPaQ U PЍ^`D.-0 0b^L1P@-@0000a @RP0! R @R0 0 01P@0 0 30, !1qS SoU0 p!P 0 0\T@A@@ T@A\00A000@00 0  C Ѝ^^^`rp@-@P pp@-@P Pp^ 0 0@-`@000p+P @P @U80 0 30 70  Ѝ^p@-@PT` 0S P /+⵭d  0pP 㥭000P 000ꈁ``p@-@PT` 0S P w+Ⅽd  0pP u000P 000ꐁ``@-@P<10003 (aL+[*@P 0d'S"S  ( P SRpU0PP(+6 Q 0PcTT0 0 30  0DRp P  Ѝ^``p@-@PT` 0S P z*d  0pP g000P ]000ꀁ``A-@P00006 p`*լP 0P T0 0 30Ѝ |Sd0d XX00X0S 40 0 30  ЍA^D.,0 ^0@SG-@Q@\00M00-00TT\0e@00P0H@0P \0e@00"T\T \0P2ʀ;\0@@0C00-000t`0p| ߃ 0!1R؃0100  ؃@W1 ̃011@W ă0AP\0?@0C00-0000``p@-p@P p@E@-p@ 0@ <^O-M@\ *`- 0D00P0UPЍEQ @M00[eg U@e_ [T 0{pS 0KS@\!0 =а@pwp@PWC00@Dw`O    N K !Y @W  >  >W00  /0aaWu`P   0[@@?C00"[\[`SO-@R`M P`0S SYPp0 0 X0  0  RR`1VPЍTp J)pVVT ' 0\e T -)0; ' 0 ' iR !gY{`S*Sp@-`640PPE@Tp4#Pp~`@-@P@p@-P`@(0 p@A-`P@PElq 0Ut# `V L #P 1V0?o2000 000@P"@P0R"@P00S0   "@P"@P0 0|0PD #1S 3/@P H 8`S,H;S`PS_$^dSxS^^SS6G-@000TP8@0 R R #RR $R; `0B Q Q0C  R R R0   0 0 S S S00 u@ᒟn"PP qL23/5 0 30Z @QUdX5P"R^0S, `@0pW8 :W W WV P VP_:W  =RP U```""PT0P `S S S 0 Q Q Q0`@p0V V V P 0  RT 3 5NP"V 00@'@T 0P S S 0T00Q0S00< F`R R R "R'R0S2  0 S0U0 Wq 0"S3}'〈`  0Spp@"T'Tm'0P 0C RpD2 P(K\SQ ""S  03q-`'E(PQ` c!PqtbqQpအQp'YppW \`g!P 0 00  0a`pU!P `@"T'T'`P00 @ R00 !@Pt0  0`@mVPЍ^`SS}`SS5NS^S^8S0S@S}SSX^O-|M,2`(R0t00(L!mP2@lPq8< yTZ @pRP00O0S ^T!FPp1 t0 30U ⤨ @ (n !pYO@0S >0 p 00S ,P P q&
%%,p0 S *  W  P`B0Q Q Q #Q   0 O o|Ѝ^`\`P@-L0,P @JP4_P(@Y0S `SSSL0G-Y <@ n (P0P`A`(P}``@-P001_@-CP 00_G-p7P>@P9萟T` +O%P$Pa@@@1QS|0Vا (%Ч`t$0P 00̧@__P0/^@-P 0/^,00S 0 /S/0 ^^`_@^@-I$00S  S/ /^HSS7@-@TP H20S@ <"S8 Ѝ0,P22PV}P2 wP10 01̂4jP1 dP Ѝ0@\P><P1t1 NPp1P dQ@P  0%_N00O0000 3P 1P0P$P000P00P00 Py00S$^HWSS~`DVS_SL`)H0`!S_SӽPp`8S```LS^SS^bS`yXtS`SS`S@-@x0P P L##0 @0R}P0 @0#*`S,H2QO-M6@V0 00 0P0SP!P嘦 0Df  PU<z$Pp0 R R R000P倦SPU%  $P@U$d #-PPp0P k0P00M$5 0 30A  k$P@UP OP`400S00 R$PP000S S R 0C R  0 00B S S  ,` FZ ЍOHK 0+0@S Pp@԰  垚 0 ᙚ0K R+KT  p|⇚ pR WXpD0S 0 0v KP{`@R^3S!S=SZSNJnSL40@-0S $0$0L|`{`)T$~`0 $^40@-0S $0$0L|`{`)T$~`G-P@吀`p R`tp倀倐@T0P U ! `0 @0S00U `S{`,H2QSSuS40@-0S $0$l0L|`{`)T$~`A-pP` `V A!`@O(00P@ @ @p @dW 0S @<4 aJ$0A0/?LSPTS]KQ_p@-`P0@PP0`$0p0P0 PPPP PP(05H0,004P8P<0@0DPHPPPLPtP|PxPPp(|`,|`^@-@P aP ]P Y@Jp@-Pt`0@00#0@P@000yP D00SP Tr$P@ 0 R op{`̎`\`O-PQ8<M@0 0000000D0P4;00S0U0S PP<0q1SZPP#k0S><0@000LP<0000xP{Pn"PdP0P0 F"PPP #PPU`0P @P0<0L Rʀ PPUڀP U#"P :0 "P<0008S 0P"P<00SxP?4: R;U0S8 <T` *0V?? )V00 9V0 9VU0 9VU0 9VU0 9V0P0x90SU0SdPe0z d0T@ Tr<0`H9V0 hy 00  oy0qq`0BS"1S8"VV("L0P0/xP80S e0SU0P T  d0T tS0L0]R "L"VV00R00SN 88< `   P  (0P(!PKwPP'7PU#P T0S U0SP0@SP00S)j-i-8h-g-tg-Pg-hf-P {",7 0 30 }PP0@SP 0S)W0S @d0 00p `00PV-PP60@0<00v &00D0R0 |0 S0Cx R 0|0H 0bRH00000 0S& 0S&uwP 5PU 0C 0 D0P PPçPõ, 0p)$ 5 ( 5 0 (B\5 `0X`0VHuC'P >wP 40S0 DPᴔ P-wP%0S"0 DP0UCP 0E 00S廠 U00VP `$d 0PPU{A 00S嗠ß P UPP 0S!t30S e/  00S:m 0 0 0 0T0S( U0S% V0SP T;P 000SKvP LQTQ UPS0P   P U  PxI|Z+ X t0 0R [PPPH DPYPDP U0& |0S0|0H00|0S|pY0U 00tx4P 0 0RP V0x00C|0|D 0D 44(00S .|0P0.P R00d 0D000pЍ^^^{`̎`p-p-.----D.,. ~`}`T`^(|`,|`|`0|`^p@-PQ`@,, 0'JP 000 00,0P$C[1|0S 0 ,0R$ t0]( h0| ~.| T0 d'x.vl8 000U00p@z1T`0|`,|`(|`{`G-q`ᜁ000%!V@000 0S00A2P40U 0!0R*0 R: !_ R   0!P000,0D0Q V P0P0H0t0x0@|0 0P0PGT {`T`_ST`0|`(|``@-@PP@90 P 0G-䀟S0SKP.P`Þ`從`幞`崞`pD t 0oP i d@@ꔍ`d`_A-@p00S0PP`V < 0 00tP nP iP d00`00`00_d`p@-@`P(0 0` 0P000p_ @-@00C0_P @P#PP/%0@S<#a0@Sp@-@0`PU$ 000p P{`d`p@-P0S `0 CRp0 A@Rp1Q0S#@up 0p@0Q1S#{`t0@-`pP000@000T 000 0 30 Gz@ Ѝ^G--2MR0 00 @`&tP 1PU F1 0 30l "z0Z0T0ST q V  P0 p,Y VQ P0 @ @ 0  p:PpGT 0S 0SPpGP@EଐV0S 0R00 p:PpG@LpPEPpGP@Ѝ^̎`d`Ȏ`O-,MT 400C?o2S) 40S% 4`VpW `tt+@ 6@4 <4R$pW(`(t`,pW0`t`@dksQ 0S30S0 FP+YP Pp#T@ 04S`p0S0 0P0S0P 0T0Spp4` ,Ѝp̜0SSppOWP07p4p`q῜4 G`p P```$`` `0SX" 0 0 RS  0S$  P0S  T0ST  ZS  pS 00W 0E0C$0p RPژ! RLG0 ? 0@E W:PZ 0000 0{0pC 1R0Y     3# Y 4 !rY E  Rڔ R ?P0 40`0Z0000000IAd`{`{`^yX^@^SS`̎`O-`Bp ar80S$Y 2 0R<PUU 0Sڔ2Z [ /P 0 @ S<0IQ P0  00D0H0S0S*L  ! WG0X P0S Sx! P8@ P R \ 0C0CS K0D0 U. !0 R 0 0C[   BQ R RP !P U 0Sژ00S0S ` PB U Ѝ  a0 F E Ud``̎`__`-0@- 00 ЍG-$AP TP `YT` ` `<`P``X` P p  (PPp<0D  P0TP 0X 0Ѝ0`H `` T<0D pP0 0\ 0d`x`0@-0{`{`0` R d /d`@00 R0$ Q800`0h000l/_d`A-4q4Q07@0T@b0^` P`@ qP.0Q*0 0 0`S`T80 CcS| 0h0   0T`A0lp0{`d`_̎`_`[O@-L@00S0C 0 t00t003/ R_d`G-`80S @ Rp@W ڀP P*W008@P R R PCp0 pSAUd``{`ԍ`-0@SA-@`00SPP@ T T  PPʀ T P\ Tʀ @@0tpuq 00  uq0A?@{`~`SUS p00S/@-p@ T@PʀP @Lq00 ~`@-$0 0S0 p00t0{`!gYd`p0 x T | \ P X <  4 T  4 \ X P  < /d`-@-$PP1PA0 000 `PS務0 00CS 则0 PAx0S00  (00<0pD  P0T  O0 0t003/\0 0 30 uS P TP 00Ѝp@Ѝ/^d`x`_@-@P TP 4P x00|0T00 00400\00P00X00<0000|0x00000000d`7@-T@pPRp00<00X P0 PT  pP Ѝ0@d`(0 @-pP @@xd`80@-00@p00S 00003/{`d`_A-p`PU @P@T @ĘTP f0`  P 000@@p⭘WP O0`{`d`p@-Pp`@ U X0 L0R  p Pm A{`_d`$ \   ?P/Jꨍ`-O-P-o\M@ 0>0T00nP>0S0 80 Snl0S 0P<000B Rp>0S L>0S0 C80R[z<>Xv >0 R0PڮL0 8tp`AP@ 8PL0 8epppW 8P0W00Y0S%0VY4X>= 0=  8  8 0S 0S 0 0 00@S00<0C`L0 8'ppP 8 p0P0L0 8p`PD  4<VY8  8 ? 00$000 0 0`0 0 0CX  ԛ[i;0Se 0 B0<0\>@ R:X+ Q5@+ R10L0@00D0|8 `=0P0nVW* V \ tV0 m`G l  h0*00 0 0V ^`  R}\jd000S 0 CQ$0$ 0 R0 CR 0 0 R  0 pCQ`pu[ڸ90S0 0 0GX 0 [Yp90SU 0 (0000 Sʈ0 S090 B0S09l00AR$0[ C 0`CB8pW0P0 Uj 80S8 d80R`! !0s0S  00800807 (000[7X 0 C0`C\ 0$\!  ^  ^ 0 Spp P   P00 0`000eC P$0$ 0 RpF0d P 0 0 R0$ SV [jڐ60S"@60S L0 8 P8<@oSP 9` 900 0`005pW?$0 C90 00 0C9 0p0 SZY$0 0+ 0 8P 0R 00S [3$50S/ A69000S [&40S"J '90t S00080S x0S<0l0[ |40S 0d$Sl0S0000C(00F,04($0 p030S 0SpX0SQ (0FQSSP 0R.0S p[;ڈ3Q7 0嬐S0 0 0@ @3 D (0 FS0 #P R0 S00CS0JS2 T0 30u q0  S ?  pP9  P;0 000` 000 8p0 8000` 0000 0CS00S 0D 7P 0 0R p 0`<0P0D C0J(0<000J00,7P 0R0 ,0 S80 00(8 0p$0  C 0B0CC((p\V1 *R0C\G(@Q \00^{`Ȏ``FM``č```_}``̍`Ѝ`-_d`̎`(0S k P(00S0 P00 RTp (0[  ?o4 2  R XRR D  [J BI  RT00pJS P0S 0S  S R l00 S0C=F 0}pRl!000`FSoob`VI ! Q\Q@ ;@0D0600020 t70 n70 @pC0 0p0 W 0  Q R WWp0p  J0.p0 J0CI 0( B"pG0S20 l0S 0C[# Rp p 0[C-(30S) 0, BJWdCY`0 0 0 0R^H R[  RX P,QT0C00D0O p$ R  W4$ R SS,$00 0#R0S 00S t$ R l$QX 0 R  Q RyT[ڨ$   R P ,RX RiD0l Rb(5P)  4 %: i[H85QD0 0 Y00l5 00H0S  R P0,S05P 0S %Z:X * 6P 0S &N: H0S 0S pWP&:;:0 0040 Y00S [ & R ?oY20S  &000 6[   Q@Q{Qx HPu <Qr d .PL,\iA7\  0gSʴ70S 7H QRO l0 sZO w[g7Qc0 00S0S H0S <0P  S R P ,R@0D08 80R 8 0 0Q Z Q80S 0C$00CS cW 0gQ09pg0W@9P 0S  3`)y90S 候pW: m90 00XX F)[000MHQE HPSAP, P0C00D09P [L@: 0SRR WV P [ :[   ڸHQ Q P, P B  D \Ѝ?O-TM0L00?h?0S /040 Ph `? RdT?R`H?0QS[R(0 0XOp0S?p0PQ/ ?0SS? R    00X00C00400>0S $P >0S 0 *4=4O00~pP0 0 00R00<>0U 0S- TPU t0S g 0S4+ `X0`FP`0P 0p!p3 ͟0S40@PC0!r'0S(ڜ=0S$0S! 0j<0`Fp@0@PST=0S== 0S 0R80,<08 sl0< 0RL4Č04`pSd0 `PSULP0d00ASʁ0 0 p0ASʁ000 a 0H0<0S;0S 0S 0S t0S 0t0;V 0Sڴ; Rw44P{`` 0R$ D00 0R   0 B P 0 N@` ,0S:  D0S0 S  SP R< @0St: R00S \:0S0 S P < B BS  B0C00 0(090S0S 9 P`0 4V >P` t0`S F Y0X S 00P(X4`<`0 4P 0ug000( S1 S08 00S ڤ80S0st0$0 08 0SPL84  0JSm8Qi8 Dek8@0T@Cp 0ASʁ0 0p0ASʁ00ߏ P4001@K0焧pD0 4@j0S @ 0ASʁ0 0@P4 1 ARʁ  ,0寏,0 @ p W0S000 0Su 8T0P0$0 Z=w 4 aRJd& 0J @T,0+@Bp  ARʁ  {p ARʁ  p P010,0@C40 S 4 440 S Z,p5@T,D50S( 0S%  4p 0ASʁ0 0;p0ASʁ0000P4 0ZRʀR ^4p40S@ 0ASʁ0 0@P4 0q!0ASʁ0000pZgz[d@@{@ T {`f닰00  `f0 A 4@30S7@ 0AU0 0ԎZ 0lSh30S$ @ RY2 0pR첟4  3P  ZPr$0 SR20S0 002 0" R   0S8 00 pe?@ 4@&0S@ 0AU0 0|@P4 0!0ASʁ00l0@0 0Rʠ0 4p0@S@ 0ASʁ0 0M@P4 0!0ASʁ00=0@0  4@0S@ 0ASO@P4 0q!0ASʁ000@0m40 <0 B8OwA4/^|`(|`|`,|`!gY ~``{`0|`Ȏ`ԍ``~`O`FM{`}`d`{`^`_̎`00pWpE`0V001` BD0SC 0တ40P0l Sڼ P Q ڴQB 0CP 0 400CVU 0000`U`0S(ņ80 `PR ;0S P10S 0 SR0000PooXbU00S- 0S*cP10S0 P00 R0S 0S $P0SI,2QE0 ᬀy @0 0P0PES``V 0S0Sڨ2Q`0 0Yl0`@V0 10 1  `0V  ``0Vt0000S33 #00 R h R30#l00d00403 L0 30 QihPPp X0G B [08PuʁB\_ QSPU00H0U< 0 00SV 0>  CŨ0S t0PS Ԅ  ptD l0  .0SH0 S 05D 00 0W  RP R< 0C0lU0  QVQ HQ 0C R@`FU00@`F0S0ռ`50 YhPV BpG WYP B\ SUÀU` P@`0S8ڀ60S40 20TЍ@-8@0`08@T@Dd`L0@-@P 8 A3T(0P@ 73@갍`-`G-8A0S`P(aU 0SP  ! RPEP`PP``0 SU1a`F`F Q QPpPp0 0T @0V`00SP$0弨000d`__`{`0@-0@S `VC00t0P h 280SGp  P @,0m)@ꬍ`d``-`D00S/p@-4P`P'$0@`@wp@|`d`{`p@-@$P@0@p@cd`{`0^{`< <0p4 0 @Q$  @P/d``{`{`@-S@)0/\`@-0@ ) $ 0S3/090{`\`0@-M`0@P000s000S s0 0 30 gЍ0^p@-M0@P`0100@?o2>1ss rL0V0S   0 1 30 Ugލp^ؾ-p@-Mp0@`P000ns0 0P r0 0 30 3gЍp^p@-M2R0000SM A0S* `V`Es!Br!!!!!P0 rL4+ p r&s(s%s"ssssss000Sr P z v rx 00r0S P@5Sl a05 0 0 30 fЍp^_\`t``ؾ-` ``$``<`ȇ`-p@-M0P0000S @`Vf+N000S X@5Sr q05 0 0 30 [fЍp^_\``ȇ`@-]00S 3/ @h_ 00S  @-3/@ l_~`@-nP00+@S0/\`0%R %/\`p@-@@VUp4Hr0Fr$Qr Bq06p\````@-$@6S q06\``17@-0001'R R P P P7 0 0 30+ e 7Sʀ 0007SS^ ʀ@0s@0 tP` 00  `0A@00 ?@ Ѝ0^\` ^@-CM1PQp010ta0p90M \10S 3/09001 1 30E e0@7S 3/wwq lqTT0DS@-0-@- - - - - - - - - - -@-@-0DS`q JqbV Aq+IqF `Cߍ^{`\`ċ`0 R/\`$0%R/ % R/\`0@-@K` 00 (0P Px`bS@-@aP (0PPx`bS@-AHP, @T ( $0600@dꠉ`{``|`$|`@-/@-#P0p@-PP@A 0` 00p0|`p@-@,P,`Qp@)q}`0|`$1G- 1@B`0V  ~R y,P /T ~R_@T: R RP@ T T@@@$V@@T0~SpHp)` @F,@U/ v(|`|`0|`S-|07@-x@P0000`0  ͵$0 0 30 \d Ѝ0@Ѝ/^!_S-x07@-t@P0000\0 | 㨵Ҥ$0 0 30 8d Ѝ0@Ѝ/^!_SA-Pp`P@VE @DP0 0S6/0@ P/0@/0@-@_0@/0@-@_0@P/0@-@_ 00  _0A0@-@^ 00  ^0A0@-@^0@P/P/@-@KZ@@-8@0S 0 0,|`(|`00 A-SS@0S 圀q` PVJP x000QqPC0P0C0S00C0$|`--|`(|`0|`00 A-SS@0SQ 圀q` PVJP x000Q6P0pP0C0S00C0$|`-@,|`(|`0|`A-@`PTp @T X X @P 0SE T  X0lP00S D0 @0RA,y w -(|`^^H^}Q0A-p `0@RP 0 0|00000 S$?o200S :W00c0 0 00C 0$|`-|`_$~`G-`HqDQ0S. P@@D00@H@ 0R: Y7 R3 'p$2Xp$ e _-]-0 p@P @ T R-( "0@D !@ @  `\|`|`^A-phPh`Q oW@ 0Q  000,|`(|`\|`/PA-H`000P@Ip Un\|`0Pcp@-8@P1Q 00S  0 p(|`^,|`0Pcp@-8P@Q 0@0S 0@p(|`^,|`Pp@-L@PU& pU 00S  0 (|`^,|`Pp@-8P@Q 0@0S 0@p(|`^,|`@-(0@@0y0@(|`|`,|`@-0@P  S00S *`p00S d0  B R \ \ \ R \ \ \  B (|`0|`^,|`@-0@P  S00Cs.00S 0  QQ R R/R\\ R R!/RQ  L  \ A  Q(|`0|`^,|`@-<@Pq  00 R 0(|`^,|`p@-0`00 0S@@@P p(|`,|`A-@PdA8`4Pp00p,|`(|`A-@PdA8`4Pp00 p,|`(|` O-q@}@P@@0@00`P0V@00 TsP00X@0   V ` T `P`[00~V0S @D0S P @~`{`kS|07@- 000d0P \0  T0@0@T@S \+ 0 0 30 ` Ѝ0^(|`,|`^C-P0M0 00`⬐@p0 PP @T*\0 0 30 Y` PP@u00 RTTЍ^{`QSs@-0@0000@000@00@P@000S0T0S P@ ;`PV@*X0 0 30 `@V*z00C0SЍp^{`^p@-P`@P@ YP 400S 4@00p@̎`A-pP@`}0p ` P @蔉`p@-@Tp0PS *@*p@- P@  p@ꔉ`A-Pp`R0p@` 00 P 6E  p@-@P P`U0P@T@@pG-`APP000800S Pu u! `v v! S--<-4-|!Pp!`d1P 0 0 1*0 p800 0 P 0 CS/o" R 0 *P O * *0 R 0S S00  0S S00)X 40P XHFꔉ`{`|`(|`0|`T`(00S/\/ᔉ`0 @- 000蔉`0 @- 00C0蔉`Pp@-@P `0 0 p@P@-D@0S,0S00S 0 0ꔉ`^,|`(|`@-@PP @DT40P/ P/P/P/᠉`( 0S P@//᠉` @-(0      蠉`p@-@@ 0S4p@]P 000P;0p蠉`rS{`@-h@P j00P0 000000) 00C 00S 0;0蠉`{`p@-`P R 0@T<00 H 0Sp@ꠉ`{`p@-P\@00SP 屁 0P0p寁ꠉ`p@-L@P (00PPPP  P0P:0p蠉`{`p@-d@0  pL0LP0S0 P hwb0:0p{`$~``p@-@lP0S\00  0 0C0p@DDS>Tꠉ`{`P 0  D@@0 0C00:0@-{``<|`h0@-P @<Lx40T 0 ꠉ`Q!_ ` 0S0CC@`/Ἁ`<0 R   Q  //Ἁ`A-M1PAp0000S  ឮ``⚮7]0060ᒮX1 00p NP `(0 SႮ"P| CFP 0 0 301 ]PS 000S 0S 0S 0S00S0S ;S0 S 0S (02S 3/Ѝ^\`t`{``0@-GM00100.@ = 9\F? 1R21\|F?000d002c 0 00 0M(0P 1 30 \Gߍ0^{`@B_00P/Ἁ`@-P 0  R!C 0載` 0S0/_0 2S /꼉`|0s@-`000h0`ƭP'`@ Lp0S 0 0 30 X\Ѝp^{`@-@0@-`000 p00@P`` P 0!1S0S 00,0 0 30 #\ Ѝ@&^^,.@-Pq@0@  080,0   P  P|`{``G-ML`H2010``J(@ X T[> R121[>0000 2c 000 0LPP|1 1 30V [&`p KpP0S ` F+`F D zF@t0 S S QQ1P00u0P S kTf T T 0S C 0S 03/@SPPލ{`^_@B\` 0080/{`P|` 0080/{`P|`L17@-000<10S 0>Pp9 A2SQ" P 003/0 R n00 0S a00S23/2S P PX0 8&0S 0 0 30 Z Ѝ0^P|``\`{`_{`|`C-M0P`@000@  p TTP@0  p p}P@ 0 0 30 ZЍ^A-P-0M⬀@p`0 000W?0Sh0 0 30 Z@ p0p@00E0@@00Ѝ^{`@-ɩ\@0S 00H00S < 3/0S E 0 R@Ћ`l_~`\`@-@Υ 070 0@@{`Ћ`G-0S|tCb/eP T3DC03/H3 8 b/0S30S c s0S S0 2P 20j048<0S  2P \R13/ᜁ@XP $똁@20e <2  20   180P+R9 0p@6+:S+ P 00S;QY: ᢥt1@0SJ*(1  03/H100S 0 R&0S# &!S¥0 P1S 3/ᜁ@XP k$똁宥ꏧ@l0S 00SRT00;0LW,003/0S 3/Ћ`S`|`_$`\`4|`{`\``~`P`|`h_0|`P|`` 0@-X@0070H0 R 0S00 00S 3/@{`Ћ`\`h_@-@ |@   $@-@0 |0:0 50\0!  L0帹6  , ;0 6{`\`Ћ``P`p@-p@pPp``XP H@80`pp`^3.4..... .6.0d{`@-M1`A 0 00 IPPPppV 0S/$PU(pV, $PU3(0SV5 (pW<$0QSP0$0(0S0(00S $(0( S$00C$0$0000 0 30% X0(0$0P e$$0S,0S d$XP e((0Sʿ,0S ((Ѝ^p`_pSSSTP0(00Q0$00/p`0@-忩@{{`0@-巩@s{`T0@-審l@00S40 00R @o 00@"{`|`_X-{`G-PP|3000lPdC04080<0@0P3P U`+ 0dSp$lor#,0 #Q ,P|DP "0,0D000$0S(0Sq$0ShOgRS{,D0S{D,0D0PP@  X"000S00 2 d 1 <0S1<0P@o1$0S(0SH0ST0SLPPUPxPPl0000t0x0PLW @1 1(0S( $0!000<00H0L0P0T0X0\0`0d00 00000h000l0p0t0x0|00000000` 0 X 0 0 0 30 ^WЍ^Vp`{`}1S_X-_S`ŃY``ISS`_H^@^^Sp@-Pl`@0s\0UL0T(P 80R$@@D$@$0$ (0 pTp_}`p``0A-PPp@D`0SaPa0@ Tp`S0@-@(@$@p` 0 0ʙ{`A-PX`@TP` Lp@ @!T@]Tp`{`-0 @-R{` 0 <!p`-l00S `0@-0S SH0XP < v!,@E/|`$^p`-!_ 0P/0S/ \!p`- 0 R/P/ P!p`-@-,@0SxP C!00p`-@-8@0StP0S 0!00p`-0PplP/ "!p`-D 0P/|\/Q R/ S  !p`^-A-pDQDaW0S 8PP&10S" z@P䀟* ܀0S !PP*0S' d@PpG@@D PP0S N@P@T@@D@@D@(|`0|`̎`A-`qAVU 0 R0SN QP 0RCC OPB\10S>0 40SwP1`FOP 00S0 Ѐ0Q^POP 0S 0 0OP 0S0 k|`(|`0|`̎`G-`PP= PU: @PP6 p00P ԀԐ0P) 00ST00S  R RBP   0]0 000000 B|`}`(|`0|```O-,M 3p@w0$00OP 2PU 00P D3Rn`xpT\ʜ2@@@ |20S P Xb0 Z@DB 0  0p 0@1 $0 30s Tp0 000 0S P @P  P0000 00   PS(00 00AU`00 `  T p?x`X Tp{@Tg0@Up00 p }NP d0@T d0@KP , @ @ ,Ѝ^̎`$`Ȏ`(`{`P P00Q0QP/( S0/Q/0(|`|`,|`(0( R/R /,|`|`PA-0pPP0SPPO`Eက<0 AQd P 30 0C0 |`0|``p@-@`PT$0@@T v@p(|`p@-`Px@0@0S,0& 0U@ p@w}`0|`|`p@- pP0ll@Q T00SH0 D0R 0S000Pp0|`(|`|`^^H^p@-@PD0DPp @DTQT p(|`0|`P`@-8@ 0P0C0000S00(|`P`@-p@ 0hS  X R L L  B/o"0CS00S00|`(|`^^H^A-@PQMP 00S ATdA TPTpTQ``T `@o @Dx̎`(|`0|`p@-@P#MP 00S p@Tdp@ TPT0 0RD00SDp20@P;@̎`(|`|`^0/(|`0 0 /|`(|`0Pc0PcO-@-hSpS00?g(_(|`|`L`@-@@p@-@Pdp@ l 0s`0`0S Q PP @T?S00@p(_(|`|`p@-DP0S8 @C@000 0 p(_0_L`{`@-@D00S400@@(0$ @ 0  $~`0_(_L`{`<5. 0@-@0@^^@ 008 0404 000S @-s/^^^`_{`0/^,00S$0  P/$~`^@-Cm0    R  \`00        /\`0  /\`H0A-PpHX `V@@P\`0/\`40 R  /P0//\`0/\`$0 R P//\`0P@ /\` 0S00/\`0000 @0RS/P/0_\`p@-@ `lTP l\@@00`pP p@-PU D0 0R :@ *^0"Spp/x`p@-@PpD 0Sp 1CQP sl'p\`p@-@P P P P@pp@-HMx1`tA0D000S4  R0R' 0P  !\!P000i!0?c2Al000u0 !1P0 D0 30 H QS 0S S0:P 0l1 0AS2 lPPHЍp^\`0_&Sx`p@-@P ;PP k0@0pG-@Px0S pk0Pakk{0Q`\`0A-P0ap@0 T0Q:P 00@AQ\`p/p@-\\00p^pP@1SpPp pQU `V@p 0\Tpp1\`0Pp@-HP R @T  B!Az00C0p@\`O-ĀZ`P @[[00â?[0P0SpA`P  F00TU Kpp0!1B0 0C0\`A-PO`V`Fp0pVP0 `00C1Q01@@00@\`0_0 R ` /\`0/\`p@-@DP`0S0 00$0 p0q0a@\`0_0 \'\0/-\\^ \00\'\0A-p@B``  j0PS@  L0:   @[SO-pP@U xP @BPB`0 PU <P  0U!<U0-S@@0S%  0<S `V PP`* @P'<S @&SP<U@0S  -S @>S&U|S>U(SP<U@P)`1X \X 00 S@@'VU U (XP XPU`V XP`VU  gP 00(S@P)`  [P VP``sR+S1S4_5SO-PRqM0000@p00 0R `C0R B RQ00SЍ+P@00S"0S 0ST0U Pip`D 10C 0i K0   0 0 1@Q 00Px`4_O-M`041 0@@000p k  PR R0TP Di T" 0S0@@ 0 30! E?P R  P@@ \R0S@@\QQ`` Ѝ^̎`O-Mt4 l$0000 Q @@` Q0$0, 0 B]P@ 3 0 30 E-R  0 B R@  00C Q 0 @000Cs Q@rx3x#0 0Cd?S@ppPZ V?P R    y P@P\WR Z Z  :Z R0 Eh[  d0W 0 0?SPP0RS?WB tb@T hLba 6/P02 00kT- J/o" R-Z  P1P P0 S 0 S ?S  RP1Wxa`xa 00SC <1@P00 FW5 $qP P  ^0Ps PP@+P@ `VP`XaP Pwu r@T@D@|000Ѝ^4_d`0_̎```x`r.>S` r. O-@p`PPP[WppGT@@D$WpE$T@ET3# UX ? S T@ g@ Y Q@T `!@@ 0 W@ 0  O-?-M0000Q,0 ̏@Tge,0? 0 30 D넟 PgP@0$ 0RXg0`0@0@:00@s00@@$00$0 0pTp" C'S/o\p" $[\0  TF\Tp W0S 0E S@Pyg@0 p 0Tp000H040000T0$ S,0@0V 40S00S 0TP"`Coo'S b 0S  TST0  R 0T0TP0p0S$ =P l=0S` P@T?0Q0"  &Q[ U0 GP-STT0  0RN :=WQ 0B 0P RZ  7P "Z00S00S/ 3/P T0 0\S"ZTP "S`f V \S'ZZT'STU 0TP U$ B/o"``0E S@Pf@ 0 (p0S 0E S@Pf@ p0 0'<P-;0S)Pt I00`  T0p tmP Uʀ0PIPP|f@ t00N0T0X0@:T R 0S 'W, \W0E "W S@PYf@0 S@POf@\0 00 00 S b @P>f@"0 00 00S 0E S@P-f@'0 00 00T0 0T00SA00S- XT0  S0T0$ B/o"T0C e p 0   Uʀ0PIPPe@  00t0E S@Pe@0 00 0000E S@Pe@0 0-0S 0S+X 0SQ% 7P $0CepU Uʀ0PIPPe@ E $0T0| pY0E< P0"Y00S0S 3/P0S'0S" seXp W* tP 0\X0pD6 \ 0r q0p0 XpY 0 P ,0P 0V#W0X0 X0:S00 %QXPM .el5XuP-QR $QB *Q4 e pn9Q /QS  000Cs Q0 ^Q 0*S^S  -^S0$$QPX0 q000 P X$PdH X(4P!X 0{-S 000A ^$Q0 ^Q0!!0 0 Br \ P dSpX0800H0(0<0 0b aQgQ!0X00 0&QS e0As R!SZ.DZ.DZ.Z.DZ.DZ.DZ.DZ.DZ.DZ.DZ._._.Z.Z.pZ.DZ.DZ.DZ.8Z.GQ0X00<0x0(0X0 P /PPX00X0/EP00..<P 9Hdpy XsQ*Pڔ:P1X Xh XhPX00X0 X0X0<100qP. P  $P 1 X00_$&KP ( 0c (0$R+ 0 0) 0($0XP0X 8| 0SP 0S c 00^4_x`̎`DS`!gY``0&S0 Q@ c@ 0  @ ^0@  \S0&S Y@ c@ $00 0XXq0L0@ X00S 0S C SRV@Y  0R/ P+(0 0C0D0oc ( $(0 CD0  0S( (0 0C@ 00 00D0 p 0R 0S,D0SX0 :R 0CX0(0SI qS @<0S @ 00@00D0<00L0q00H0 p0n(0xSG  c'S C SQ0Sb0\' R# 'p" P b  00Xp000 00S 40H Tp040'R 0C C C B R\Õ ٕ Ä ÕÕ0 m  Uʀ0PHPPb@  NЍp@-M$1M*`000 9,P0 `0  C|@ bP.U0-  a0a0da0ڍЍp^S0@-M0 MP*@000 +P0 0  CŋY(0 0 30 >ڍ Ѝ0^p@-@P`PP @ $b`P4/00@pbp@=HSO-M3@RpAb0|004`PP& %P  R 0: SQP @-&p `U [T WT2 |0 30 A>@40Wp0`C02000 S  P\ ` F)T h+0 !S P Q  0C00 a R)  S'P`/ ` $1 p)VP ! `VT ,`P  `T $+ 00 R Q R  0 T 0 0  0 F 0 0 @[Ѝ^d``O-M3@s0|00@ `P !=&P &%p 0: S 00[Z (V T @D0{PPTPU 0[ ~ (2 |0 30 f=@@P  &P y( 0X P 00S #ZPa8  P[P Z1U80 0 * 00S0 P0 0pp00R#3 ZPԑ0[7:!U1  $"@~0 P! P  8  p YP  0A S P P R( Q *[ P K R 0P 7  Jp Wl0P R @ XW p Ѝ^`x`d` O-M3P㌣p000PP@y 'P!-%p $p 00$000: S @'?oXK20S U@?U y2 0 30 c<8@<0t``U`V @v'@.PP@ k'  j%@ c'T { q@pP pG1`D`00Y U :[ `K Q0 Q37   0U:@N K R  0R7   I`0-A`$p 0 C DA%P@@p t#TP @ &TP @@T\ @U  )00Tp`Ѝ^`x`0 ?0 ;d`O-PP<M0@0 0S 20S SpQ{@C<  `W000oJX10Si 01 /oV" R X)@D0S W P@ V 0R OP@ ЍX0@ 0@00 S@W P JKZV  Q $W P D @V P ``d`A-`p0@P \R % ^@0*SP*00C0 S*R*     EVP 0C\Q bSR P 1 /A-p`@jPkp@c\@-@Sa^0D\'   R ' 'R0  0s@- X@PT`09@ *OP0 9 Ѝp@O긎`)HSpSzJp@-@P Pp@P !^ , p踎` @-@U% P +@L%_P @P#PP/%0@S a0@SO-`P-@M1T000@ R Pp pW 0Sp 0Sp pEQ@|1 0 30U 3: 0RN @RT @D0S 0S@Y  G 0@pPDQUp @ H 0p00@ pU0S 0R00Y 0v0PpP@ЍȎ`^p@-P@]p0`0SP 0SPp3P 1!pTpDpppȎ`G-P p@P `$P00T0S 0 R0S Q0G-P-p`P3:t@TD0S 0S H OpV@ P@ @Ȏ`- B R ^ R@-P0@`0 000 R 0S 0S0@ST @0  @p0 0 30 "9Ѝp^Ȏ`C-p-d1MOPR0 00$ `~0p@ T@PEU  PW P 0 0@Ps}P& 0 0 30" 80S 0Q 0@W eP PE0 p@PEP@Ѝ^Ȏ`\A-`PPp@ @T ;@P7E\Tp A-@P1 0~S #2\A0/SS4P AP\` 0S/S耟0S 3/pP  @?=0P'P0S[P 3/pP  PU @ =HЎ`O-~M`@PTPP[@2p~WWpp [< Y0P[@ ` p9100 0S300/S- 00C R Qp0 |  P0 B QpY 0K 0c 0P0 i[ `0 0$pP  HXP[[@  0ЍD_X0!R 1R0P/R$@-P//d_eT0 0\z{`@-P@d__l_@-P@L0S P  d__l_p@-M2`B000000S Z03/`@P 2d0S PMh2P@TwPEP: S p,2P( <PP: S  tPg  nPcI hP_0SaP P S520VPO PPKLP IPPP@T@ AA0S 9P OMKIG0 0 30* 6 SP  SP  S P  S P  S P P REP~ @zPPPPPl0S PЍp^`d_؎`yHl_@-(@0S@d_C-P`@pDY .X...\\ =\ \ :\ Ph^\P@ P@R @x\ W\7\;/\0L@|\@ ` @TPTP`X@L TL.0.0.0.0.0.0.<.0.D..0.0. ..0.0.0.0.0.0.0..0.0.0.$.0.,.0.4.0.L.?\ @0LyY`@}P0LF\@\0Ly YŒPaLyYŒPWL eŒP7L@@Lt@>TP o?\p @G-20 00DP 0@S h2 T2 0 30 5D@b P:1 P6 R$ 0S:S'Q:S S0PP0P Y0@P  0  00P@ mP =Q  Q |0  00PPQP80jЍ^S؎`-O܎`d_SSBS&SP`P/:O-M1p00010S10S @1 0 30c 5뜑㘁03/1]WPPE }W )W(0 @[0X!`@UV  V@`PE{0[  0P 0`V W@ R@Tp @*``p%401 & 0`0P2c 003/0 00%`[Ѝ^$~``_(|`0|`_{`@B$_ P@- )2 ]. }* )&| ]p"l d@}\)D ]H4 }8, )( ] `_.@^,. 0S0/$_$0 P0 Q //00E,,0P0/ R/ 0X000/p0 /G-@PQP@P 0D, `VP0S0S0P  ,0S 0@ ""30``@ ,S0U,S 00 ,R UpP P `P,0 0,R ,S Rc/R B/R00 @-( %^V&$F%A-@xP`pP Bp t 0L 00` H 8  L 0  P (  T  p0X 0X7@-0 B@ R"")#$$Q(Q\00U P^!" !4/ Ѝ0Q(Q(Q( Q(\00T^ D!"0 !$n0.D%y*D%\0$.vD%7@-P@03/0UF "$&(*,.02 Ѝ0@/xph`XP Ѝ0?D%C%C%C%C%C%C%D% D%D%$D%4D%AD%)D%6D%QD%lD%D%7@-P 0 3/0 U/ !  Ѝ0@/|tld\TLD< Ѝ0L%'["C%C%C%C%C% D%D%(D%XD%aD%D%OPNP/ /@@P.GIKMOQRTVXZ\^_acegikmkmoqd/n@PP񏐬jYZ[XY//|/t/l/d/\/T/L/D/</4/,/$/// /////////////////E%3D%B%B%B%B%B%B%B%B%B%B%B%B%B%B%B%B%B%B%}B%xB%sB%nB%iB%dB%`B%[B%fB%cB%`B%]B%ZB%!B%LA%@P/+'#+' #"///x/p/h/`/X/P/H/@//0/ᢎ&!JA%DA%j*2A%+A%%A%A%A%*P<P/Pwac acdfe//Pa "$&(*, *,.02H/@/@P,/$/// //////////////////|/t/ @% @%# ?%?%?%?%?%?%?%~?%y?%t?%p?%l?%l?%j?%t?%r?%p?%o?%n?%o?%?%?%>%@- BL ZI̠L03 N0 kQ@-@>QQQ*AQ񏐨1-? 2  Ѝh$A!1a! T PD A2 QTP$lA!1$# T kQpqxw^]\[ZYXVT~~ML{tsxwvEDCBA@?>=<;:n876543|10/.m,e*)b'&v"! omjlh~}|{zy vuta`Qi AR[b0 0 0oZ0 0 (P  P 0 0 P  PC0 0 PE:: < > $ / H8*   PPD 4T P 0 S  TPI 0P P PP:S  @PT8 RS CSoP0 S QTHTꀀ8P M G-@P `p 0H Y-X   ꖎ(0Hꖜ,0L0I Z\ZH1T @,^ P@O-M` 1/0 ?0 000D 0 0 V$` &.( /@ P0 0$ R"4 *&, 8 V$ B, V$1, R"< pW   \"\ \R  BRS  B R\ R R R  R0S $0ŒS40000Z S0<0SŒ0 (0SZ00S \ 0 0 00 =?\\Y  6rX00 QFV& V 0d00h0V8$03F000002 ─00 ᠀V(֊4+-\4崜 Pv0Zvpnv0xl00XP0 F2H‐0@ T0 000D00p?0@【A X V88t0A,s,d,F 0<00C@06x000 0V(R000 0 0|00L00;010 ;RR 00R0\0S , RY  6rX00 Q K*\8 R C%RzY@Y %Y\ 0I Y0 a0xS_SGS>S'S 0p2 S A0I9S=63>@SfG;_5/R8 $KY0vpp0#(0 !5/x0S `0 S0pqS$0pgS W t T05/0SP5/@85/0S: W2  5/0S 5/0 l00P03/p R<00S 5/[ 5/'(7 0 0 30* -0ST00 <' 80,' t0S0 5/<00 S@05/80S^ 80S!0, S00!5/,0|000!5/0S0` 0S0 R0S00"$ 0 0 0@ S    x50 S S S\TLD<50S S S 40 S S S`0 S @S S `0CS3l10R-*)(&%$#"!"?0CSW-:RS VS$ QS0 $ 0S p0uRpL RL0# 2#p#p0 !5/@H <4 5/̠ <@1~0>0 |@`^:\<`- 05/~7gW \<`t-p0 p\<a- < |0( C R2  01"0S01! 0"y! 0"r1 01<#j1 01|#b ^0S񏐊}` 0(1I*E).Y&1%i0`.3%/1%1%l$l$-6%3%1%w%00%*/%/%/%/%/%/%m/%c/%"r~.%.%.%{'.%.%.%@**#)"7*Z%-%_"*aZ%*&5(]*&r%,%tc0<.",%",%k&-19ah@B{+%R+%1+%C&.+%*%l."P."4."."*%%'!M&M&i'%%'% G{(&%@7C*l%b# u]0Ȧ.'%%%'%a`$\\00.%%a%%_$)%%%%$%ã&iJ&LIFC@0pS  p02c 5/0000CS񏐫("yY0 0d yY00s \,5/,3QyYlQ 05/5/yYh0 d04QJ0!0S S  S=S8 D0,0 _<2 $00#T"T0 !5/P0S  p0嬠Rl0S  T00X H0bH0X B2$0"0 00!40S S (\05/(0S@5/0SX~h\05/(0S  ( 5/  = Ѝ7O-04M@`P?pW| 1  RV3  0@0001F!@> 0   V$"  0 010  &V2 1,0 R 00S 04ЍO/%R00 5/p0p0cSBBS%SC 00Cs R>p  0A P-Q ?Qn 'Q0  :C0C S$8! BaeS  sS xS< ͔H5/8500S (%S2 1"5/500S $S2 1"$v0ԄԔ p 0,0"0&p 5/400Sp xp400Sh `$S2 1T"H4 00#4$40 ! 4 00# $ 0 !Vt5/3 0 030$030(0 R 5/$0 0呒"( !5/ YW' R \5/P3H D302#<@ 5/X (5/3H 302#D 5/GpX R 0S9P0 3/000000 9!00A  0B \Q pAcRwpGVsH WR/ BR5 HR 凰 !"0BaR0 P03/rR xR dR 5/1 00s#!0 ! p 0q'qG yP03/ၐ儀p01001"   0!Vp 4Ѝ.$%H.#%I&H& %l1x."01<.""1M%Y&e"1Y!%p1|.J!%xW0@."DW0 ."t(ؠ.V0F"@##PV0(."# V0.Z"3 )K%O&&tT0"<.&G%Н.N"B&B&0l@-Q Q Q80@/ .%t%s%L>O-`DM0h04>@00000RL0 4S4dd=-&P pW L0 \ 2P0S]V8001V(000V4<00V0H0V4 02@0&8pւ00 @ <10<F$@S8X|0! Q 00G/X  !*G/ 0G/d0XT$#" 1 B<q*, TB0,." %. %% % %I&!O-@2`0S?Rpp5/Y( 6[S X `" \ 05/Xk p8" 45/(5/P0 p3/" ! X !  05/! 1 T82#!0 !5/Y45 STp 6WS00p X d! `05/ H! D5/Xpg,! X ! p5/0 !   S TpX  05/  X  p5/0 x   %* %u*% %])*f %f?0. %u* %)`%*$!Zٔ** %* %Ɩ ,0\1 \0$S0aSdP/.PP/aS0 tS000//O-`.M> 0 @000D0x$0000 PP0< + Pz >0Y .= 0 0 30 0ЍO/ \\$  $ $ M P\  Fà0  h0v00s2^4000?F20l0&>00V 0X0XF" pVt0 VD F&4HFn@pn\ W^ p,\dO (  x  8 x 8  B| %L S C  %R$ 0 1$0 %0 0R`0v0&.10c 00T0P0;010 R00S 4/Z x+H; 0 0 30 !%R0tS@S%SR 00C S0 0dSrS xS 4/2S99A0C3SPc/d.j<!4/ p$O8OS200S0& S 0 S 4/S \) X04/ @0RX P03/) )  4/Y80<0800 D02"<0 !4/00L S0* R 0S 0 4/ @0pRphd 4/ 0##< <01 4/Y,0S H0SR 0 4/\pYx,0S70S 0##< 01 4/YcH0SP0p3/0000p00T0SQ 0D"84/(7 0<0700700 R 4/0 <0呒" !4/ Y< 4/< RW0 0 04 cq"R 0 SPh0 4/4ph R(4 4/: S$00 A6S5 D00#%0 !4/00S 0S d0 4/ p|4/l4/,0S 0S H 4/4 4/pP0`3/0000`0R40 S ( P(  4/ 4/ 4/ 4/ tw0`S0SXo P  P80 QS'So ?S| R0CS1CQN/&0S 0uQ PQP0UQT RT0P# 2#@#@0 !0000 4/p !4/pq  4/pp "S  0S 4/ 0<0030CSX 4/<)<2c 4/0l 4/lp|0S8 4/x08 (< P$(  t 4/tp0ЍO/0l!$0 0 0 306Ѝ/8/.ԫ. /%%-*).%p/e%%L%#%*%ҏƏ%.702%%$%r%@+%"R(.(50"|d#o $%%5&30}.${$E7$17$%s$ "$ $)*"&"X*o$B"G$00z.2"x&x&x&$$&&&rG$$"$$&=%L/?O-M/P0l0 ? 0Q(0000l?00p040000`0!8D0Q8$0Q:P0Q:0000Q:|0!>x0Q> 0!6\0Q64000 R S00T00RS00X000CR?o2t00)00h0:L0:,0Q6 S000Q6H02802<0!90Q909d    003@03080# 00>00L>0000(0S, 0 0 0Sh0 )`Pap0S AZ >Z<Zp} 40 S 40T0JSp@;sZiZO0JS*@1NZZ1ZwZa@ pp J@2p ,0Z Zn @ pZj0J S񏐉,?,#C @ pfZU0J/Sn*lk@?>gf;:9ABA@WVhMLKXWVoTmRONgfJIHGFEDCBAg?0JS񏐙 J R@2  < R @ p0JUSRPONMLHJFHDFEDCDM@?>CH;:9LTdj43kot.-u*}('#"     ZZ!v0JS)@# S @ pZuZsZ=d0S ` 7pJW4)@'70n W @ pZ  J R#0 A R RH0S<0SA @ p 0 Sp: \0 0 S0@@ pp0 0P`0 Se 0S@@p pfZ-$0 S,0S p3$0S 0 0 P p3p#@#@3$$0 S,0S p $0S 0 0 P p3p#@#@3Z $0 S,0S@p pi0 0 i0@0 bTp@ $0S@@p p0 0 Q0@0 JT pp@@$0S@hp h0@ pp0Sg}T0S X0S t@@Z@@T p00S 0 0  0@0 0p0 TT@@`  p9 0S @ 0 0 0@0 0p0 TT@@ p p=0 Sp Sp 0Sq 0 0 0p0 W p p@|0S pp@@0S@@p p0 0 0@0 T00S p p@@0 0 0@0 T* P0S p p@@P0SP@ 0 0 0@0 0p0 {TT@@ p p$0 S@@p p0 0 gp0 `X pp@@0D`0 S S pp@@d@ pp@0JSurqp%{lk ihgfdcb  w JRl0Rb R Z Z X00S [0S 0S=`@00Sp@0S% 0 0S0S 0`#0S``V S`0S7 0S 0S 0S0S`0SD0  0D000 S 0S` 0S`EZr0So000//1.((V c.$1@P1QP@M1$m1_."^.N"@$$$^."].f"].B"]."].""e$;l!(u% %Z(1`&k!E' %%$$$$$$$$!$$$$$$$$$$$$$$"+!"+!1&=%Ƀ)$$q$F$|$$_$$80L ;00 S R`;T080%U040L0գ%Ġ0X0X 4000@0-0  U4 0 1  Ed #     ㄠE  զ $4| D@ ,   U$L @ UP8@ 0 ` \ 8xD q!p    Dɠ  @<@ 304U130413x00t01h001p0E8 000 0\00U@0@a30U1 A0(0 R@000S @ 03/T uV  840P0S%T4" \4\$0S`00S_x4x$0SZ  S6ST$4 R0M $SJ U4ZUE oQ`R`` 800SL00S M80%k`<0S}%4 R 0S`0S)S0p%S~d Ru [`r 0Sm 0Sj 0S`0S0SG00SB0\%R(0000(00wS~AS%ST 00C Sw00 P00IS@SlA0CShf)dca`~B0C5S[YX(VUTSRQPOMLKJIGFECBA@?>=<:%476545?E0I,+*( 03/000(0T0S 03/700S ' S2 1"03/0 $8 $ 014,03/H \ 03/` ` 03/ 0 0 BR񏐺'/$,4'$,(| !,3/( !,3/) ! ,3/0) !<,3/L) !X,3/} l,3/wu  d 03/n0 09R0 :Re Ra #&\(Z*L R R R 3/N3/J$3/F03/B<3/>H3/:T3/6`3/2l3/.x3/* 0Р0 060CS"5p|00CS " :/  :/ :/ :/$ :/4 :/D :/T :/0S0S S S  :/ :/ :/ :/0S0S S S  :/ :/ :/$ :/ 0S@ :/P :/0 00I@P񏐖  :/ :/ :/ :/~0 0AST0S0St  03/n 03/h 0S8 03/_L 03/Y`- 0  0R|3/MRK3/G,0SD  03/> 0 Р000 00CS/ P0 :/#$ :/P <00000 :/` :/ 0D0S7 P0 S8 S;S80!S9 0PQ4$Q*@ =L \>̠ Q Q Q ݁S 08  H0  ;/Dx0 0 080 ;/0(0/l0 e(0 0-;/X 0R0 < R4 R 4 l3/4 2"H3/H0S$ 03/~ 03/xH0Su  03/oQ0Cs 'R'S񏐉W~}|{zyxw/Dtsrolkih'Kecb0 S@< S 03/4-  2#-0 !03/%= 01"03/0 -0# 01"03/ 0 R@ `-  2#L-L0 !03/  0RR}AR6$RIR`R S:/̟ B, R S S:/r B v, Rx, R S 0CSX:/B BR񏐴rCV@?>=P%BJBv=RS S +à# :/ BR/R}SN SP Sw\:/sRqR<˟S B,+f S%:/`Rz BR[ "(iRS* 1,:/H:/DSB:/>S<:/8S:/2S0l:/,`:/(T:/$S"3   $:/:/ :/S S :/:/:/:/S:/S:/ SU #  t:/h:/ S 3  <:/0:/$:/0CS :/:/0S 03/0S 03/8  0002#(0 !03/0 0.0CS p @ 03/h t 0@ b3/{8  00 0'0 !03/j0Sf  03/\ 03/V 03/Pl 03/J 0 Q0 R R?,3/; 3/7Q5R2 3/*3/&3/"3/6  02#&0 !03/0 0w CR  ~SQC QZ WVQ/ РQ RCoS 0S +Q  :/0 Q C c0  Q C c ( ( 0S S S` 03/L 03/ (5r&$$00 0S 00 0 3/0@0 03/   03/ 03/ 03/| 03/(000w`$SX4$ 0  $  R R  R $  R $   3 0 $300   #3 0 0 30   Q    R H30 0 S00C?o2$# 0  0QW Q/ ;/ Q @Q% ;/ P@ ;/P8t0 R0`PT@p#X@p 0@T.> 0 0 30' 0ЍO/ [  Qxxx.[   R V P. > 0 0 30 [%R}p0aSu %S 00C S0 0pVSnS/ rS dS #pSW |5/QSR0CS*40 S`#0 S`T= 02#D-D0 !5/00S-  - 2#,0 !< 02#,0 ! @  R2      0 5/ 0pP0ЍO/ *  R[<_0:80,[< S;K00+0; 000+5[#000[=`%?00?:00P0&:O0L0[80[4P0{0 0[2T0+8 6 B @/o   + "XX  :0W@ C0 0|0[0,0+2[  <\ L{ ${! t   \   $~ ((0n+Ƞ q  `$[d A0 xK@ h[ lSC 400&<Ao;;{ 0 0D000S+0-0H0001p00S 0@000P40800800 R00S 8/0S d(7 0 0 30jD0%R ,8/@^000%0CSSxRvutsrqponmba`_^]\=U[`Ytz\NMsnH}T=VYA@?>=<e876543210c`-,+*i('&E8/0@y600S &S2 1x"8/d600S TL600S <&S2 10"$$ 8/$Pt0S P PPPPd 8/dP` 8/`P 8/ Pt h5 0 2#T%T0 !8/<0S S S 0S   @ @ 0Sy  ؤ`  D0@##0!8/00S  ,0RP`V?F0S,0# P0S 0 X2#0!8/T0S 4 8/$?P0 0CS 0`c 0`cV( 0 c5! 0S `@ 8/T8/0Sl8/0 P03/@< `0(3 0F 0# # 0 !8/ 00 ?o2R0S (0H 8/pP8/T 8/T (0H 8/pPl 8/ P80S S S0S $040 Bb@8/` 0 * S 8/40 Z00S 1H 102#< 8/0Z}P/.w1C.C.R.L/Q$M%R!M$/@&t$ /A.V"$&"/xA."/HA.ʋ"B$$1$% #mR"8%d ?k$<.l$X/%% $n1:.""dn1-$Dn1P:.$$$P$4$$$x/@9.ƒ"9$3$-$$$/8.$a#= )$#@%$ͺ$ݺ$A#$#%/6.$Ĺ$Q#}a)$n$\$  (/"#4/ 5.}$G& $}"۵$$ߑ%#%$]$_$\V*w$B{"K$;$YA*z"4&4"z"$rz"Fz"N$z"a%/..>y"%$,..x"$%%%-.x"%|/40Z00S  _0 ᒣ# 0!Wx0 8/ 0  0 X P0 |P0 P0 3/\8/h P0 P0 P0 L3/0000L00P0 D3/0000D0  0S  \0S  0  `SR@ HP ` l 0S 8/  8/  8/  8/ X S  l P\l X ' R 0S  h P8G@h C P =0 0WSg .DS[ 'S@q ?S=,2c  8/ 030RS SS,0 S0000S0004 02# $ 0 !rS cS; dS `S 0@0S0p sS xS  R401, 8/P  8/PP !8/PQ5 01$"0 `030CS0X 8/`0S8/P0 0[ d  w: `W%5 0 0 30~ЍO-$Ml2P d"  Z000000 0 00DpW ,0 {000S @G400S&  @0S%`00V   B/o" Q  R P2T S  R `Z V80 RD1Z Z>$Q:&000C?o20@ 0  00 0 0 0 30& c  \:0P0@0 00 S:P`F @@$Ѝh|/z/O-p,M@|* $ T (  HjHH` SPA (PH  PH /* P,@P@D R8 "   R yP U8 %  PP )  P ( PP:  pPU[ l =R  P h!%!P P< P (!%@^ ǟ  ( 0 8 4  D4` R00V 0@ ,P    RD@ u RBo0@@df @z  ?     !"     t h \ P D 8+ b  { \ w&   lau g c V !0 S* Z Z BT@!T0@@d`$ R    RD  ~ r R`eVb``&% 0 H R`Q  p  h E 8PQB0l@ 9/X0  D RT*4000S L@ 4/h$3 0 $0 30 y @`R P&`$ ` RV``Ra`  TT30V@l@0 9/ 0 PS3035_0 l 0 9/ 0RS_uP0S<>+:: Q R< H@0 X4/ 0"S$ 3P00@"0 <Q <000ZXW R| Q    s/t2r P0d200@T20T  2/PHJ0 ;/P 0弱S㻿{X >+ : R* ", R 0 0 P  R0 0> : [2"3Y  X R  0#   8! , 8 0R 3/V 00 <  < ,Ѝy/${$)./*$|\1X\1֫$ګ$$[1$$h[1w$$[1     ?06? 55#' 5##X1|0W1$s/@hX`V @T T T:\05!vpp0@-@ 4M0P 00,00 0 0 ,0 30 0 4Ѝ0@/l0 P 0P 03/< $0 0 ,0 304Ѝ0,l/ l/k%U%zk%k/ 0 0@-4M0 P@ 0,00\00L 03/8 (0 0 ,0 30 i4Ѝ0Dk/%?j///|XyX^O-@5- %TM0p `$04  00L00 R?`"(00"`' 0Qd`Z @ 0@[4P` 0&#@d$L4 0 L0 30)  ?dPPP ?> `Z 0$` ` 0 0? 0Y)З0P0 (000 00D000(0 0R( 0:0 00X300 00sQš@(c`{`R`00 0  PxA@doO0 00P`Q@@0 RZ:2$ @040 ,,P40[ 3/P0 00*0Q,0,0 P0$ 0Q@4 4P[,0 0Q 0R0M: 00 0000(00V(0 Ha@d`@][$1 ? 00@T0`P0ŧR P:H@X=00 0Q```T T, H` i@PT``L`` >bפGXj/Pj/ l%l%ik%zd"i/h%4f%f%f%^e%e%e%f%````$``TЍA-`@!PpPT@0P 0!PЍ 0 00tPP UPPT@0 0!Bf%/f%0QS0/{ S/ 0 R\ 00/G>bh!h1 A-xM0`p0t00!+PDP:8P^@P8   P@儗@W0`00 @l!0RP ?0@i@# sh P0 0 t0 30 JD@@<@@4@@xЍc/}e%>bפG3e%hb/d%d%e%P/@G-` Pp$@X( P V W O G4- `V U 0 P0 ST 04@0 Sp0D0 H0000@-P0M`pS xp0Q ^  0v@P  D0 0 Ѝ@P0`@>bפGgc%@-@P0S 0S ƖĖD0S $彖H0S 8帖L嶖T0S 3/@讖@-0 4 Q R4 H ЍA-Pp`P @Pp10p10 @᪥PTp 0S  ?PswV 0@0@P0 L0H0D00Pp10p10S@@_/dD O-!`1$M Ṕ00000H@SW pV01`0(00t1000 pP T40@H!01 0 0 30A `  0  `00 00``0000`@P [ t1Q dQ X!RVPP V @0%P@p1Q0p1$Ѝ(^/^/(`%,]/`%O-`@ᘱ0PT 0"+@PU 0>@ ЍX! ` @ R!Q0S@Xp! p!!00  Q U4 0 R U 4 R 0 Q:@+U@ 400(pS pp <籟 P X p ЍO\/(8O-`x#p,M @d3Y`0 PP0$00V  p U ` Wp10p120$030 # 0S $0S (P ,0SU3 0 R 0PU 00S @"@@ P Vf 0 PG0U0 000 0*WV  p W' p P   4P U *  0 P4Q *|V% 00Z#  ` pˣ`P  dPប0Z x00Z  C pX 0 !U40W00= ,Ѝ\Z/DZ/Y/dD <1;1;1;1@-@sqv000000S 0/@-00 Ѝ@-00  Ѝ0S G-@ Pp`!T0:00`  0 8/@pP /O-p M0P ` 0000000 B@P  6/P  !*< 40 0 0 30  ЍU/U/?@:S,17/@-P(X%W%x/0 @-@4/p@-@P0 3/P00p0@-@0S P 3/00S P 3/@軓\@- T000 00  O0 (0 0 0 30 ЍS/S/A-p `P@P 000S P WP`0pU 5/X 08/0p@-P`@ 6/P 5pA-@Pp`P冂P<o)P; 0 0 @000000 0S`)000 0R$ 0S 00R0\0W0  V00000! d0A-SP@`7pP> )0P= P  p 0 R)00  Q& R   Q \V  @q ?q   ! l0 000/O/0 000/O/`ƃ@-o808 0p@-P`03/0@3/;0@ pO/0 P0@o/808 0p@-P`03/0@3/;0@ pO/0 P0@o/G-p`pP 1@P@Ѝ)@P `00X   H  ցPI 00Y`PN/dhs@-PH00\`P @`00PPЍpP@-` `0 00 000 00Ղ0 (0 0 0 30 ЍlM/4M/Ձ,O-,MTPŸ@[ $  $< ,ЍO}TpS@`P!!'@P ᫓PP'  0   !PZP! 4Q ' !0 0 $0 30,Ѝ 0 0 0B`00000@ 0S0 S '00\0 0R Z ! Y !0  0L/L/K/d @-P0p@-P @PpU000T000p`@- X000 00@ @4 (0 0 0 30 2Ѝ@J/J/l@- d000 000H 0 8 ,0 0 0 30 ЍI/8I/d@- \000 00D 4 (0 0 0 30 ЍDI/LI/ P@-@P 埀@80@- ,   $   j ЍH/dhp@- `@yPP 00 pP 0S 3/T?@ T>@@pQ? Q>{Q?@- Q> UP@p ?pQ@-?@ Q> A0PT  R0@s0 ?s00@- @!0RP@p ?p((0 @- 00 ЍF/dh@-@Pp`U P VL0S0S Ѝ0S0 0Pl @-P0P/O-RM @`᩟84Pp00$4000S ( 00:0 Z ᄠ P0 0*RFl1V00 !R/:!!R- r, !0Bs'V'p l1V 1S:1!R r0!0Bs %XqWxpst10 0 l1Z@`0 pS PCi@P ! U0 0 瑟0PA xpQ 0S  ᄟP30U0:0  * lP  P B0U00: E4 0Q0:  0"0 00"9 P 0Sx  0 p P P?o 2R0SЍaH1V0:X !ppXmЍO`%lQPP6P7l1PPH1U1U : ŏP  B%PT1a`H1V11 I!S%|.@-@@(N0 @-@|@Np@-@ `0p P0jp@ N\!0X0@-$M@HQ P  0!R 4Q:!RP XP8 PPX$ 0 0 0 30(  R Q(Q Q#" G$0SP l0"hh00'" #$<0P$Ѝ0@/@/(@/N%K%K%O-#PM @3U00 002$PP "2 0 0 30 w i2 @0000Pt1H $1Y(ppPp1y$p$`P"@2 0 0 30Ѝ$2 0R "1 0 0 30ЍOQ$ 0S !1 0 0 30 0 `P0`0 >$pY 11SB 0Y p  $ 0 B"q0S:#$!00 00 0 30 0pG'qe0  a0Fs0 1s `V Y S %* Q:S: S*m$?/>/xX>/>/=/ =/A-p @0M `0000れPP$A0@ # 0 0 0 30 10T00X `- 00 800.  000Ѝ;/;/G%G-p M1`RP@0000y` 0S W6 1S E/$00CP T10H0䐔q 10 1@000 `IPP& 0 0 0 30) 1S . 00C_P0 00䐔q 1pEGZ #0 @10Ѝ:/G%G%F%9/OF%*F%A-p$(M4P `脟00$0001SC W zt14/05@$x4 0 $0 30(Ѝd011Sp   BRl RDp (4#$0$P(P :P5P @W t1 $P(P@"PP 0S W0S1S 1S1S%4W`01s @T0 p@ P 0 p@ P 1S D 0Sl 1S@ @T@@0S @0 PA `U0"," @P ?"2 02R R! "!0@ P SPD`0D0) "P!D @P"D00D0( $D01S:D`*X1S `,P tP `vlC 0 0 $0 30 (ЍA!W@41S*@pXP  p@X!8/8/E%'F%D%<8/E%E%C%D%DC%T4/ mp@-P`T@P!pt1 &`P@ @@!l1` H1S:0@1@@ 0 0@-M0@P000000000D!@tPXP D 80 0 0 30 Ie!Ѝ02/Hd2/ Q Np@-@`ppP+P p@I! p@DA-@`ppPP A3!0 A/P/P/ / // P RS/p  RS/P/03?0p@-P0@ 0C$0 @!( 0 B!D!Q, 00000 H`Q Bd Q <PPQ 0]dQp`!R  p@R>%8p}>%O-p!4M1` @00,000쀐00 0\ 5 0!5$ SQ 5 0 !5!R !RW PU& ?o!2 0 0X:( 0S S 0   P 0+ 0  0 0 ,0 30! M$0S S 1S 0 R0S 0 1S 0S0  0 0P4Ѝ//=%t./7@-Q    Ѝ0@P' $0 @0<%Q Q 0AS \/  //Q Q 0AS| 0ӓ/  / /L:O-OMD*@00 4(:0,0410,tQ0P0 9/ 0:|!0R R/ R, 0,( , `0000 00V":0SP | :t10t1 d9LP\9` XPB <)9 0 41 30< z 0p 00 $0 0W#:萔 H`P ( ,p0   G ƒ X,萄&8{/0 0`/㴠 0V` Z 0@ 0O `J @ 0h0 Pp` ` `CP(0P 0S :0PE,0U 7"0 0^  0p/` 0Wᦅp00F V`00ቜ 0  0018(> 0000z0   W 6/0 0!wp pp X 0 P ; X' 0 S7 X6/TT0 0HX E 0 V  W`F 0RSRwQ  0000000 0 00l`FV 0 .$0|10`50(00劈?l1003/0pP03/0p   0;/0, 0;/P X0N/1! !00uP0`N?Q101H10H1|P `P T hP #h0< 0H 0\ 0@ 0` 0d 0 pP HQPqP[PP 0 0S 00q Pl 000,0 00Y:DHh,X ` p{R003/0p03/0p`03/0  08/<0w, 0wp0'%/&%/b&%/<&%D/c&%/N&%&%tk.a%%E%%)%%/Y"%%!%!%s%t!%!%%?!%Z %p@-P`@MP`d@T \0<  P? Q P($?R p0 X 4 ?,, 8`@$< (0 0 <0 30 |@Ѝp /E%%%0 /@-, ($ Ѝ@-000 ЍL1/8/8/p@-@ `P p@j@A-@T@`PV 0S pW TP @{P  ?RW@OoB@%%O-DMl0P`0p00#t0h 0 3 <  PPP 0P 0PPx @ ,!R; l#h#0 PP 408$000(0 0$ (, P 4Ry 30   x8 0 S, P, 0S 2 0@' "p2 0 <0 30 ST704,EpP4$ 0,0D, P 4R; 20MPx 0 S 0 0000 0  S 0 0000(04_0T 000000000 S 5<40$041 0(0Tpp880 0Rp 0 P 4X 0 0F U0T 10>@0@Dp4P=< B@dDЍp /0 /D% %%/%%D%y%O-$MpXPL0 TP P T0S$Ѝ$1 (` @ 00PL0S 0S2XH00,Y% 0 S R P R 0S( hP  cPUR$ YP `H0 0T 0DRD0@Q!0 U 1P 0R%%%O-M@HP@  00D6 (1 $ `M `1w!\0` ЍR) 1P$ PR 0S(P P JD0 KS0!0$P p@0S 0Q0S0,P X0!T0 00p0 SR_%s%%%_%~%%t/t? O-P-0Mt!0300H C % 4/(? 0 3 30 V ` 0@0 >#0i $`0P0 ,P 0S uZ<(0`0(0VQU*` 0\000 0000(0$ 1( D000p1`40040,0`}0P0Y-= 0 3 30 ߍO  2/  2/ JQJ 0q r` Z !'&' ` Z  `P ``ar`&ba0004080t1 dQ 0 8PQ 0 1$0 `& 0Xt0 0,P E`$A`(>`PP K9~7~(X ,1S}$0SЉX 01S L  0 p00418 000001P80Z㐀pX 01S  0 00<00410001 P$0 pS 0 `0$000:P$0Zps 0$0}00 400$ R`Q$pz :$ 0D@|00@00,L HHPL 4P 9 0v9| @Pt0Sp9| t|0000$H @@PH 4P00(H @@PH |00 08 0000 p`a  0 00<0`00q 0 000@P% `p5 0P0U(0V 8!$0~$0D P40 400UaI 7%$0l003/0p03/ 0GS0s y   ḏQ P   pGP W #+65]$000`V0, 0Ug 6)$0$ P0000$ P0 00000 0$ppQq  hP$p 0 Sy 0S%R* y 0 000 00 p  … 0$pパ 5 0S P ᇡ!pg cP 5.$0B,0x txPt0Ps|,p0000 L0 00```PP`|pmt$4 0 3 308ߍajX1yt!X1\1 \1p1p1t10L t10S1pN1a?11>1111101828211 1 1$1$1(1(1,1,10011H1H10101414100111111j? 1 111111100L0L011N?1 y1111111111111<0<0111111v1x1x0 R0X `` h p a7  H H < `H``  a`a aaaa$a(a,a0aaaL`aaaaa\a0L p \` -d`l`t`% -! -pz PPtpt0S p|00 00|@ x ,0 _pPt_{]{ 0A//p/%%/%%%%/%%%t%%% %s%% %6%%k %7%% %P. %c%0 C 0, 00. 0 2 0 10S000000S00 ,1SX1S ,!R000000`0 0t00l0000h0$!P`0lpt` h00`000\0 0|00p0000d0(!P0p<0|P\0l< 0 0dPp0 0 0+:gjag ` p0:gZag  \ ńX P,1S㔡a0A-@p`4P P˳APUpPpU PPEp"2 G-HM0P0D00MP@"0p 00S 000 @:y`Pp1 @0Zq@H!<1 0 D0 30D G. @P4  \p@f0 07?z }P ZD0@0 #IYp'p RdPA+@0@0 0p0C 0HЍ$.%\.*%%%A-!P1` 00 00PQp0S14x@P 00 0 40010!1 0 0 306 0S 4040p0W*0 4p0Zp 000*pP T0 0y@0 00Ѝ.%`.%A-@`\P*p4P P ʭ0P0 yAPUpPpU Pʒ 0P0PEpP%w%0Po/p@-@PUp`uPPy@-@@IyO-p@P( xP`! U# o@0 0 0 Z _ `y yy &PP wPP P  E *`P  P1`0  H P l0000  P 070S/p@-P@P  Qp0p@-@S000pP Pp0S`60000R0Ϡ\!P LP 3QPPHP/0Q0#/P @-P%@-@H@EQ@-0 0P 5)p@-@Q1P 0000P! H0S R000fP00   HPK00 pPaX`P0 S pH8HP.dD``-)Q0@- P ɡ)Q0@- P 蝡)p@-PR @`*P p@F<pA-QpP`p0 @P L0a`SX T  tLLP  P.)A-`pW0P@PUA0S wP@- 0  Ѝ(0 @-@0  F4 \ " 2G- M0@p000 0 P  C`P1$0t`! 10 0 30\ b `l 6yPP H0 `0P  1A0vP  `Ew !0QS# ``i 1宆`0S0 0 0 S$wYL'LH0000` ЍL.u)$.l$G-PUp@j  P PT 0U  @0 P00`V" `T4 U  0 0R T 40U  0S T4U @X 00 v0LvO-`0P4@TЯp  F0PS ЍS `PP@DA-`pP[u@P  P@vЍ@-0@@0S LP00 0 $00 /D0-7@- 0 @0@0000P0 0S 00x00$l0l@% pL 00 0 0 30 . Ѝ0@Ѝ/t.h.00t$.@-@PP00 T H_0 00@ 0$C/C/@-@00 @@0$0-A-`H!PD1 p$0000t@P p(  k7P u 0 0 0 30. W$V pp V0 hUj| U PXT UV@pp8 ЍAЍ/..$0$ '))j ,0@-@ $0$0Ѝ@ $- /t1A-@P`p X1S, T @P % 0 P00t110@t10D!S"*@! @11p0 0R 0S Ac 0S 000 00] 008A-0p`@0P3/P0, 0 0 0  0 00 S@Pu0`S" B"0 "*04 0$$$$G-P@pT @P  P00100@H1Q 00 0 0R 0S G t1 l10& `Y003/P0000`1`X 003/t!00l10xlP3#/lP#3/A-p P0` 0000000 p4@P@6/@P 4 ,0 0 0 30 eЍH..C-p M0P `00 00000 Wpm4@P@ 6/@P ` 4 ,0 0 0 30 1Ѝ..C-p M0P `00 0000 p94@P@ 6/@P , 4 ,0 0 0 30 Ѝ.4.C-PQM `p@ $ 0003/P$ @P0SS  S R d0P#0 @ЍSp @,P@$O-!LMP 1$0p`x0D00p P!1 0 D0 30] p$@P t  08/PP$0003/0@`S$, 00$0003/$P$p  $v0p0, 0p;/40`00 00$ `-P$<04 0 0t 0@00 0 P`0VPLЍ..t1/l1SX%/t0 p@-@P  p@@-P Q  ЍՍ)@-P@=@-pP 0003/ Ѝ@-P `0 00 00Y@P 0003/ P PP PC P$@0M0@0 (0 0 0 30 Ѝp.P.@-p@Ѝ@P 0003/P@G-@`T5p pP PP   0 ` 0003/P Ѝ 0@000003/T 0$p@ppP0 0R 0S @wP PUpP00Z 0 000C0@4G-p 0P `00 0000 0 ~PF4@P@ 7/@P 94 ,0 0 0 30 Ѝ.h.p@-@PPpPpp p@O-T#,M@ P@3T 0P0$00ippw  A`Pr @P  0 P `F 0003/0@S`" $ 2   P$0 0 0003/ 0 z` `` 6/20000@ 0SP P 0p 03/`VA0 S `1p 0R 00 00 3P` `Y[00 RP MPP T0    ?P R `T0  0 0C`P `s V P P 0 S <0 800,Ѝ. .$$O-p 0M P` 000000 0 P4@P@07/@P 4 ,0 0 0 30 ЍL..@-@PЍ P3P s@-`P@(P 0l!P t1 Ѝpp@ P  l1@P t!0@-@T!$MP1p P0000`P%  P$P 0 PP0003/P 0@SPl P 0#, S(s0 000H @0 0 0 30 D00000$Ѝ\.P.Q3:\/-l^:XQlQ:X1S \:7@-P"p Ѝ0z@P 0003/@P$0003/O-"bפG$$:$I$$A-p`@#pT 00@0 P@ @    /0p@-@P H! R: g{ {'{ZU gP p@j[0 E!pPpp@-@ Q$`Pg$P$` p@L p 00 0p0@-P M0 @00 00l1S:X1Sl1P P X1Sl10XAT P @D <0 0 0 30 PЍ0蜡..A-P@l!R:X!RPl!pl!R:X!R@l!`1S hP A(( (  \P褠.d@-@ `0P 0 0 000rP0 0`h \0 0 0 30 0S 0$,00PЍpܟ.$.$p@-` P@ M0P0000 0 lP0 0Pgh \0 0 0 30 W0V H00$0PP Ѝp.$.[$"2 O-4M0@R0,00P220 P  E``L" , 2 <2p82`0 0P 0 + $0 0 0 0 1 0 0 YZ 0SXpp   0 0P@00P0 040$00(PY`P 0tt00t$10\(1 0d1l倱qQq2;Pul4Ѝ$...Dd(Ƚ$t! H!!/Q Q QX/`/h/p/A-@P` p:P V Q `P  #P6aiQG- `$ @t1  lH1|GP | pP( gPP  `V$` g$P 6$$e"e`!t1 Ha`l1Ha0`0W 0`P0S 0S 0 Pt10t1P0G-P0@3/0`03/V4 %0FSp$+$d 0 0Q HpP 003/P @ aGd V`*"pW$p`V` !`1t1 l! QXl1H!0R:/p@- @PPP ppp@-@PVzdp@td!H- G-0t1  1@S1Q5.:ЍGh0l!0 S#003/  PppQ `P 003/P  c 1 PUQ 1HSᜁt10t1Ѝ0PS!Mt1 !0   0ЍЍ/@-MpqpQp(@PP PPPS P!H1 0 0 30 R 0S !1 0 0 30"Ѝ@0DS0/0. 00 030Ѝ0`0000gp `V0a`M`L@2$08 <00.Ĕ..z$$ .A-@!p1M tt0000  0 0 0 30- uTP`  0 0 0!pP`V `=W<0@l1S # 3RH!@R0 1ЍH..@-pP!$M`S@   P@L!D1 0 0 30F &0S0Su UWPU@  P  R mP@ 00000p@ 0W:$#  b`}! !$ 0P$Ѝ.ؑ.@- Ѝ@- Ѝ0;@-`h$Md1@R0000 ) p PQ pP0!  2 7 P P 0!$000!00 0 000@p0  V$ $Ѝ8.. $p@-@Pt1  P`p@z003/Pt!$0 t!     pO-`!p1$M 0000t1  V 0P U W R H@@P a PP 0S.=c$P< 0& 0 0 0 30 J0 0<00p@l `0 0 0 30Ѝ ЍALW430.h..0@-pDM@1`RP00 00" @P  Pl` 0S.b$P0 0& 0 0 0 30 0 0000p@h \0 0 0 30Ѝ Ѝ@W"420L100ꀉ...A-pRP` @P  P P A p@0 A\@-` @1M00 000DS 0 0 0 30 RpP 0S  0 0 0 30"Ѝ@CP0 0p 0V&$ # @4 $0 0 0 30Ѝ與.`...A-P0pR,1`00 00% 00S0U0S  @P 0P' 0$p01 0 0 0 30 "ЍA<00 0p@ PU0P\P8 (0 0 0 30ЍD.$ȅ.D.@-` @0M t0000 VP 0S " 0 0 0 30 Tp  0 000 0p-P 0W*$ # @Ѝ.. 0# 0! 0O-p0@W@ t1 < PP8 003/0`03/003/V&4P" $`!DP Ѝ$ Z K r ZiPA ЍOZ! O P000SYt1dl0b`t10 @-O-P%TM@ 0 500x`0L00t1 %5 0 L0 30  "Pp \%P5 0 L0 30TЍO0U 0SP003/0,03/0803/,00CS $4 0 L0 30 4P $4 0 L0 30 $0402(0 P `<$$4 0 L0 30TЍ$ [ IU P)4Pt00$0$  X X hP`#D3 0 L0 30A| m 0P$000(00C<0 u<0Uo 00P 0S,0Z0C?o20S v(0 0C(00<0j<0p 0  R! UXRP00!$P0 00420Q,"2 0 L0 30!, f!4Pf0000@ 0PH 0( 0 0`P1 v0H0!$P(0U`QPPX00!$ 0 0001P0 0$0S  0B13  ! , 00`?0404=8 R <0t10t1 00  P ` 5/V001S 0 P 05/[ .́...Ā.h..$s$H~.$z$М$O-`(M 8<0000t1@  P<0P$0< <p <4P@$0@< <0$ 003/<0p$ 003/<0$ 003/( <L@P P@ZP0GS P @0003/(0P (p W$00(0@0000[00S( W0KS<0 Q0S ( @P  [0GS 6 0@p$<0GWS(`0,0 yPit Po0P40Z l080 hPR 40  2/80, % cPW<0 H00L`P0TPX@\0P G0G SV;J3:321c0W0P0S`0 p@ |`0 << 0p @$4 0 0 30 `0 V<< 0p 0 <xp  Px 0<x 0| <x0|sp t"  P GcP% 0$@0000000|0 0x00`30T |$ 0< p000 x0p0< [ppWD0$ pW <`2 0P"T0< P h2@0$0 +p@U 0 <xD<00 p00P$0 <PP 0<%p 4P D<4P '$0x 0 0P00 [00S ,qT0<p P 1@0H0 uPn  Xp@ T0< dPt[(0 << 0p0 tH Ѝ{.ۙ$w.$l$T~$Y$X@-@P`p003/@P\| Ѝ$0 p 0 00@- Ѝ@-`D!D1 0000t1  p@PA P 1p ZPP ? 0 0 0 30" ;4PW =jP[1 `0yP [ [t10t1 Ѝ,r.q.A-P!`1Q (q0t!000$1p  @sP A 0 0 0 30# (aP )P X PiPP  }PZЍp.dp.0 0 1p@-S`Pd @ XX )P p@0 Ppho.@-D @c0 0$0(0,0A-@P `PPU8AmZpkZC-8"M42@ 00000PPx1# 003/0@ S$/ % A@?, P`pYP8 0<0#0S  Pp` Pp` pP`P  0 0 0 30)  Pp0`10pS40 4  100S0#03V0S000VPPU Ѝpn. m.- 0 @-M00 00@0S @ :P8P880S8Y0800@0Y@ 80 0 0 30  Ѝ@ Ѝ/(l.k.0 88 / 0 s@-@Q0000 P `PP@ @D <0 0 0 30 cpY@Ѝp4k.j.G-@, $ (`LqPPp PxGa1  10XPP  P PWPV# PPx0 p00PP  P P\j.`DA-@`p,P,0 R!1P0(0bttQ Q R: ^00),,0:荙$h$}$!$$H$A-P 0p00 000 H`P}W@P  jP0 5Pl0?!hh00X < (0 0 0 30 vЍg.A$$$g.@-` @0P p0 000 0P 00Ws t l0 0 0 30 K @ @PpZ Ѝf.lf.RG-P R Rp@pA`P ggVP 5pp@pdp@pXp@pCfEf ypP  P`m$E!)A-@4!P01 0 0 00 JP !0 0 0 304 zPq^`Pp   P 4R PPPЍd.d.$$A-`@ P!0M%0 000,PPp0\%l00g  P8 R $8$$܄$~$C-p!1` P(0000)@  P @@@QP4 @ 0 PS :OP 00 10 0@PS *OP7^ 'BP@0[: O@dSP\SPTS @PHC@| (<,-TO-)LM9P @ ip0`0D00 PP8 880᥺Pt 8z~8P0 ᗺPf Z8 0猺P[ l8h8 0 ်PO 0 xPG $8 0 0nP= 0 f P5 0 ^P- 0  V P% 0  NP 7 x7ĻP dGP Up P1 @R018 UR 67 0 Pr  ! HPPPႸ60 k P0 :P 0 _pu4P pe6 0EP0$0500500,0 0( $ѸPP 4U: 50+(00P ,RV 0 SS8 8@.!p`$Cb$a$Ba$S$`$R$O-\M`t`0@0PL$0 D4D0p0T00B(4 @ 4糹pP P=p#3 0 T0 30 УDHP@ y?L`P0 H00 0~P 4[ 3 0m  00 D0p00P@z(% 040<0(020,0(08 4pP 4WZa0S{pXWpp 2+080@p<0 r" !,rWL2+H0 p~4662 0 *PnpH0 0@0$0$ 00D00  00P04P  p4l1 0D0  0000Dp0@H R, H  H ~P ,"R|00p!@ p!V  ,Q,KpPp0 0  \Ѝ/./.,_$@lL/.b^$^$(^$O$LO$]$\$[$@-p!M1@ `00002SPXQU 2ST1$@0g8!,1 0 0 30A WX1S PXa  0 P!0G,00 ߷P $P 0 ԷP $PX1Sb jṷ`P00N,,0Ѝ+.K[$*.[$L$lZ$TK$@-@P A@IG-`pPJ@PI I GXPP p  ᲶPp@-@R 0SP 0Rp0`d0P_UpPpPuD 3P,.pdD!/!/)9 O-LM0@ 0D000$01S )9 0 D0 30\ 51PSpɟp9p)p0  DZP At10t11S @p$`!P49 0t10t1/P +?P@APt1$0t10 ᕰPP 4U t1 0t1T801S 0(0400000(000 s,P`B 4P 7 0,P ]P@0 pP X崽P 尽᯽@0PP {P `$7 0PUC@CCy48 0 &p P 8p@0PWPPPU8 0<0<` ᧭80Q 0@ 0\60f@}(M<~8P MP  [8 0GP5 0H80``%g XpP(`W0 )48C@6C,00`P T5, 0,51 1@0 P -"40 <00 @0BPP 40<0S t4G.p0I<0Z:jj޻B ػ0 P3 0pB@Bj0 p0p0wP,媼0 PT3 0ᚻBP<00 @0`P t2 00T 2$0P<0U*PrUmP<0U:QPN0 PGGL20 PPKQxQP ! P [1 0; CB<0U*P7 PG PAPX< 0 P.|GPPv괡P  <0U:h1( < 0 jP/A@Aj%x00LЍ`.0..D0dDI$uH$ZI$G$F$jF$E$E$rE$E$B$ E$C$C$JD$=A$cC$oC$!B$G-p M0@ P̠`0 0006/PT  dt0 0 0 30 t1 0t1 P   @<0S@Ѝ . .A-`@ᠭ P -PPP00CS$H@pP,~,Q  PNyG-P"2 0,!0 000R0Ÿ20 ߮,P  Y "2 0 0 30 /tN$>$9:$O-p$4MP @4`ᰴ0T 0,00t1 0t10 DP0 0 P 4R D40bP# Q. Yt1p0t1#3 0 ,0 30 E0  $0Q 00 0< WPpP@A@@P @!H<3AT !4/@P 0 @忮 0 1S>@PP P!H0`PP L 0 p嗦P-p?U 7???(0S @$0@?(0S$? 2 0pttt PQPQ yPO>pP *0 PPAP ???(0S:@$0@?(0S$?܀pPx0 !R ttꘀpꌀpꀀptphp\4Ѝ,.,>$.P>$T.<$(;$<$:$z9$H9$N9$P9$O9$V9$z9$ 0 0@-$M0P@000T l0(0 "  0S8 ,0 0 0 30 $Ѝ0.9$./ R\/@p@-P@N Nop,0@-@@0.P.0. 1!. -0- 0 - @0O-@0p3/0P ЍP>U 0 P*S+`P  pU -,0PEP03/P PPP,᠏,+P PE  Q!0ZS c0000-00-0 P1/U 0 P1/ 00 O-P@v,Z0P@V0pP``0 0R/R0S/SSR  J0KR_*P@` `FM 0 R9[P ` M`@`[Y::[ PMP S*,>00%P P0P UV" 0 >>0/RV V.R V.R 0/SK P+L'L5$h/,/Vt'$/0@-)0//@-P`M pLMP*@ eP F %GD <0 0 0 30  SPЍX--@-`0 $MpP    MP ix l0 0 0 30  *@ $P F F P$Ѝ-3$D-@-8@*P0-@-80qQ020/(/@-@M P \ T0 0 0 30 0 }-P -0- 0 - Ѝ4--A-p `0P@0 T 0 00 000,@P 0@f*pP @-P@ p$`Ѝ-d#3 G-HM0pc @`<0D00<P P @#3 0 D0 30 ʪ dBP LP T  LP u00@ BP8B0BPPP/U U90/ ~PP00S. 00 ⹿`Q00P*-0S" PU 0:SP 㣿0PS0d` &$@P6P#UX 01SU 0/SR1 000K j`R0e S 1V  P:0Ce0#@Pm d  P I<`PPP0@ C0 C 0C(00 0RY0P@ DVd0 0  N0  80` OP  /OP OP `@PeHЍ--h-&DW$A-Pp`-PP @@dKc(PP  KJG-P}`PJ` 0PC003/pP= -0 _ 0/S P;.!R0-'P@ { 'P @T@P00@ E P !`P ( (0 )0(0Ѝz@P -0  ( (0p )0(0. .00.0-0 @ 08P `&@Pw*PW;00c'002 p", \ R 00/@- Q0  -@-$\B Q0: 0@H "!1 @-M0 p @0 00P P  9 `J_o -0Rp2-0JPPU P8G(PP  0 003/P  P  <(P003/P ,0@  0 0 0 30 -0 R 0-0n-02PP-0 ,03,0]P  0R w &$ЍX- )$)$P-h$d4 O-M0Xp @000+P P P $4 0 0 30 n0 00P[PU0P0 rPJPP 0ᨀ03/0P pl`T: P ]" >00 0  P/0 P:W apG W* 2pG S*  P3:!P  V : &P "` WH0 p 0Y/1 ZR0b   0 9P--0 0-09003/P 0 /R 0 S0 =00 0 9P 0 !`pCI 0 `0R 0`'`P  ,P&  <I<PlP BP0O 00P~PhxP `P-01-0PЍD--&$&$&$A$$.$$#$#$"2 @-$M0 @0000 P T"L2 0 0 30 J` PP~P 0P0P*P0h 003/PP "`v 0 P* '90p`%0P  P P 0k&0  00/`0 0S:00` 0 ZSc00 0 0 8~ QSS/Q0\Q`Cl$Ѝ-h-"$"$/O-$M@p0P0`0 pTV;*-0 0S - W0/S   0/S " pH0S`` $P@( P$ЍHY*(0 0 S``$ 0Pp 0ᜀ`82000200(200X - U R -T /RB ` W$P`GY :-`. T00 0 J `0 GS/p  0@I00-0 80< 0  0D80 <0C 0똀@ /R `( `Px 0 0 $PXb00Q]   JY00X00SP 000Ln$\$V$ 0  '$ 0 lP'A-Pp@p`T(P0 Q S  00 0@ Q0 $0 <@-u<@o G-p`P$1 0#R? 1R< /R9  0002 (F0@0S 0 0  PPP <;<P  5P@ D@d +PPP <#<P-$$ ! 1 A-00000S  0 0 0 300 PU  p@` 60PX  -0X " $0X (P 0U 00400Ѝ--A-`P(0pdFX :@ }IX00Ӆ0Ň AsI0A-(0  AP`pPh d  v=FX@8 VIX00T00S000$$A-`(0@PFpU : P6IU00ӕ0Ɨ @,IT.Q ToR0C C/3O- p(Miii?00tx0(0  0X000i?0dpP, (<  >X0  8K0 DF0 JA0 P 0E< <PJ E 0PD   P:@ T# 0S Q@P013/P@Tl!@1  0 0 30C p@P0003/P -0S" @ 0  0P0EX 00   1 P  X1#qm0  0 P  PHݍЍ-$$$b$vaZao$-$O-M`@ 8#P43 000000 0僑00pp00 `(0  mPh0 <0 0phvh`P"0℠  C 0 - ' ) + .  l"0  0  0 0  %`P `"1 0 0 30r > ;< <P0  X03/  PDPPpĀ00 0Z0PX03/ ~ PP X20S  o `@oob Q 嘐 <  p PpWU J X 2/ X 2/ H P01P Bp  9 P Ѝt- $_$4-(!1 p@-M0000(0J  0 0 0 30/ +PY e p7 X0 S<0` 0 x   ! ; 0"@` @P @  PЍp -- $/$ $O-TMpPx0`Pt"@a0 `@  L   E 0/0   0-P P"2 0 L0 30w Š( 0yK0ԑ  0 ,0 2!08 > 4< <PPP D0`㜀XY 3 #$*VQ g 0P  W 0  R - <`   ` `☀`V 0S t K P@_oR0 A  = P`TЍ-T-~$y $ (/ 0 p@-M00000S `V "P   "@P 00S L"4 (0 0 0 30 Ѝp$-$-,0p@-@ 0SP 2S0$03/p`PU0`V  "!0P8G-@P4c`;P P ;P : ;PAUA pAP 0:S  m;P H0@Q /o"Q R :Q0 R' P C 0.Si 7$Sh P$Sg +S S Q p@  GAP 0A#V$S 0;p'SI $S %S 0.,S -0(H ϵ%P@t00P 4 00 0$S1P@ Pu` @W7P*Q @4 @0  000S $   $R10C@ 0 1 0S0c040Y`0.S*00*S #0@   00S L#   $R10C 0 1  @R b`  hQ/ lQ LQ$ @$ 6P 0$ UPxQ7QhQXQ& !EQ. 0tP '5" J S iApA  pQ& sQ0P t dQ bQ 0Rt0 0 hQ"^ J +Z Z  PAQ -R@!7 J 0S 00S 0|Q t0 X S0S 0S 0S  ỴBQR@ Q J 0Q -   ЍO--[#W#P###O###4####0|/###6 |-#C#K#R 8 8#[####W#B ###0 R11 /@- P@ 0 R1/@-@P;e6P5 _6P/ Y6P) S6P# M6P G6P A6P p;6P \PH0 0 `#“###t/t/,00S 00S0/S0//,00S/00S0/S0/P/,00S 00S0/S0 //PT 4P V @-P,00S/00S0/S0 /H##)@-\ @\ @d@/G-`0pP00S#(@P! $0W(  002, 2 30 3 00$p !(4=04)0S@ 02E$cmE$ 0PQ Q Q!  /!P/0/!@-(P0S1@-@P0S1T PO-@p W 00S@p p0 $R.R @@4`P" FPPP v=0 0 uP *UW G:@rPP  _=P@D0 6:V` 0: [pP  H= D= @=P*G-P( D!@ h H@` 0S9p03 ;040! Y 3/0(403/D 0403/0D00$03/0403/0 ((03/D0 0(03/0D00;0,0P 000(DP$###G-0PQ    , `11 0S2/0@,03/0p ,03/T0`0pH 02/0@ 03/0p 03/0 RQ (/11 0S /  //A-p @0S"0`Q!1!1 0R XPP A (0 P P @ @D[#O-M` @000Sr0pQm!1!1 0Re TdPP 0  ЍO (0 T PO ,00S ,@T(@ 64XB@ XB0,03/0,03/0,03/000(p00pG0 00S @P! P0 Q4 00.2/0  4 2/0 403/0 0S. 1 PЍX0,03/0 03/0 03/00 02/0 4 2/0 (03/0 (03/;)@#00S049(////0h @-@e2 00 4p@-@P((pA-pQ  0S b00PR,00 PP @U*P`a00` D$2P0a00A-`pP0@Q @!*Q@A y 0?;G-Pp@ `0@ S *@00@@S*U PPp 0S* D 1 0;/p@-0@P  P3 P -pA-` @80![P001T S 0 0D0D 0 $00 0 30 kЍ䄟-D//Ѕ/-p@-@PP P6 00 00C0pD/T000S @-@,  @S@/(/(0    @-/w#K#0@-S@`P000P @0< 0 0U000P#h/,H/$  Q0S /4,@-@p@-@ PPPp@꼃/\!\1 @-pM0@0l00,0 0,0<,100P,010CSh0S1tP 0 0 l0 30% 2S LP {P004 0 (T7,00,0kPpЍ贜-X/m#-i#P!!(0s@-   <0@`S -0  PU 000S PЍpqP P!P ( ##{#O#/#P0@-@00S P@ z@P/D0@-00S P@ @P舀/p@-@L0P`00S V}P ` 0p@p,/80@-@00S iP @/A-p0@00SP VPU 0 `P@pP @`@/O-00 0Sp /pW@P@P(P000V 0S 0T 00S5x00 P` 0@PV  Ѝ~/@-`!P0DM P0p8 0<00 L P'x0@S 0P0Q0S }0t  X00 <0 30 IE$xP@wDЍ-#p-,0O-0@SMpP ,`V(`V` ZZ ZB ZT-0 P0*0  00S   `@BP @P P `@2`  PPC0S #Ѝ0 P 0 ,0(,(  0c0P(,0020 Ts @P 0P 0A /PP 0S # # #@t0S TO @P @tQ  86P g H####0t0  R 20090/O- R( & 0  ;@P$D!41 0 $0 30B  . " 0 @D00t`20  6+ "0 t`(0020 P  @X0pWp* 0t20,Ѝ-##-@-| |0 0 00000 0P 0S P0 (0 0 0 30 @Ѝ䔎-@-|!|1 A-8M0p@040000,PD! @ b , P0 0R` P!0 0 40 303 t R 00  PP V 1P   (0 000(00D00200 00P8Ѝ-##-#,0@-0SM (p@W ,0St0S00 ЍPp `P p  KP 0 P@-,@(0@T RS t^0^0 oP,  R00/@-_,  R00/@-S,  R00/@-G, \,  R00/@-7PQ/pp@-P@P PU /1P/@1PPT op0-aS R  R  0p@-SAAT Qup@/^ ^ )N R)*S\  P  pS\  R, popPpS  RpPp ^*S\  R Rp pSp C pn#)#O-@0`(X0pP3/0D@X0Ii3/0X03/000 0U0S& 0PX0 3/0X0@3/0SX X X x 7t  G0X0 3/@@ @P0 L0 3/ J  >f#!###0A-0S ) 2 0@`PT2S  R RP5  0PLQp0P  CB`P 0#}#,#0O-@ȱM`p1 0SV 3ccSD2`00Y (0 SЍ 0FS0 P03/0 P03/ 0FPS  *0 70Tq 0S9 q ȡZ 0 :/ P P* 0$Q Q* 2S*P4 0  X  Q0X D0 3/0 00H h00P0 3/ P t5 -9@0-90 0 +0 P03/0 P00##U#E##w#p&p6 O-DM0`\V0<0000L08@1P01 000 0 00T S'@&5 0 <0 30r \ Q (@ TQ 1  R 0@1 0S&P lU0P403/0T403/0403/858P040UBT 0SppPPX  0S0 0 0S501S 3/0TZ  (\ p0 )000-9@0\0U7 (p4p3 8p0S0TQ !  Rᕯ8T 0T/3$ 0(030,03000X300Xw0S tP `30>@0P~0S.  S0 p00 0Y R# 0 k0S,0  0400S Y 0 00P@0T080<DЍ,-#--g###m#@##Z###D###ο##V## 0!T! RC-P0`T011 0S@0(pD(0W@g@P @(0P p0 Ѝ@0p@-S@  P` 3/` 00pp@-@HP`0 0 000(00d00 h00l0 00 <00 @00pd-O-p$M 8@0 000800000R000,0  R'0 0B?o2 0'7 0 0 30 80Sx700`V d70`P ` ,0HdP0,00P00H00P0(0L0d0T0h0X0l0\0600`0 0P0H0DP40k  \0P 0c ,0@0D x6Pp00 00d6<0X6JP080H6,P0$P<00SX0VSp$  W600S 0 pCW00 S 0!i/5 X 00S:QQp0 0P,0 0013/PPuD5 0WR tU 5/00,00,00S D7$ S $ (  W S R, 0C?o@ "2"380U0  5/00X400(046=?0(00 QDD  00000P,0 0013/PP[ (0R, 00 0R  R&,00S-00-000S }Dz-  (0(0P300SV0 1000 V!p R 0$   到[0H,00000(00d00h00l00<000d0P0P< $ 4/P5 P$W0WW00 0 R0Wp0S !PW0,0X~ 1U0 0  5/P1pp00(046=?0(0k D p 0P,0 0013/PV-QW 0 0,00,0O0S `01apWZU 5/0600m Ѝz-z-- z-,-6|,4-$--, <--14-# , @-0S Co 0, @13/P,00,0PP P P 4/,/$///='9'6#ptkH00pPP/@/L! !R0 #p@-@PPL0 Q0CU0C0  p "!"i#@-@00G- Pp`=P Y !3 0S :@0C 0@T<@ $0 `0 0p000 -G-@0p` 3/PP `3cf0p! Q 000  "Sq`P  000q \:0L S  # p0 W  0 Q  R 1!b^0 `C-D!@1` P 00009 p3c AT!Y X0 00S030 0S:@0C 0T 0 0 0 30 0SJ$P @ @ P , S@ Ѝm-Lm-p@-P0@ 11b01 RX T p R0   02c Ap##0 @->>l0 1P, ( mP 0ꈮ#q#Q0!030p@-P 0S:@0C 0?oU20S hp @P  @-P 0  0 /P0/ 0A-@pP00 0S 0aVP 7/P000`P@-P@E@P00@ݬ#-p@-,@P < PP0@Ap0 0$0(0@-@PT00(0@-@C@)RA-Pp  @P*`g@P V` (\`P  +`` `}((0 `` 0` S`$0 @@$@ 0s /!1 G-@0p ` 000V  0 0 0 30) Ɔ L((PY 0403/ P Y 0@03/ P  P`Ѝh-Xh-///@-l@-g///////@-T///@-I//////@-;@-6@-1@-,@-'P@-@P3@PPQ@-@ Q3@Pp@-@Q/pP@Pp@-P@P U ! 3{!pp//// 40/ / 80 40/ 4 0/0 48/0 84/0//0//`0+S32/`0 Q/`0+S32/`M Ѝ/ <0 80 40/@- l0h @0000< @,0 o0 0 30 Ѝc-c- 40 8 0/!<0!80!40 <0 80 40/!<0!80!40 <0 80 40/0p@-@ P L (\ ࠡPL SpTE0  !ꀦ##0p@- ` \ QPL SpR@E@ 0@##A-(P $0U p` 0  hЍ,  R , R( S R X\R - RB  X: @0@OP @o#   @-|##@-(P $U `@%@p 0*P @o ЍP0@0//00_SL0.0@o/A-@0`0`00s 0Pp05t0T` h0@ Ξ@&@00 @@Ѝ( ࿞F/_-0#LF/#00@-S@LP0@00@-@T*\P \  @R0@0 000@-S@NP 0S@@0P0#0R0///0/Q Q Q! / 00@-@a `0 3/Q0 0 0 ЍЀ/ p@-P0@S 3/Pp//p@-0P@h a ^  0p@/p0@-S@ H @@-@P4n(j0P !j#-#@-PP !`1 0000fV`@P @ 0 0 0 30# (pbW0 W00* b@P@%0S0,03/ Ѝ\-###[-O-PMp@<WrpPU;Ѝ 4/PP @Ta-PY $@T`P PN0D /R @ '00&$0Sw 0  $$ 0)T 0@PY 0 80 3/PN0  80 3/PBY0x10tp!  P 080 3/P/@!  0 P80 3/P""#h$Y@- P 0/S 0/S 80 3/pP@i @n` C/Q 0P 0/S (꾞#R"p#!MC(K #!*!p@-`@P` 00 R  B A$PP `@p $ 80 4H00 0PP,|W-X>/ @-@P00 0 0P0 0R0@0- ,0 @004. !9, '/0,0輰,0S A-@pW #`PP  &PHX0d0h0x0000/ 0 p@-pM0@0l00003/`P# 003/P``,00S(0B riP 0: S DjPBj0IQCj4 ,0 0 l0 30 pЍpU-T-,0@-@@ 0"013/Pp@-,Pt`P` p@zPp(0 P;P(0$00 0,0 1,0 pPT-@,0p@- `R`( @ }Pp 0"013/P 003/PP ( `0+0( "000,l0H   0"d0|0x00Q1S- Q@-@JQ30S :@0C 0T7@!1 G-PP0000B@T 0S#@P |!l1 0 0 30P 0(0#S `P1@( X@0P03/0P03/0P03/yp?o``2Z0Y0S   " wP0Sx@P p%@ЍpR-F#_#R-r0PG- 0QS@r@P zPP p| ` l  ``ഛT  W<  @@ ⡛tF!Ap@-P"@P  pY0 Q:/00#s01 #ꬓ#!@-M M0P@P0000LUM`@PPpP*0Z P᤿EoH 00 0 0 30 >ڍ Ѝ O-Ғ###8N-oC-D!@P@1p 0000$WXP @ 0 0 0 30% (`V0 V00* @P@9"(0PU*F $ ЍM-###ʑ#\M-@-d d0 0 0 0000@4 ,0 0 0 30 ЍpL-8L-@-h h0 0 0 0000H000@0048 (0 0 0 30 ЍK-K-0@- 000000 ЍQPp@-@^@ph`o`P[P!]@P  P 0D0#RQO-@ @|1MP@$M0T000 @&P P00d-0-p@-PP`@`PP p0Ph0T,0@0,0pLP T,03,0PpTp4--,>XC-P @00@0@0@ .-W%5ZD#D@-P @%$` 0@(pP @o Ѝ 0@-tM 0,P0@P0l00  0 0 l0 30 x0 |0@APL#!P 00 P(0 tЍ0--\--f G--0 X9 -@P`p@ d 0SY-00-00#  !0 G  R ( R $ Q T@0 a$\L X/@-@+P000@-@Tpd@- @ $0 0 40 308Ѝp---\#C^#-`#`3 O-DM0`p@0<00aVP\(P0(0 00PP"2 0 <0 30 p|Y x0P 0P P Phd2 0 0YP P0 xQPPA > R; @ R8  ` gP aV `0<@ 0$ 0) 0 0to0`0 0R R0  $  F`  ` 7VP U0Pt aWPp0Q `VP bQ `F 00V0`!2 0 1PI  0DЍ-4-R]#%]#9#*\#w-w-7O-LM'`0@ 0 70 0D000`+`BPP\7pP0 0+ p +0S'7 0 D0 30 oSR R00 R00SP R  R R +0$R* SR ,]Pt6 - `0cS . cX ,0x8S2S 03SP0 k b P p+`V^9 5`P5  00 MpX % 0p 0 @( 00J0P0 l 2p P P`` $PQ %pK+@T SQi JR :0 0P  `0  p x  cR `P 00 R ` ``00|0 X X0|0  p P P P P X# 0` X +0 `0删S* pP  Z,0H00C Sc_zP0H 0"0 { {0J0 2{0{4 UJ     " r r   (0  R 0(0 l00P 00 0m$$0!pPP 0 0S $(X0\   00Jq000XZ 0X"0 0s0Sx < 000 {{00 S "{ {$  P{ t 0 0 2 [L h 00 p+0SLЍ - -}X#p -X#T#8S#\!\1 0@-M0@HQ0 00P00 0MP !1 0 0 307 m P0SS 0 0 cR  cR 0cSPPQQ 4PP |0S (040(0$Ѝ0<---0 (!(1 0@-M0@0 00H0 00P 0 0 0 30, m 5P0$S 0$S ZP,PQQ PnP |0S (0,0(0Ѝ0-l-ԛ0\0*0@-|@00cS S00S P:\s0PPcU /0t-|p@- @p c^ @^PS` ` ^ @0 0Lo@pp-0 |0!S/0!0|/0@- 0LN1L TP0@P1L|000^010N#/0p@-PM ?@P :QpRp-Pp : A pO-@004 P<0 ~b p8`pG`ఠTP Ѝ YUP000S0 Q PQ 0 0Y P00@ S 000RZ0M#00 0@-M0B 0(0@0Ѝ0/@-@@ (0@b @0`ЍЀ@-@P0@0@-@TpNA-PL!`H1p @F08!0 00%000 S2 0R: 쀟  0 00 \0 0 00P  0 0@0 P X H (0 0 0 30 kЍ0,K#..K#:K#J#,p@-@QP` l P0 00P \    T 0PPp0@1 0@ @1 0@{J#""!"@-@IP00  0 0O-`0  P{ 00C0030CS0 0 UPP 0   P0 00UPP 0 xPPE<Ѝ,,t,DSp@-@ Sp0P`K 0 p@̈́p@3D#p@-P@@@@PdPD00D00D0 0D0 0D0 0D0 0D0 0D00D 00D   $R<00`0< C% ; C& 2 C'  C(   BRpO..@#@3 O-tM0P0l00 301S0s @pTd@`p1T=xpW ТpGPI  P "  `2:0S 0B    A "" A Q@0 6 ` VJA`0  (0 0 3@;K?P@ 0UT AT2 0 00 3B0D c( +TT0  3 dT aT bT0  8 oT tT0  7 0  2 0  6 0  4 xH (0 0 l0 30 itЍ,k.;D#C#C#C#,D!D1 C-EM0@0 0 100@`P0 p @P@T1 0%S P0 00cS! PcU PERU U > 0 AC0PD 40 0 1 30 7i@Eߍ,,,,!1 0@-M0@Q0 000P01S0 00lP P0%S0 0 cR  cR 0cS 8rP H 40 0 0 30 h$Ѝ0,,.,G-p (`Pb@PV00SSP  k 0$ S  ` R@%0#0% *0S R0@0S@0 Q (  /, H0@-@0 R gP000h."2 O-LM00D000p200W "2 0 D0 30 fh0@ @ "S #SSSSS20  0 00 00* PUp1PE0UP#0`S1 0  V"" V 00A 00A @A TN@  RB C r   F T :0 T0:0FV0!03 R @   B. @@r ,CC  B; `PV< SLЍ ,=#,<#tW-;#=;#]:# 0R://0@-@\0 1SS 0CS030@0@ 0S 0S @o/// &Q0 )Q//4S/p@-@P`Tp\ 0 00Cs0C? @^> 0c004P P AP@/CP@/C/@/2S S/L0 SXMPRP/ S/ 00 S SQQ/P P @o/P///0P P/  RP/,)? R//@- M000000 @@<    !   @4/< @00 o0 0 30 f Ѝ ,,A-p0`,0P3/0@,03/TP@Aģ0P0P0S0p40Q3/040A/1F /B4r  /@-P 0/0PP//0Q0t00R10S/"R  BR0j@-B,A,5#@-@ 0 00 00$00CSR $ 00S 0(,00000s (00(08 ,0 0 0 30 9fЍ,4#$,P0A-P `P @( qR$ut040A/3#4A-PPlPP%ppp'S@:0 0 2 z3#0\TA-$^I#P^ 0p   <0@ 0 0"N@`TNQ-0C  $ BR:0CC,K"C"@0F@0J@ 3/0t@03/$pV/2#V#2#1#O-p#`SM @3P 0s!0 30㖯040$\Lx00IEύcύD yH X +^\  p P!$ T!L X!x \! `! d!E/VT0h!c/l!tx1|11儡QV# T+0S@83 VS` V S`TP1>1S T  P 00 0P0 p d0 0 3 30 dT0 S0000 ߍ|,U#B0#,s/#@-oo/#p@-P@H op@-@ 4S P00P0S04PC-`RMP0p "N@P 0tp0 0Ѝ'>@P 0 pp[A x.#B.#@-TPA]p@-PJ`P 0049@p@T 0S(`" @ $@4)0,0Pp]A-` 2S.hP@@9q ` 2SH `H9S L `L9S P `P9S y0D D)R @Yp@-P@Pp0h0STK0@9S8L0Li1SSpJ+#*+#O-004@ Ѝ0q`pP @P@0@ <0 < 0@@, 5Rd U5 h@T 40S<0S$0 S  0 `P 0M  XU@hTJo+#"*# 0p@-PP p`@ R$t PR! QpU %  R 0U!30p+P A0+,0p@-P(@S,@(p@p@-`P.@݆0 D 0  R  0Rp@@-` p0M P000000S@   000 S0 S0000 S0 (0 0 0 30 bЍ,4, 0p@-S`@P(L0L 0L00P PL0 P TT P0 T l T0l00l0p p00p0t t00t0]0 4$0S\0\00\0 p@E&# Q/(0S/,0S/4S/,cO-`M00 0"R02M0C?o200 p8@00TW0Ѝ00S0S ,)? R@dP @0 R0S "S *  1,00  pP7 PU0S 0 1`10hI300Z :Ud0 S     0  0P   P 0  0P@S- dL\N@-@x)@蜤:%#!1 O-P0$M@000(0S`,0S``00S D!<1 0 0 30>$Ѝ̠Z) 0 n+P 0 q001 000.P 040 404<4<4003/ 5S 00S P @0 0 0 30 a, 9 $ЍO,,$# ,##p@-P(0S @p,0S` @P 5S $ $P 0D0@## Ap@-Pz)@P"0 @K @ }PZ`89:;<=>?@ABCDGFEB@ p@@`BT> P @ P3 P+2S* S @ @@@@@@@@@@@@@@@P4"@ @ @"#9"#%"#"##0  '0,0/s@-P(@P 00 0'`P0@Ѝp4 dM$ $D T 5Q 08`Pڬ00$0.d@-P@0404@-P0 5@-P04@-@M @贬Pp@-@PDPp (Pp0 0 000 0$0(0,0#<0@0pPp@-@PPp EPp0L0 P0T0X &h0l0p0t0x | p@-ό ЍQPp@-`P8E0 @ z4S Sz S S S Sޡ  ء  ҡL ʡI hġ F Tྡ Dม  0ಡ ଡ  ড  ࠡN @   00ASD!@T  Epl `XPo 8@h( ` Z T N@E@ : 4E#c# ###################2#+#.#7###%#### #N#=#00S: A-Rp7 ,9?0S30P0S.0S+ ,?Q' `49 @<0S 0T$0R0S 0$  P@`&  @0  @49A< e/]#0p@-SP@0Pp0p@m X`cp@-@PP -ZpP ` /0@SD  / @R 07 /@~, ~,},4 0 .\!0dS/,;#A-Pp` P @  #00S R 0S /]QYQl/Q]QYQk/Q 0"Q0   /  /Q 0/Q/0 A 10/ R*0p@-`,0@P3/ 4 2/p/ P @P 0@SP///// 0R: 0R///( x0B0/l 0 >R/ R/0$S/0a0Cs0S/,P3/0.SS 0 0 0/l,DwP< 0@-C>/hX#40S $0S 0s@@-R/@-@@ (E>##04)<\ \ @- ,) 0<0/#?#P( $ ,@-@o/6##P@-P GL b. P P$Og6#Z#.#1Q@-X _T e. cQ0 PgE6###O-MpP0P0+ dW@!/ g. 3W 0P 9G`Pp&lЍ 5RD 5qW$E01@` R@0A0@S R"  P`  0   8/P  T0000S5 1 0Sp`\5#&##m##r##A O-$MpH0Q" 0L0 0\0P020000"_ j. ⢿QP U00( ZhWTy 5R8q 0 P `P @"1 0 0 30m \`M0   f@P U T000 0P0 0  P0P XWp ƾU  000U0$P<0T00 00040X080 X耟@P@ 0S S  3S R X R  Tw@ 0 @0X 0CSR PD$Ѝ,3####v#V#,N##w#u#O-,M@P2 0S/`0( 11R8<0 R"@D0$0R0 0 p3 먰P @[0 P@(00T 0 0 @,Ѝ|"ix - ⪾0 CR 0 3/(0p P@S000尀00<0 0<0S ( (0R<0 L0S ( (0RL00X0= 0X"0(0S 3XL:@Pp!l - ^ 03 R!*0  3/0  C!R*QR 1C@ 0(0p00000( R00S0 0@ 0(000C004*000 3/(0p$0  P3/(0@DS8/# #$.# #p@-`Q@PPpWP090pP`AIPP@D(0@V Hսt@p6###p@-@P/P , Pp0D0000pA@-@5JP00 0 R00000  R00 0R000-G-`4!M01@ Pp0W000# W| ؐ? 4P D00  0 0 0 30 Z딠 ؐ00403/0$@03/H `L(00ЍGЍ/Ḹ,R#$,=R#0|S&p@-@P0 ,03/0 0imP 0 ,0ie009@P @0 S00p/07@-S@P0 803/0090,03/0H ,090H00005 Ѝ0A-PpYo`P/ @ a000W0 0(Q:,Q7| 5Q% S0A00 04S 20CS  0P;< 00490S$Q $   Q   Q 00 5@-A(`\,pW^@V L\d/p@-P`@`P P0 p@`T@`@ L@P lP 0 p`@V`@`@7M@P UP47 `@Vp|i,Ti,0i,i,h,h,#O-00p0<00!+0P 0@ 0S @.= 0 <0 30QDЍ0S ,9?0S00S0S ,9?0S001(0 6 0 `0 y49<0S? 0S 0 0S 04)< `%@"T* 0S 0Xa@ <0<030u UP @\2S  @0%\2R T4RS 0 D ̷0Z.E΄ %%Sx `#?0? 03S pQ pQ R3 S S   㢷00;0$0|;0(0t;0,000CBS ? EQeszywvu}UTk0802088 2\p 8 0r l% lQ #v400 lll l5 2 R "S022Q Q 2S "R(9 01p2S p"Rp20 00GSZyP 0s0 t2t"St2t2t"S:t2tSQQd( !  'Q5%S% SR 0S05 ෶2"S S SSRRAR"R SRRSAS "R2 RM0C?o20S 4S 2S " SARR B00R0S004"R 3S 2233p2Sm 3Q$S03R0!03Q->-.60!r>, 0,ǒ00' P Q D Q@ P  R0C"DQ"2R2= SS: 453#SR00R00S #3S33 3S30S 3#S354#43RS SQ <Q4R4#3S QQ3 SS 8)RS $ 1!Q 4011$ 40#3R , $$R $4RS ( 㽵$4S$4l$lR R $Pl$QPR%R T4SR $㙵%T4RE>Z.P Q P 05X  T}(@@@a_ ,r.0DЍO/IP V (0@Bܢd@ [ 00_P 0 YP  104YS YS@@ Y X0(&,602 0!>0R  A@T@Y@T &   0 000@ @ 2 @   K0- !|@   K0( X!T@   A> S L  @   ۴״  д  ɴŴl,,̣,""""Z"+#"""#d"Q"/" "X+@+"{<o<6"" ""M,b"b""""""S""p"6"X"]""$"P/D 02 0c0 A/p@-P(0PS/,0S,00S0SĞ\  w. P@dt 0P0V(0 00 S H #D w. 00V,00p@/000 ,8#"#"PG-p x!0 (P( RL, RIC`@<    40 # 0t04043/t0 403/000 0 0 0 30! Qt0<@0 0$@ <0 0 $~t04083/t 0 4003Ѝ ,L,(0S#,0p@-S@00`S$Q(0 1#(0pQP@ 2$(0R  6#(0p000000Z"(0S",0p@-S@00P`ShUT P - $(0R  2"( p000000"#"A-P(0Sv,0Ss80`@S 80 40 S 90@70 0 S ٳ40S 80  (0S 8 0(00 L0P0T08  Q  ᮵P50 0SL P T 9 (@ P@P90@ 0S ࡳ0000 20S00ts  ,0S  _70070 A""A-@`PpVt0`0`0S0000S!qPp@-@ M0P00000 P@<  QxPa0 PP5/@ @00 o0 0 30 uP Ѝp褏,+,!1 C-$M0@000(0S,0S | 0x4x4PS}x_pPl`PH< 7k0 PP :!0 0 0 30- !PP0P 0 $4pP000xP04080080020S 4S 4S0 0(  ( $$0$40$ЍԎ,"""j"B"C"č,(0A-S/,0PS+`e@P pjp0 KPP P 0L `ipᎱЍP""i"k"p@-P0"r@0C?o2 S p@p@-00C?o2 S A-pS( CP`@ ,|@ W0| @O-dM`P /0 ?D00\00(0S`,0S`0V@0 @0< /x? 0 \0 30 EO+0P0 0800,00000S,00S00Se0尀0(0p,Z(P ` @ Z!X00  0 (000<00@w0h0 S0L>0 0Y 80@A0S S/ . z. ⬱0D p"pGpG WWQ ""Wqp0# t p0D0#'$ 0D0#@D@$'('| p0ppG pG W00W0S  0 ( 00  "#  "#  "#<000#Wqtp00#'$ 00#@'x@$p0000 0 0SW 0 80@B 00S S) \,X  z. 00AP00P0S P0@ B র 00@DB0 0| 00J JR  @ ;$ +0 S[{p:(0;7PWx(00| p(0SJ |0pv000   nȰ  Q q:p t๰|0 40D:ဟ S p! 40  0:# &D 0:#| &=(0S$0C |0 1000Yp0~ ;o  0 p140(0&|:# & 0:#| &(0S$0C |0 $)S[{ۚP8@00<0wP40(00| Jv |0000f  49  SJ-@ y0 H  d(0#(0/   ( < )px7o |0(0(0|&$ p& 0$|&$0C, 0|0 < ' "  (0p 0|$&~$|&0x$0C 0|p 0)  px~}7ob' P% 40px!~}7\o 0|QK |0_(0&|:# &@(0 0:# &Q-Z8p p9o ) |0=(0(0&|$& 0$|&$0C |0 0v@0  ? 0 S8p 40! |0(0&|:# &(0 0:# &tH0S A0K P& {040S0| Jc |00 5ۊ[( < 0H@0H4 0H?o Hoo2¡0#[Q [{p( 3Y3# 8CP (0S,0Sp5S)x$R 10P 0x$0P 0x$0P 0x$0P 0x$0ЍO5! Rp10St0@ j (00<0t 9P""B"0"'"-00C?o2 S  G-P pL`CH@q4 S2 S" 0|@T/O-@`8P(0S ` Ѝ,0S>pP2 }e0 `P h"0d <dp ;<0rV (0S,0S 0x4x4SpI 00S Q 0 0$r (0  1 00100 0q Gt0|02 R$R& 0!Ut0(! 0|Ot 0 p0|!G40t C<0@@0 0@0@40p3/$4Sg*G੬b4 $R )t 0 40t !t0\ 0|t 0  p403/Z"[">"#"""9"N"F"/6"!1 A-M0000d0SO `p(0S,0S Tc0x4x4@S,X xPP Nt0SG@0S@d0@0S7 0 0Pd0<00@ 004 P`T ,0 0 0 30 dIЍ@t,""0""""n""r,@- TP@ h TT"O-,M 0P0ԅ@` TP,Ѝ 0`(PUp, R$ !<  @ 00$0Sqp W W  3W R T@3[ G 7 #RP1 X( L P* @ɜ!!\&Q# q X ] $R @ Go< W@@ T $R  #@S@I R  0u 0 GoI Goᩒ3W]WQZ0ğOH?A QZQ ğOHA Q3WQMTb]W Q Q 3WPV RT R ʪ\0S Q p (   T# 0P  H# d 寪 00$00b ]WYR PP3 RU:RRPP5A Q:T  R S @   0S r R! Q&@PTSQ\ r4$S  0000 PiYP @P0@Q Y 0@$000 P0SPPR YP PR YPG[WY Rh 3TH3\0S Q p (   ! 0   d xW 4S 00$00 RP P0 RP x{: 0$000 [W P 0SPP0SPf""N"F"!"@"3"""""O-@04M 0Sx 0`0S0S ,9?0S -(0S 4Ѝ,0S20S\80S8`P(0SP,0SM80q4$S 4 P 16D04S 4SC P 1 0D0 4S  P 1 0D0 80 0002$00p00S 0 `030 0 P0C#(000000,00( 0CR 00S ʠP0+t{z0PS@*  8{0h0S, #OPq @ kPPeYP0@7S%0 000G$ A 00CS@Z0@Sf_~7Sasrqpd[P 0@SS񏐖4`2Tl00l0$P 0@)RP9 7#    yT p00p0sTt00t0nP 0@)RP9    00\UB U:kU ]U/ZU3#0 p00p0T/ $00$0\0  ZS RZ Tz\0D9+UiU4043S'8 WP"hUU UPv 0@)R|  D9! !+40S T 800800 3 T00# 030㟨HT 090090020S 5S 00 T00Sj4  0#000P0 T] 0pW 0 S 8pP 00 0p000 0q0 00 0T000 5S 0U7U 1 05#姧x!>t -0  0RT0  0N80080(L@0s00[000 U000` 3UU000Z 00 S%P MP lT 00 S@P @0800SzlF""""""L"X,"",Ŀ""ΰ"(0p@-SP@,0@S@@P P4SPpG-p0s0P@`( R , RQ$#   0@嬔WZ܀P XP P  P  P  GX  5S 0P P  P 4(S  EPuP 0vP  EPY 0S S p@-@@PL0( p@t/O-%p5$M @0000(0S %5 0 0 30[ ?D,0Sl`P~8 `pXX$4S 4S ,px9@Y 4S(4S x*@Y e4S dpW ⠤ P @pYM  ₼pW3Sx0S4S ( R} @0oY 3Pr( . ))R dppW @Q     P P P(P  y>Y P    p$x@,Y020S4S4S p$4S[ p  G   pS( R @0XpW-   3SN4S] R PP  P $R P  PNW  ( %P RApP }P  R/pqP  (0S  - 8PU 0LYP(0S hp@)R*08!R`V0P`$Ѝl^,<^,@"׸">"'("xN"O-9"8';rr0 |0"0|+p" 0f0pC0pGP 0F|x'I0F|'DW:00$0W6 0 0W0100S v0!| $0 | 0 -!0'.|0|!| 0| 0 5S p00##0`0s`0s 0t 4S0 0!"0 03/|WQ  4 2/p<Ѝ\X,PX, """"PF"""@t"H"I"Q,@ DʌU8.j"ƏƌA-@8"P42M `0000(0S "2 0 0 30v 2@,0S(0ps: ]0 70 , ]01 T0S. 000 00004@U$(0<@ 0 0 0s8ഢ0( 0 00L0"P  90003S 0s 00CS 00!<0@ 00 040 04R0$$|0S 5S0S t0S00Ѝ8N,N,b"ښ"G-`p(0S@,0S@@Y# 0T S(0S4(0 P(00(0Y( 4 0(04( 1B0 0 5S  ( 5S샔S p0 (0S4(0404 ,+,; O-BM0M040 0S *: 0 4 30 S?P`( R , R0 @R4 Rj( Rg rW 40 S ֣P Tp]0W0]0 ʣP$p0]80F 0sC L0( `07030(00600600S ( 4R  $ 0`0R00\pS3W( $ )<)8  . ⥡8 0C?o "2"2 řP0(080080 0s80 0SᰙPsW' ( 00S? 008  r8 3 S+ 0WV S RQ) >PL00S> ( B `(  $ $ $( $  (  ( P W05  R       04YX  s 5S40 ST0S l0S3 0s! & . P0 0S50`0S 50S0W0S $%(00(0$0x0s #(0x00(00K  p0S# 0 s 0RD 0s x (0r x00(00B  (0|00(0 0s<09$%(00(0t0SN 0 0R3 0sx0s;#(0x00(00  Z 0s- t S0$%(00(0s80ᣘPf$%(00(0 9s80᎘PQ$%(00(00t$%(01(04S> 0s; 708 6X45pp10+03 p0<p00 p000J 0 4 8  8 6   6 d0400040600600000000S 020S 5Se  P0S0 pW00S"20S' 0s$ 0S!C00S  B R000 @0cP00 0S50 0000pW 00p40 S?T R<ᛡP7  Vp`0S 00S 0s80ΗP38 S70 0S 00S 00CS 0s 0S᱗Pu 0s 0s 0  70 > 5 S 0$(01(0WBލЍJ,J,$""l"6"""A-"@S0( Pt0$|`lp)pT~$Ft0HH @ 0|pt0 0@|@T蘱"@)9 O-4M0@0,00(0S ,0SsP80W0 8@ 0>R [0 00S<0S $R (0S 0W (0S 0tR40 @   < 3/t0403/t0403/@0 0( 5S'7 0 ,0 30 <c 0SVu୞Wxv৞ 0t(000X7000X:(0S7 4S4 @0 <0@0 <00SSt0 &| t0&0|t0&0|t0 403/t0 040$00(04S.6$ 0t 3/@0 R ( R2 @ <00@< <t06 0>00@ @ 0t040 @3/0tH 0@0 @403/$R t00`5 0>00S 0*3(`V& 4 `F464t4S0 0V 4S 40 3/t0040$04S40 3/4S  t40 3/x0040$04S040 `F3/4S  * R(R R9 8P4  */ BRJ>('&%$OdH3R= 0CR< @ % " R1" $Rٽ P  㙝@<  #R Y ( $ < L$0S 000 P 600S$0 0$0P1S0H 0CoP t0 H!| Ht0!0|t0|!0|t0 403/t0HL!| Ht08!0|t0$!0|t0 ! 0|t040000 0$Q% t0!<@ 0  $5P (0S ՜4Ѝ>,>,DpT=,F".""-ԭ"("o/""Y"PD^-t" O- 0R $0@,`Sh!_d j. ⮜Sp&4PU8 0000(0,0P 00X0JS(0Z(0SS( b0@S S (0 PS (0 l.^SP LG PP` H""""b" ""@-@@5"@-@@6҂"O-M`P0/800 00,(00Ԁd00H00pL00h0?0l0?000000p0(0t0S ,0S0@0S0S ,9?0S M  t,0 0S (,0c "H9` |000p S3P08000x0#4D04SX ,000S SN S80080 3/,00  #1@3$<0 P 0S S0S00 0S000@0Q440Sj W( L00L)4 R @9D Rg*40140S  0T0000s \00H 40;0,000<0$0T0W 0\0 ]00B 440000C00@0X 000T0PO X 000404 @0< 000 0000T00S0  0 H @00HWH X R 5 ` /o" T H 40\0H 4X H04pX00 \ 0 Tp R {E?1! z  ? > =   { z y 1 0 / | { z srHG ` _ ^ ] O~}|{zyxwvutsrqponm g iZH0X0K R <0   $(8 0 0 30q 7 7 R P BP Q  R% 8R" 0 BqRS  0P 4:400@ <0 0L0    0000i020S 5SK 0H 0S@0P> 0S8S4 4Sp)P1W 50T 000 0S& 0SE `C*SV``8SS57020,60&  "0 0l śP 0SS 0CS Y@60L 0000S' $ "%0P$0 <0  000nxp p`@0V< 00  ! `$ 0 E$0W r 0 Q 9 0 00 80 70 0$ P0 R00S 5S 0e JXX0 S000dV `@ S $`V00@0 5S000 07Sn XSNSO 00CSpd0 0(0@ 00p000H0"`P ` 0(u`P <@ 0 0000s0L 0 W@0, 000$0@0 < 00 0 0B$ 0,  "!SR 04S1,0s0 0803/,0  00@03/VW0 ,03/EV rV V X00 0C?or20S) W  d\ <00 R@  0 P$0$0sP$00$000S ՕPL0<0$ W`0S D 1s(ғD `0q p&X0 S0 00 004S0St040@3/Z @0 $ <0  D `0D1` 01<00$0 0s 5S9 ᅕP300 S0 0400L0Z 4S0St 0( $ 403/( 00R. (0S,0S@ $<0 0  $$00$0|X0 S0 0 0S50`0S 00 @00 5 S 0S #$ 0 000P ?0 5Sm0S # 00@0< 00000P (q0 0 S 0 V$,A  . tp&00S/P0S+P  . # 0 00004S t0403/P 0 4040 0S38 <040t0403/000@0 <0 <00C@ 00C0 80 , SV ಒW 00S0(0$0$0`0<0\0000 0S00000ST $0040$00$0G( L00 R 0S @ R W 50T 000 0S40@0 P0S q00a W 0S 00S a4< 00#( SX U#00<0@  00< 00 (04 00t0$$(R  0 0 RT14S8l  0T 3/0W4 00 0C4$b(,  B B 4R!S440  %R  R38 <0$ 40$ t0403/ 0 40R@$ t  B3/Pt0L 403/vWPC0E 0 # #!P Ϡ & S6U 0 @03/0@0XP 0E 0ZSi00f 0 003/0`p0@, 8 803/: S >;: S 0h8 0@803/"0Q0'  R $ !    000]8 ,03/ <S# S! S! 1 000t0H @0 <040C<0@ 00C$00>  @0 <0 <00C@ 0 0C$    e00S0` ,0 000`0妏  00` LN`"_""\""~\"Z["Z"VZ"Z"Y"VY"W"Kh"P]^"xc"_"c"wb"/O"BO"&O"?\"N"N"N"N"/ po":K"\"7\"m"RI"Z"l"G"SY"j"ZF"W"|i"T"V""V"P"P"\d"&@"4S 0 ,03/0`"R  ཏ4SoYl (0S,0S  x4S(ॏ4xpPHt0S`@0Sx ,4,$0t  "$1  4 2/$ 0  4 2/$ 0 4 2/,$$0 ,$<b@ `  @ @<0@0 0P 040 0 ,03/4S 2P :09#9C$0 $00 - BR@ <   0C R 0 UQ,R#80# S28 4 # SVR# 0 `803/0x803/4S "7;,0p009#9C$0 $00 1 BR@ <   0C R 0  XQ0R#8s  (73P SYR# 0 ,03/0` p@09B$ <0(0S@0(0 0, $$ . $R V$ v  ~"^ ^< 40p 0#$ \0 C0B$0$  0Sȟ(ȟI P 0:0C0 0= C R432 0S ,0 00? 00p0h(&X0  40%%0 ,03/ ` p( @0<R 0@ (  KQB >Q= ?Q Q: &5 . LQ\ V $ A >L^\0 000B0C$  ȟ(ȟI  P:,0 `00? 00p07X050 ,03/@0`  0@B< p(0S@0(0 0, (3(  . $R &"  $ \0C$0ȟ( ȟIA R,0 00? 00p0E 0B$ 8X 0 5y0 ,03/@0`  0CB< p(0S@0(0 0   )5)  . b$R !/$ \"0 C$0ȟ( ȟIA -00 P0#S ,0 ( 00? 00p0 0B$ eX` 0e 40:0 <0 0803/ 01$"4Sp0 $0$00Q 032 s0@ 2/L 00W1( 0@ PI@9`pDST;0h 0D 0A$ 0@ PB0PW00S ;008 <0403/@0 00 %(0xPS@0(@  @@0`@C0Z00S 0s8<00<8 0P403/@0@0 0Px W 0<|0 804 2/ 0s(0xS@ @0 (  @@0`0x  |z 0s4000004 t0 0Sx0<00@ 2/| <0  @0 0 00 0 s   $P  {|00|0IP 0 _WK( 0@ P@9`$DS: 0# 000(0 0@ 0B,0$ 0R00S+0Q0@0 <0p 00  P 0 -@0 ( <00403/@00,00(00" 3$ *?0 ?0 0sHx00,0(0S(0$0 0 @0 0` @ 0B$00 R00S / . < Q@ 0   P 0 @ ,<0  0 4 2/@00$00,00 0 $ 4 < 00@0 00 00000P 0 `803/0p803/4S ?&0*00 $ 8B$0@0< 0p0 x 'x0 0B$ 0    PS6 @ 2/0@00 `803/0p803/4S ?&0*00  *B$ @0< 0p0 x 'x0 0B$ 0    PS60 `803/0p803/4S ?&0*00 'B$ @0< 0p0 x 'x0 0B$ 0    PS60S000000@0 0 0BL 00000@0 0X0 SR|Z 70$5IЍ$O-M @4400000t00l0p0@0 S 400@ 400,03/40 (0S,0S$  BR  #T . ⧊00C?o2S #3 0 0 30 '00Pt ᜀs0p(0008000@00< @0D 0H0,0<000<`L030P0L0Yc80S(00(0(0S W$`H0`80S`W$0S U00U0S | @p2plx080W <0!"`$ 0p QWd h 0 <00@ 0D p@0\80\([$0440  08@0D 0`0 0t04 0 00 00CSF-6 0 S < S PT T 0#7< 0p@03/`v0@03/0@03/0S 01Pp0403/0S p0403/01Ppp@ ௉Ѝ+HN",_":"+*:"9"9"&N7"O-MpP0/`00 d0>T0\0>娰0`0|000<0(0S<0,0S0 D02X0P0c#L0L0V#*0@<H0Ho@t@6d0@SP  0.(> 0 |0 30 &H0H #4@0D0p@h0"S@ 0@(XX404 `0\000 0P0d000pQ00P00S "2S 0@00 D0d%+00 0 004/<0DT p04@ <  ` 4  R5 @E 00 00S-,X,*X-0,03/ 2@P :09#9Cp 0x x Tgx ,X@0< 004 0C0C*XD0,S  284@4/@]/0HS00  0@  0QZ0803/H0803/@$2'<+0t 0,03/ @0 0/ HR$ 0040 +s  G C@0@0$3/0@03/00Tp g4p R p:\0>R @Q1= 600> ӠS0@03/0 0@03/,03/ 0 0 R  BR0  2 "!S2 0#0  4 2/T0 00 D0d})0P80 0Sp0080@0SX$ T 00CSlXKgXNXBX00P  B/o"R P0SB 80  0000000݆  X8Z0HSXsT+ \0. 60 @00t P0( o 0 80$ 0p0T 040 00`%Z0HS00X 0HS00H D9"4A0]SYS[0CS$S6 0o0o0S 0  700 T ep 0@l 0000qT 0,03/@@0403/0o0T0000803/x/x4 R T0@03/o@/ @8R 0T@0   3/0o0/7 R0T@0 xF : S >;: S0803/2 000 o{0,03/:"0S Tp0 40h2*R 0T40D4"0S0T40  2  00T0!40T㼁<崁I1P0@0(3/ 0@0yX; HX;"846 T 0S+ 0 8 08/0  8  @04/00t0t0Sn0 t  @04/00x00Ѝ+++DF"A"?"?"6">"0/6"="hxD6("<"A-pa(0`S>,0S;8@P T %ݜPd0d0 S@ 0X1 0T@1SE@AᑜP P0@0>0$Pd0 S !08+D0@-( `@R@, R@  R4œ^5 +DO-MP?( /0t0 ?`0p000(0`(0S 040/? 0 0 30 ",0S4@S00@0  [0FX@0`X҃`҃ 8/`0.0ed02ttM0C?o204DS?%`?CoS0P@. L ~Q %!UP4S 53/ 000p0D0 0x00$040(080H0 0Z$0S dV 4S a4HPp0 SPP 4Pmd@`Tm\p P`W@ *@P @㰄 NT P\ ऄ0S ( pW4M0]  Ppr@GOo 0B`PB 0TSpW4SP0@53/ 0p00$0śA! QRv <ś^ <@( @@DS@Q! RV<@(@RY <(NS! 0S00S ,9?0S(0@ 02S ,90@0h0,0S 0H0X0$0a 0B1 1` 03P0d02Sd00MHx0o0娂S0800 00, XQ&08h00S0P0S?, 0pB#p @T0:0\0:0h0:0l0,0 SO80  0 0d%PP 8`PH000P0 S0x0S8%T $R0H0dp0080W4S 9 80@S2(00P0(0SP0,0SdP$ 0S 0 x0S (00 !x 뤠T0 (qPP 00CS40SX@ 40S0<00X  @0< R@0S"l  80@0  0dZ%P ,0@S( ނ,0S,0Sh <0 T 00 60P00<0` 00 P@U 0S\$D00D0J0* P R' % @0S" 0` S(0 0200 N0PP0I P0 ,#\060h0,0\ S:0h0SPOp1,0P%Du0T00h %R`0Dau0Su`6Su0[0C0Q u3Q S ( TP0V0\0D9%4,0 0,0@Si4Sh㵂S̔`ᜀ@0<0, 00<0(@`P< 0 0 00`,0P00<0 PUHP4S5 T03S S05T S2+@0 <0,00?Y R 80x S 08H080@H0@x080 @@00T @  < ` 80080HPVA0S 0x00S0 00X$0P0} 04(Q q q! 'PPl 0  0<0S,0@<0@@0 0@0 @000d$jL0PL0^2t P` 0 CR CR*(0P0( R, R3S ( r @@T <@P @@T ,0< 0 @00@40<06000-0CS(00( R, R SU (y @@T <00 @0h0SP0 x0Sx u000 R( % @I"!- R L@ R 00 < S0 T   ᳣P 0|0|00T :000SPU| 0CT (00h00tS 0h,0, T00T  0#  pz@X`<`00++<+?D}9"v)"z#""#"""R "5"5":$93"2"~"? 09&"")'"P/6'" %":"$"#" "#"#"f""""x Tԅ HoLoᨂ , +˂< ČRX Y 00 20 偢, P T @pG< p " 0 00V00, pတ0,0h0, S,0&:@ S`ykw ,0H0!@ Bo1X0BBo?o<2RX`X 0< 00, 0T00S \0?R0 ) 0l0 \08 0p2@000+pP< 0 0(0 P00P03S 0S (000 R Rl Q RXㄐ $ J ? " ' Ġ $#& R ,P\  ^ XQHXPE<Q  l<WpGX00S\0Lp#0#J 0 S0僐K0儐 0p S* 002 U0, R ုl0H0$P |,0 h8013/P@0PT0< 0T 13/0P\0$> 㾶,-P< 0D<00P0080$50l0M> 0|0\08 S)(0Z40?o20S Zp|gM( ୕<0P S X0$0T $0S40040T08 L0 >RPX   &ppW l 70RL0|!00< 00C00 ᨔp0 @ a 0h ?p0  Sp000! 0 X00h0 ſ@P$@ 0SjD00D00(0000, 00R P ~0$00< S?*00$080080`T   BR4 R 㸀p 0 0C  P 0,03/8P ~$ R X, X0 0ِ0C?o2 S T ~, 0,3 #cS $0S P0J S0!P0,0 000 %S 5P(P@*0  @⦾`P  P⠵(00(0 0UY4SMn0@ `3p4t4p5 @ 1 00ԓP  M~4~00 0 P<00$000000 0080d0(,0000 0U00tTp4]T ~ (00@d0C@(@X @  ~T  ~,0 S@0 P00  A`P 00CS  }V@ @4ЍG-@(`V ,0S4p,dP U4 VP ᵽPP  P;~ٽU P/~0S ( `V`M^ P `4S 0 4 4P (XtPX(P" "N "p@-@(PU,0S R}0x4h $x X x H hx 8 lx ݿ( x (ؿpZ""|"""" 0 0 /ᅡ-0p@-@( R, RTPUP00S) PU0 PxֿP dпP PʿU0pP (࿿pp"""'""00S/p@-P@P 0嫝0P & @Tp00S (0p@-@@P \ka}0( R, R 4nV}0x4x$RxDp/""p$p4 O-LM0@0D000<@0S 8$04 0 D0 30 (0S,0S $}㸵0|4PᲵ|4S 00S |x4S d@T 3000x3040P0S$ 09! 0$  =}pP P0 s#(0 30,0(0[:0<00S A0<00h0S 9@T`vZ (Zz4Sw<0S 000S<0< P (Zi 0<,03/00S] `(0S,0S |0x4x4S|01 0,4SB0x0P0| 㓓P| 440 0 OP ,x|@ 0  0 0@0(4000 0x@0 4 8  8 0 (0  0(0(4 0,$(4 g$ &4h &R0C"1S #R ( r6  R 0<00S 0h0W ፫LЍ|+<+"""""B"6""""G-00Sp`W ,9?0S(P@P h0PHP PV@P UЍ!P 0#2  dzP uP@0( R/,Q/q/ PQAQ$/ 0( R/,Q/œ \Q$/R{Q/"0( R/, R/  Q"MR/4S/9{"6O-|M&0 80@60( 0t000L0RP0, R4(000S @p&h6 0 t0 30 00S0S ,9?0S(0Sk{4S (pBp5dP0D0U `0SC0@ 09 0<1= S8 8 50@ >R1 P+ 0S( 00SL0 L  Z@P0L00S  5 0)0,0050@00 S 0L00S w0L0P0C S!(00000aS40<000LX:000@0400 0QLLHHD0DT0W7HP0\ Tᵿ0(0,@ Spp4X0h TᦿPpP \TfP  @000,0 000(0S,0S @"z0x4X0h T~P P \T@P 0040p"Z . zx4S#zDx00劑pP.~z$@200 FP L6nzX 0 $   00X0h40 0xX0 4 8  8  000凑  0$0 0<200 P t!Xp . $0 X 00 0 000 P0PX0 4 8  8 yhtW$0 00 0 pppxXp7X0a8 4p 8  (00(0h40h44040000堠T4A|Ѝ++t+>! "D "P"g"R!"!!!J!"f!"00S/0O-`0MSi0Sf ,9?0Sb(0S^,0S[Đ@P`yTT1d 0 0XЍO 0(P U 0S 0CS%  . y0  1000 ]pP0  y <0@  00P0l 1000 ?pP8 04 Ѝr!6" " ","!#"""00S/0O-`0MSg0Sd ,9?0S`(0S\,0SYD@PX8yLL1d 0 0XЍO芨0 P U pW W% 2 . (y0  d10 00 pP0  x <0@  00P0h F1p0  pP8 04 Ѝr!u"[" "0"! "E " "7O-dM'0D0 700\000T0000(0S @&6 0 \0 30 00,0S00S@0`0S0S ,9?0S004S (0BdPU p0S@0= 09$091= S5 D 50@ >R. P( 0S% 00ST0 T ᗚ@P0T00S ˧t5 0'`50L00$ S 0T00S 0T0P0C$$ S!(00<00tS$ $00$00,  R, S  0T 080D3/@ ]EFETpP 00TyynZPZX $ 0wB T@0 000 00@0(0S,Z w0x4x4SwLxK0P(0pw(0040PHw$H#000 P w0X  0 0X08 l4( 0 0  xX0 4 8  8 4 0 00ގ 0  $0 400P/00 cP ("$ '- w80 X0000 0PX0 4 8  8 ΦlX80 !0(0 0 0xXX0t8 4 8  (0(0@ (00( (0l4@ 0l44 040000 0 000< TS*0 803/: S ,0S< S 0o0`,00,0x00H0,0S 0dЍ踥++p+D!D0!  "f!>!!!!""!"""8O-4M@00(0S,0S80P 0SP&v}000S 00 <`P/v0(070t0780(0ZR4S04 #(040(00   5S $5S(  ( l hwp8`Vo3S4144S 3( R$( $( ( p 00(  ( ( ( 0㼆 d`Vg 4ЍO00S 0S ,9?0SdYR0 X h Py! pL)c D) H)6 0$00X*0 @9SU0 00S 0S (000(00V   0S 0 s (000(0J  0 F  YG0Sj000l`V 4 p0>W @ R 0S@0(嘯P  R 0p 5S 0 $(01(00@00p00p0`$%(00(0$%(00(0$% (01(00S0 a 0S00S  \p,0 i,00 0S $u00(0000(00(000 3( !B!(  ( 0040400(00(000 (00(00(0 P 00 SY 0S  0 p0000000(0@# 5S 00$%(00(000 &0 5S 00  04 5S 00S0S ,9?0S Pt`vtP :P p5 3S ᔭP (0S 3S 4SP(Qyp   媑tP4Ѝ3S 3S 4S 4S 3S 4S $5S `ZH+6!4z!vm!4R-""!DA-@(0S,0S0`P4 5S0 pTP-040 44040404 5S0(04,04004804<0400S0S ,9?0S pht 08)$ <)L P0 4P`0 t!!!!O-R p0S:0P0 00地S000  P T 00,03/ 0S @PP00Q00S :0尀P0S cȭ P ,(01/(0PT@* Q% ,0(4(,0Q U XP   P@ $ T@ RQ0 UP<Ѝ++x+D0( R/, R|/A-@0Pp!`P03/0XT0P03/0P03/ 0 0 0 00\03/?P U 0P03/00 P:@p@-@0`X0P3/0X03/0X03/0  X03/0X03/0X03/0X03/0 X03/0 $X03/0$(X0p@/0p@-`P0@P3/0P03/00p0p@-`P0@P3/0P03/0T03/pp@-@0`X0P3/0X0p@/p@-@0`X0P3/0X03/0X0p@/0p@-`P0@P3/0P03/pp@-@0`X0P3/0X0p@/0S 0ES0LSF@o//A-Pp`0@X03/0X03/0X03/ 0 0 0 0<@s *W8 4 r0X03/0Ad0/"@"0A-@!PP0q`3/0pP03/0P03/0W T0P03/0 P03/000P03/0S z0 0 P:P P*.0l 0.0q0P03/0P03/0 P03/0$$P03/(0,000 "0A-`1@Pq0 pP0\03/0\03/0P03/0WT0P03/0P03/0 P03/0$P03/0 (\03/0(*\03/0,,\03/00.\03/040\03/082\03/<A-0@`PS0d03/0d03/0X03/0X03/0X03/0 X03/0$ X03/0((d03/0*,d03/0,0Pd0!3/0.4d03/800 Pd0#3/<20 Pd0!A/2O-"Q0S  f0 P00 R  Q 0 ?0P Q  P ( 4 ,000003/0p<Ѝ++ " "$+HDt!t1 G-@Mp@0 @0<00P0 00GxP !1 0 <0 30:  4w4P00/8(S 0 Q0%%<0 S %0%`V`V pQP 8@T 00xP(0  wDoꙦ"` @Ѝ0+̄+p@-`@Px0 P0*up@pJ@P  q+l200(0 (᠏PD"(墐Pu 00(0B  0 0C0 0#" R&! P   Rr  00C S70 *05 68: % 04A? 0$0S 09 00S 0 33000 0<0S 3/p4@+ 090 00 0@0 0 08 07 07 06 050C4S? !<Ѝ ++u"NH+:"D O-S   q Pe 10 c0 .0 0.0uj` 03S`0V:PtPB `3/Pzh0 R R  Q P 0 0:0PjЍt+$I!!ho+LO-M!0$ P 04 0040000i4 03/@P j @@<$44 0 0 30 P &0S$0S j%0S' S)0 0ST  O0 S00S #}`@P 0hb 03/PP ᪙vjP0 0Smj`pP   x 0S00Sp0S 0 S0cP 01PH0 SWnlY R 0S )0Q0Yp 01 0RY0B b00Y p!PB 0 R  V @ 00 0 V   B 03/0 P )'iG 8 0 `R W 03P@0551510 0R㮀`PT@PP 0 0;(0d0`0  0,0 1,0厱-0 0-00SPЍl+l+xl+(@q/ /009/009/009/ 0p@-R ipP@P Q 0R}P 009 PU @/P@آoppH$4D4 C-M0` @000%p4P DhPnP 0S0S S00S003/P P 0ȁ2 Q /o"S R /o"S R Q4#  BQ0S 2S,0 S 0R ?Q00{pPp` (o(P W(0S000 R~rt0 B"So*00]pP po P 00PppP\0`Pp0D`{ 00SS qgP 0So80SSp0QTp QXp0P 8 <Wt   h\0t0P!<1 0 0 30E 00SSPv Pq S CPo \CQoP^ uh$  Ao P" p3/P ,FP p0S 0Wp1 `Ѝ,g+*]!d$d+"2 O-M0 @00000oP `!1 0 0 30i P(P 4n4P gP !hA`P .0S,0S-0SJ S0 0S\ 0 SY =pp᪃PP p0p loP  n P p0S0S   00}E0"0KoP0SY P0 0SЍb+b+0O- M40Qȱ 0 Ѝ`13/3P002!000S 00S"0 $B 0BX  U$Q (0 $000c R $0   R0Q P@TU  0SnTX 0X00P000 0 00S$0S (  <,bR 0!( 0 0<f0 (0o,03/pP0  ጕ`00%mP( [m(0P~!z!v!@-@0S R@<੟P (ࣟo?!5!p@-@ P( @ P 00 0 0000p0A-@q0P1` P1 0D0tQx0S005005080280]P   4 !Ah!@-0S @ R0P 000 0(O-BM8  8ЍOf( p`^> @@ >.V*@T 7 ^  N^@Z  `p P^T PPP<PP Qhp@-@0PP0P P0090xP0\0 0p@ E!`!h!p@-@PhPbPp tgPpd lgP P fgP8 _gP $ p@Xg!!`````0@- 20C@S h& 0X!(00@D 0" $!!!!!p@-P`@GP 00S 0Sp 0R @-$$ ^(( ^ BR0@o/P @P'/0P 0P 0CP/x/p/h/`/X/P/H/@/8//0Qtdn!T!O!H!X!~"T!!-Q0  , 0S) P \ P |(QSQQ @Q Q<P$ SS+D0$ $Q(:)  Q#:$-  (^ \(\\(\(  ( Q :Q0@//A-PQ0`@@pp]c0bVP P @P  P@V@!A-@pCP`(qP 0$ A R :0$pU00S0000000 00O-!6xS P(Q @X0` Rt R  R  4) R ! 00 Ѝr| x -ðh B! @Pd t0S;0Pt0 (0t@@0| pW? XO@0S6 8! .S1 <0S X<Q   @DD 0X03/ L0S XL R     @DT, 0X03/0@D\X03/0|p[t0@DS @> c0X0 ЍO/ 0P+D!p@-P@`Dk0 P0*c@p~@P  iP G-p@@ ^ 0S00 0S 0 0PQ`5/PP R 02R: 0JbPPh  @0ȑ(0  0-9 8V zdpW,0S; 3/p@5  a@   RD@ 0 R D P P 00  0 S  `pD0@SD51(&|G!x!!!A-`hP,pX@P 00C(00P0\0XPKdP0020D00S SCpp@-@Qp`|PP   Pp/O-M 0" 0 @2TT0000t2TP0@30`2002000pWp 0H0 Sk0P03/0(P03/ 0,00H0P Z0P03/ 0d0 d  00P$00 C 004  SC* 0H0P>,00S. S8pT 㤢,0[ * 0 000$  B 0 0`L Z:H0Ο0P  0+# P03/P pGZ,P NP 0 0 0 30 Z,P(0S =|0p$ 900 Q0y ЍF+3!+8D+A-Pp`|@P XP  L00 49_  褫!u !G-`0Ppȑ0S `8| 0@S000 PV0 001  ( 0 3$000 00! 0P! 4 R / 4 (000R P//B+Dp@-P`@P   Pp(0(0%%D0D0pC-` P0tM @p0 d 0l000`0  ᄞ{P  0 0 l0 30  *,ᫀ P 0(00X00\00D00090StЍPA+o@+,@-@yP.PPh'0p@-`\0@P3/0\03/0\03/0\03/0P03/0 P03/0 P03/pp@-@0`d0P3/0d03/0d03/0d03/0X03/0  X03/0X0p@/0p@-`P0@P3/0P03/pp@-@0`X0P3/0X0p@/0p@-`\0@P3/0\03/0P03/0P03/0 P03/ pp@-@0`d0P3/0d03/0X03/0X03/0  X0p@/0p@-`P0@P3/0\03/0\03/0P03/0 P03/ pp@-@0`X0P3/0d03/0d03/0X03/0  X0p@/0@-@\03/0d0/ 0S/2! # Q/279Qp@-@P`p]^{Pp,90,9,00S @{P 04 00p!081 0p@-@|03/PpPz00 0 Pp G-@0S "R0a1S 0\ 0 pЁZ 00 00Ѝ 0Pe@P 0P @A-PRC `@0S@"Q*q0@T)0 S s R  s]ЍP @U0@5@0:0 <XR 0T @0V]0S @0TS @@!¾!A!%O-p$M00HLS "e  ]R 0"R` @@`\* \ <`VH0Q`1010嘳 0R0YP 0 t0@P PXP]P@R @@ 0ePPP  Xd[V1 0S- (/PP0PP@ 0 Lt@P0PPP&i] ``! 0d0P0@ )d[0` @ `PZ @S !t@P sq $Ѝ @9]0H# 00 S* 0!  ;/0P  0 H @<20 \ K V0`!!! @-R@  00S0\@ 5<5 !7 5P T0S2O-P0Maqd@`pT { 10010 0 T(Ѝ0   Rd  0Q@01,0S0'\0 d0@ R|X\ \0 9aV ,0S 0Xp'q  \@0S ,Y0, x Z Z  <], 0  [ pW;!![!}!0|P/0xPt/ S 0  00 0S< 000/ 00 0      @ 0 0C0/0O-0S 0`0S0P 4@<@P  <   R ZYp0ȱ# ЍP!R ,Q ,0S @0SQ\ p0P#02Sp02SAT 0 S s R0S 0S 0S0!R02S)0S S00#@0$$0Q((0Q0Q  0Q  0Q0Q p0P 02S0s0 8/@- IT $ P(IT P0S1 <S P DPR) @@P:D(#@T RP P`@@X@H@Q  R P@ @@@@k!%!%%A-`xPt"S@   S& SxD"<2 0 0 30 _ЍA99 $_!1 0 0 30 ЍA|0S010S+p : h0S 0   ^0 W`P 0 S N% R4), 3/pP;ኙ ``V `FvJ9 ( X0 0 0 30Ѝ`TH.+.+5!h.+J>!Ĵ!!7!6! 3,+v!o!k!@-` 4M0@ Pp00,000S10S 00000G# H000P 0S  P1`0G$0 (0 0 ,0 30 4Ѝ(,+t++0"R@01,/0O-M"R 2`p R  YPb  稐@0A< PPR0ȡ0S" Rs !S20 aPP : R?>S71HK- +*F-$#"<0 2PP 0P~XP PP\EUPP0 2 Ѝ@ P PP9S10 00Q \00Q !(0 S  SR  wQ  YyH@0H(0 ( P  0"RQ:$ @ 0 PHQ < @ !\ R @ !P R Q:Q P}Q !(0 S  SQ  y@0(00(00 u02S@tP 8p0"< @0G8 RD <0,0S><0@PS .)10S x09Q Jώ@0JSRP 0 0@010S P U:U rP 0)R 9S S!R0 S 001( Rw R:0pX(0@B0! RR   QQS0 RS010 SS8 (0B: R 0R QQ*@010S S PP7 P2 0唰SL0<0 0 0L0<0S 䡚0 :/P004 0 WkP0 k8sP  00@0(0SP 3 Q #P00000H0!& 0S000(00(03$yΌ/(0S yΌ(yfό0S( RTP0 5/PP  R0 0 2sd0 2s0  <0~,0yϱ!!t!9!!!!c!O!O-,᷒  o P" 2 0 \0 30y 10ᾕ 9uPP 03 003$00(00X00\00<07l0 DS000000 0RYB0100$1@  0 dcoPP  {tPP   001$3A( 0 X \ c0 P!k0 DS000000,00dЍ`+i%!+O%̚! 0@-@L<0SP %;S0<_!0 1//O-0@Zȁ`@0pPS+ 0I 0 F  dRC _R@30000 R D (0 R 000R 0 (0  0zS`P00 Ѝ000S P 0zSTR `0 49p,P00 0`0$00Sb PS_ @R000             (     t R ,    (+ ,  Q    R  "  R !  0S @P q  R 0@ QyL0S0 L0P{m0SS0C S񏐞* %-N2 S S񏐊I!11 01(0{10101001110j01110b0 0(00R<2 0WRST 9QO 0(00R@2 SRE E01 0@0S01<0S <P P0Sxd0`S  3/P V(0S`0 S1L<gg!!!g!+!0p@-@1P1 @KP,qPpPPp@qg!m!O-@MpP0` 1V 01  Ѝ P 0 OP 00CS 0 @ 0`0S $0S C 0c2#0,0S0S/0/04)D P/$0(0CS $0(0CS P-^ 0C@-@,mP(@ 0 0$0-= O-DM0pQ@0<0001(004900 S0 000Sl0S  Pl h0P0 O0@d$0剐 0Xl0 R aP< 0049p(0W 1003 0(000S03W0`` 0`S  0 0C$  0R`#8pPP 0 (0 S ,cmPU 0!08!00,UmPG (PP00`$`Xp0P0 0000(0<[ 0SQE 0W0$ c 0B0  00 00 0 0C 00#0N P0JI$  R`#`3 P` R`3V+S` 00 0P 0 0 0 00C 0 00000P 0$0 0 B4 0 0 000 0"30 $ 0S1$$8P0 S B $$ A L^ , #3\3P2(0 B .n( , 4 # 5 b2 0 Q3#\3P$0 R W    $R"R R SW  8 R Vt02S |L@-i0P8` 49囄p 0P494DŽ0`4900 v4)0 < H:L  KR Q\  RdQ h l  Bl P 0ꔀ R\q 49呄<0` S4) `D0 Dq L0 S4)T0 T`q uPsb8`h`PE 8hP h+; 0 0 30+ B0U @`4900! 0H 9!0" R RU| K80Q0900 4940!04940d0d04400; 000Sa0S00|P(0U0C0S0'xpd0S4ahP 049,PX*p U>d`VH00ogP UPdPUe 뎃0P0 0p⨀1(0|0000L0(00!0hpp03#`00 2l000SmbpPYK冃b0PD0\ SQ<TQ LS} L0  @  02 00dpW- D98@ 0>W R1= 0<080R7(PU4 u u Q  RPYY4)4P4)0P"R8P|,?R(0!Ru 2/Pp RX G<` ` <PP^2h` P 0Q G` ` <PPE    Q (  qZ@l$80 P  L IP    { 5i{0S* ,00S: $0@p(X>$0 49 $` ,003/0P\0 $00PU`0S% Pp4iH"p 0P Q p 000,OP᱀P -00-0h ,0R RSPS  P 2S$09S $02S 801Z $0494 U 00U 0 `Pl 01DR ,_G 0D SHaG 0D cD P42L00DH 49wPL0p`CUx 0S 7 0L(0 0 0S,00000,000 `L(\(    \`D `000(00H0$ 0$d0d Z40R( 0 l000< < X X  @  P 0ZT ( $ 0< T0T0[0@000(  - S 0 0  ( X5@ D, `!  `  %$PQ02S0S $ 000Q0 (PlS Z, !  ! ( X [pZ  pM S  ( 0D Q1Z00 !R 1$0p pZPFZhX0S0<00R 3fH0pS (0  ,013 000C 000#a00p0`0Y0p@0 B l000[,01000lZ5 X0VP0S'T0V$ [ Z(0P  rE[$ 0 p0ZX00C 0P0ST00CB @0  D000R,0000w[.0Z 0 0C P R 00@000g`Y6  0R 3R 1圥 +L00 042  PQ00(0S0 042(   PQ000[,00S $0T0X00@0>0p0$ @0Q*: VX  X` l  ( RS,00SpD0S 00003/[ 000VY   00X X D 唐"P  C/o"SQ_ 0S0Y ;#S50U 0$ <0#3 0R [Q <0<;2p0 0 D$0 Q -R p [0 ptL0Pl0 tpK\P  Lt 3tt0Wlp@ Q P R  ` Qp  R 00 R,,00SR@0S0X`\000``0@0 00  000   000000(00@00@0/R'0X`S\` 00`000P, Q00000+0PQ0R(0 P00S0  00 0P0SA00X0\0Q R000  43/P 40d 2SE H00H0H 0S_0X 49 l $ 0( SR 0 0d00 P 0SS(04 02 <02(0$0S0(049 (0S  B880>00 070 07080080,  R( $ S :h0@0T0P0$0[*P0 P00. PȟQ QQ \' 0S{Qy  p W  ^ P   P Q00A\V ǟA ^\Lpǟ  \H:^ p ZB \p p Wp p8@P \ p W,: pGo ^\Q p\A\Z ^ p^*pWW P P @ZY8H0B P  2s"0 6儐 08 50!8 5p T$0Y: 2!U 2ps0 x5 0q0 X% Q0d dQ$Q0SP,0S X\ P 0P 0RQ B '  (0R 'P(0S p$  aB (0P  0S $ R 30 0I` R RSS  +P 2S0)!U "R 8 !U 494 !U 001U 0 00$0Su 00#1, - B(0 03 0\d* 4)Q0SZ V R$$Z!   Y(0 R( R*$ P#3P#[ ([V Z (2R00+ 0)$0SR% R ,Q 0  E"R0$0 0C(X0CY X0R0 0C0  s$0 00IP;,0 $1D03/P^ 00/ $X 0C0 0  BR 00  00S Q<0 @w~\ЍY`!DRtd\!\!0p'0\!\!Q!X!h!gP!QtdX!$4 O-$M0@-0000ȡ ,00S-04AP$4 0 0 30 0 @00001b0 0S04) $@ 2100[A:0P49z`49Xz P00 1414ɒ 03P0c800 00$`pU49|:P03/P 103/P 490S 3/P!srp,`W WppV 00OV 0 0 pNPy 000S(0pPm 0s ! Y A0 49y0<0Q0LQ(0 0t000,0t 0 00he0 P<0 }P5P(00t000pyP0S00 RP`o3/Pp!OHP0 0GP 00)@HP049yPS$Ѝ*L!*ib!OJ! 0S 0  0S Q @Q0 Q  04,P1S00P/  @-?@Q!A-`P@Xp pppWp00SX00ST0SH?@ 0CSQ00S 0^ W .^000-9. 0 0 0X 0  x0S 00 |0|0t0t0W(0 0000 000d0d00 S1! oG!7@-\\P(( \\9Œ@@\@T  x Ѝ0p@-@d0Sp P|` 0@ PR @\ t@ | V \ R Q- ,P(,, @R(  (@) R001000娰0X000400d0 0SDp 4Q0004 R0 P 0,0D080X00@>0T0408 S  X0 4)0 R S Q,R B , b  SE  R   (  911@0d@  |}@0` Pp @O030 R000 0Q)T=0娰X@00DP00 R00 P0 00X0(0!S0X 049 ,< 0 \0 30 QQ AQdQ  0 @^@ Pk ` $l\\``\`V`LVP {`LpVWk` V:Y a[ `Vp ` p Wp`U p`W:pG`Y `[`V\``pVL\pW Y ` V*Y `YU  P @W^F \B$$\> \:((\6,,\2DD\ -0@* 30@9"R@B 0D0`d@TG (Z0P  @  @QP (\3#0  !RQw Y Bp0B48< ; ȟ QQQ\@A\ |A\^hȟ  \:pW  X\ ^ P  ^:?o N2W0SQ00 SA00S\ W 0Q*^ 0^0P 0 S0C\V`P0,p ! \3#Rx| st,$ Ɵ RRR\`V  (  !" T $@2@B@( P$(00000VB\$48\^< \:^  P\  Z$\  X: H^,RZ\ \0\\Z ^  P* \\$\ \L Z@ pp $T@ $ X@ pGpA pL\Yu pp 0S   0RR 0/<@ PV 0SE I # 0UQ0U 0W R$  R QQQQ   (P X ^: P   02R    0R   NR     A8  R R @ ^ `! `1 Y *P P ! 1$  U*P(PP`,P(PU*$`P,`V*PY BR8@@ 0 @Ts 0``dpW0(0H0X@P p R000000( 0S00!4 0S Q0000V @0S 0 00000S (P3#0D!RQ S0 ,00!S030#Rq0 0S 0S0Sd0 2;0300$00@@80 P080q *|WL!P*Rtd]?!Qtd-!*C*! R- $ R0D?o 2 \0S (0<| * 0\  0S0'T 00S X0Q:( 0Q(pJ 0 S:Do  \ P(0\  0<T T   @0V`S000T 0 T< S (0SR$0 0   RTtP 0@0 pS/ $ S  PW ( <|* PW  \ 0Q &W   R X Q:(  Q`  R:  PW( \  0RW W  @0S $ <  a R*^' 0 $ @!/o"!# P  N@( 0 ,D@  L N@ L b  Q  \: G/o" ^ R ( >~*  ^ 0R4W  RX \:(  Q  ,  R R$ R 0 !@I   QD:pGo r \p W(pp\  0W3X $ P1$ 1$00$00< S6 KW   FWb, R ( R\S $ SVPsPQ 2 0  R0@*G( R ( (0X  $0  0 0 @,,,0c 0 D 0(2  BQ S0! 0c0 00$060P00$0 00C<00 qW @`VP9$ 0 \: Q PQ(0p * Q QH( P 0Q QRQNX^J:( PD,Q? Q<$Q9$Q" 0C@0( ( 0 ,D(00  L @ 0( 00L b0\ 9hS 0$0(0<# 5l2 0<# 5`20R\!*X0 $0 $0a0$00 ! 0S0@000 Sk0$ @0@S`HU@P  00 03 000$0 000000G 0dЍOI)9 0 \0 30XdЍ0Si P0P0 0(0$0 :0P0V0 S < e80$ S$00@@0S 001@  0(0 0 ,2# 0$ 30C04h<0D0" 2 @-<\H  RD    R @@T  R   Q @@T QR$ (0SQ  Ό R  S0  S0 4 4 S0 0S"08S < R(00|*D @-` !! 4t QA@3 :,0@0 P*@8 @-Q 0 !! 4t QA@3 :,0@0 P*@f8P p@-R@ ,00Pz@0 P3:P.pN8ppp@-@ P011(`06/P0HPp!0P"01p0 @-@11,03/P|0 @-@11,03/P0p@-ɓ\Pd @8p0\0S S (0P:(3@t RT,0@0 P:p0G-9S7p 0Pd@`1p1(T@0 )Q0S S0 8/P (0( H3Q"/pa@!&O-\M @6娀00T00(90S; QU 1#UP 670 H"@"fHPj? ?P P!PP q}+`'S0HHbV 1 Pp0C00!R0@rf먐$9SS Q0U !RdP6T70 D"<"   @P Q 0RP 0C[  R0 5 P 0 S01 00R00  R pW 25Sj: 0 `0 0Z25 AR]0> k>`P P!+PP q,G 1S0S 0S0`0``(XS0DD" Rt $0 :$0 6$0 2$0 .$0 *$0 &|$0 "p$0 d$0 X$0 L$0 @$0 4$0 ($0 $0 $0 $0 #0 #0 #0 #0 # # # # # # #0 #0 #0 t#0 h#0 \#0 P#0 D#0 8#0 ,#0 #0 #0 #0 " "0 "0 "0 $ \PT HH2SP"81 0 <0 30D 0Q L 0S 0S ( ! 0 `V !p R  ` ̑R  PU`  Q0 PabDЍh*)!U!\)!!)!(!?(!(!h(!F(!D(!7(!'!k'! o%!&!&!$!]$!y$!#!O"! /!.!.!!"!!!!!!!!!!!!!!!!!!"!!!k$y!!p!!9!: O"8!!m$B!!!!0!! ! !? ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !Z ! !!!d !Y !*z !! !M!@-4@VOP@ᶱ0 .S LP/ .P/_S0.S(0LS%_PLS 000/ 0S/-C^SR000 0S//伌*  @-c2'!!010SS00Q00S1/O-p!14M XP@`0 0,000 ?0@100d000P !1 0 ,0 309 h0  f|P 0S0 S0P Z0 ?0+000 P0P$0 +0S 0S0SV 0  :P0$0 4ЍL*p)*-<0$Mό0(000 0@褐P$Ѝ)@-όv Ѝ0p@-1!0P0Sp0@49p0 049p0 SPO-`-P048p W@P@ Ѝ蔰0s|&@P0 11 0R 0Ph   Rs 08P  8@@OoB!!!  @-N1#!s !000 0RU p@-@0P00 Q*  Q Q  Q  0 0E1p Q @Qi0P  "  B  0p  Q Q Q QG0P Q @Q /,!p@-@PU ,00S 49S P hᘍp@./C- tM0 @P00l000 0)0S0d 000 opL`P | p0 0 l0 30  r,Q P (0D0tЍT*|!؄*0@-000 Ѝ|"|2 A-pM0@P0l0000CS񏐎j|4",2 0 l0 30  pЍA0`S !1 0 l0 30pЍ0ḁ,03/0090,03/0T,03/0p803/p0Sڨ 0)0T00H1p 00)T00d 010qnK`P m,Q P 0(00X00\00D0 0 0 l0 300 0 T pЍA!h 80 0 l0 30H0H 0 ,*܃**!**H*9!!4*,**8*p@-`P@r0P@CKPP  q00p0p@- S@P0gSp0P03/0090 P03/0 0iHp 0C S  p@ x lp@ X,}P`P 0(00X00\0r2P0020D0dq!/p@-P@@ }hP 0090S" S% S'0SH0P03/0090PP03/0 0i|` p@ p@ S -0P P S "S pP QPH < #S %S!S #Spt!|A-@ 0SS 0CPSnt "S  S  1S00S SG Ѝ3/P 0` R:0P03/P  0R0P0`3/p0090S 0P03/009 0P03/00)0S0 ``0CS:0 `0`000`D0`3/p ЍA00S S0wS0kSP03/P0 0R pp0Q  00{ h0Rs:dp P 2/009i0Sf  x l  ЍA0SN@ 4 ( dM ! ! ! ! ! !/? G-M0Pp@0000!S^ S*SA*S0CS'`>  0 0 304  $S S:;C S񏐠4I^s-S)  S ''B,B: BS  S0S  gP-p= 0 0 30Kl K`-S Sn0SkD fPe0-= 0 0 300 01S RR2o009 R! Q   H 0H0000``y3/P 4x,@< 0 0 30 d PЍG0S 0  `P ,03/̟p X GR 0!S*  },@W0G  GR+W㜐t,03/; 0 30,03/p k HP< n,MP3  0R^* 0,03/0090,03/009*h: 0 0 30Ѝ,0圐3/: 0  ikhH`P` ~n,M`P 0 0C(00Dp 0X00\00,03/P  D 03/9 0 0 ,00( X00\00D00Sfl eP`X)8 0 0 30+8 +0SP  ePJ )8 0 0 30 0S: eP4(@8 0 0 30 0S$ ePt(7 0 0 30T 0S< eP((7 0 0 30 0S {eP'87 0 0 30 0S eeP'6 0 0 30p 0SX OePD'6 0 0 30$ 0S  9eP&06 0 0 30{ {0S #eP&5 0 0 30e e0St  eP`&5 0 0 30O@ O0St( dPn&(5 0 0 309 90S^ dPX%4 0 0 30# #0SH dPB|%x4 0 0 30 \  0S2D dP,0% 4 0 0 30 0S dP$3 0 0 30 R dP$t3 0 0 30| Rh udPT$ 3 0 0 304 R  `dP $2 0 0 30 R KdP#x2 0 0 30 R 6dP|#$2 0 0 30x\ xRH !dP4#1 0 0 30c cR  dP"|1 0 0 30N NRt cPn"(1 0 0 309 9R_p cPY\"0 0 0 30$< $RJ( cPD"0 0 0 30 R5 cP/!,0 0 0 30 `z* !x* !+F !x* !IGISw*)$v* !*[ !Q !!t*<!,!!s*!G!(s*!!r*!!xr*{!?! r*0!!q*!!pq*!7!q*P!!p*!!hp*!/!p*w!!o*0!!`o*!'!o*!!n*Z!w!Xn*!#!n*!!m*!{!\m*M!'!m* !!l*!!`l*!+! l*@! k*! dk*!/ k*}! j*<!O 0h* g* g*K ,g* f* |f*_ C $f* e* te* e*B @d* d*Xc*R cP 40 0 0 30W WR} cPw 0 0 0 30B B0Sg4 bPaH!0 0 0 30,h ,0SQ bPK!81 0 0 30 0S; bP5!1 0 0 30 0S% bP,"1 0 0 30L 0Sd bP x"@2 0 0 30 0S |bP"2 0 0 30 0S fbP#2 0 0 300 0SH PbP\#H3 0 0 30| 1S" |Rj0 $0I000P 40I009@_gP @0 S003/P 0$$4 0 0 30[ ЍG"`$X4 0 0 30N O$4 0 0 30A BO-S0`@ P "gP00 +XpP) 0@000X03/0X03/0( @X03/Y  @ PEj 0 , j @d0 C-@ M0Pᰐp000001 aV!P0`  F, CigP <eg`|0000 \00L @0 0 0 30 '06/PЍb* a*O-p "@2M P`0 1 000$0(4 1100< 2/ @ 2/0& @03/0 403/0,403/00403/04403/ 8gP Hg|00000010 ' 0 0 0 300 2/ 4 2/0  403/0,403/00403/04403/08403/ <fP Lf00000000Ѝta* D`* O-p"@2M `P0  1000(0$!  < 3/0 @03/0& @03/0(403/0,403/00403/04403/ 8tfP Hpf000010  0 0 0 30/ 23/0 403/0( 403/0,403/00403/04403/08403/ <8fP L4f000000Ѝ0_* ^* O-@ M0P`p0Ѝ00001 Z  P_(@H 㼁 Xh0 0`000P D0 0 0 30 @0:/PЍ]* h\*@-00 00Ѝ @-0000Ѝ+F @-010 S (00PЍ00 @-<0 00ЍS @-10 00Ѝ' @-10 00Ѝ @-A?0 00Ѝ @-10 00Ѝ @-10 00Ѝw @-10 00ЍK @-B?0 00Ѝ @- 10 00Ѝ @- 10 00Ѝ @- 10 00wЍ @-C?0 00lЍo @- 10 00aЍC @-10 00VЍ @-10 00KЍ @-30 00@Ѝ @-30 005Ѝ @-30 00*Ѝg @-?0 00Ѝ; @-30 00Ѝ @-30 00 Ѝ @-30 00Ѝ @-?0 00Ѝ @- 30 00Ѝ_ @- 30 00Ѝ3 @- 30 00Ѝ @-?0 00Ѝ @-;0 00Ѝ @-40 00Ѝ @-40 00ЍW @-40 00Ѝ+ @-40 00Ѝ @-40 00Ѝ @- 40 00zЍ @-<0 00oЍ{ @- <0 00dЍ䕗@-40 00YЍiC-PM@`p=^PЃ00 ЍC'.^P00 ЍC$ ^P00 ЍC"d^P00 ЍC)0^P00 ЍC&]P00 ЍC#]P00 ЍC ]P00 ЍC`]P00 ЍC,]P00 ЍC]P00 ЍC]P00 ЍC]P00 ЍC\]P00 ЍC (x]P00 ЍCj]P00 ЍC\]P00 ЍCN]P00 ЍCX@]P < 0450DЍ/]P00 ЍC!]P00 ЍC]P00 ЍC]P00 ЍCL\P00 ЍC\P00 ЍC\P00 ЍC\P00 ЍC|\P00 ЍCH\P00 ЍC\P00 ЍC\P00 ЍC\P00 ЍCxy\P00 ЍCDk\P00 ЍC]\P00 ЍCO\P00 ЍCA\P00 ЍCt3\P00 ЍC@%\P00 ЍC \P00 ЍC \P00 ЍC1W I  s H  Y 2 f @  \ 8  1 o K " ` b @-0000ЍELIF C-M0PEqP`)pP PЍ ჿ@P 40 p0PPeQ0s@-S@ 0CPS79;IKX SN  SN L SE 01`,10Ѝp@/10 Ѝp@00`P`Ѝp,00S0S0 R1`13/000000P 00000 `P00H00@00800000Qtd #.{|T #U N oC 00S @-!00/ @- R @!00@T "Djc/A-p@`0@

 NPB;0P0N!'P T&0P0|0 Q` 0 p [0G,0N0 0 1 Q$ 80@03/( 80B 0C 0<廵P1 020@0$ 00,,03/PP 0SP p00<垵0P<P㘵 04 /d0 020ꉵ(0@10(0! 0 0 0POLЍDA*P @ R  @ pP//9*D90@/@80 /@-@Q0 400S80 080 00 0R 0 0S P0 3/P 0AQ /P/,,AQ44P @/ 0 B0CP _P/P_Q 0s\ 0A-Px1@3/ 0P, S0|1S 3/8008080 8 0<!00 6&f 0310C21D!!! @pD8!! 04 0$1S010C  4 2/ 10C10|q0W !(40 B7/! / 0P /R///0//0/90 /p@-PH@T `0Fs0S 0SS 0HS0000p CR  B 1S 0\C/7@-@ 00$0S0$00$000Q5/000 Ѝ00$@-Q   R-*Q\(\   2!Q !   B! APAQ 0 R0SP 0P 01@-= S@ ,131 @-@80S(0 80080T0STTP(   R  ,,)?  Rd R !- R0S@@@-P0pM`!20-9$3` 0h02 0! 0 S0 0 0x0 0S R 0H00 P@0$,03/Ѝ0 x` A-pP`@,TKUP 00 @ $ P@O-dM@0P0%0 5 `0 0\000(ȁ001Q8< Q @D Q $ $ { 0`F0p S 0 0000 0T4000Y1S 3/0 R000S !0 0 RISQ S_ #R  R- q0@Q0  O00oQ70 3/!  \  0 3/ ( p  0  0# S S "] 긒 0(@0P0TS#0"f tꄒ | t `9/p0`S(X` Dp0  HR \P0d 00``S J0 0J!1 0 \0 30U 9/Wp9/p9/P& V 0 pC9/0 P:U 1PP1 X00* u\0 lR  l\0` 0p W  R09/0P* V\  NR0 00PdЍ0*< $ d (  \ < x @@<-*70 0SJ 0p@-s`3 D R0 P,90S3 0S'000HBT 6@P%00p0Q@0S0060P D     $   0pP 0D0000000H" HB/G-`P0@PP+ 0V `QpF h1Gq0tV0 F 0SPS: 㘙)q0PPI 0 V0CDV d C1"! 3!!S 0BS p P Z  0 A  A   O-,Pp g,P00 0pO-`X#T34M PXp@00,00009S8s001pY8  Q0-90-9"" R0-90-9T 0S 0 1 000@\0X `R*X0`p~'0 40|0Q0|0X0p 9/P !1 0 ,0 30p qW+ 80 0S70 @U@BOYp T1PpG @W J W %Np00R00S AQ0 <*P 0  0 007 pWT p T1P   @W.0 0p W000 8\ ,`Pg4Ѝl* *LxO-H!@D1M p<`0㨰0 008P Y0P Pb|P) 00CS$!<@ 0 00 0#2# dzP O0P0  !  ) @0< 00< 40 0 0 30 PЍ**80 0s000 0/80@-@@ 0 CR 7  RS00 0CS0 3/70070 0 B/o0C?o"2R0   0 0R : 0R:///p@-P@NPp 0RppO-$M`00p!HPP $Ѝ P0( p@T`040ȱ1R80 R@0 HX3:0 3/ 0@P "$T T`000 `@= R 040/T ( `² ̲  R @ <  @-01S S// \ O-@",M2 00$000(0S "2 0 $0 30 @ 0S S SQ0CShCPP`S00PU PU (0@ 0,93 000 000S 0pW< 9S8 0109-90SIY+ 0 c`P >  P eC0x!YP 0i#00 S RCPC000 0#2) 0S&   ~MP S"2R 7  8 ` \ 4 S00CS #C!CV,Ѝ0**| l G-`@pPU T PAMP 0P0P qRPnRU  RP  PP (` 6 ``@ظp@-@P0(*00P0S p 0SP *P p 0G-sp0`Px13/pP 80S1S'@zL@P DK*@P0pH0  4U0 0Ǵ 00 , 0R00 0R,0B@ 0@-s@ <L< 0@-0CS@0  !- R 0 O-ᘠ`PZ LpP40PE)@P0 EPE T p0@S0pD40 0S0S 8B80  3/P80 3/P 0s 0 (0 O-M@p @10T0 @Ta@b Y)QPL0W8 剀 !  UP3@ @0)`P@1 0 1 0000X$W 6 ! :K 0S0 10^*11#<# R :dYAЍ000c0@P RTppW@4 S  BR/0 /@-00 RA-p@\``T PPP-,P0 @a ``8s z< Aq *l $<@-(/Ẩ h 0s /A-P @@qQ0S 0S (0*50 00CST`L0V 00L0?0P`T0@S8008020S Q0P000S -0 p@@PP00 U ?U@00p <A-@8`8 010CS 7 0SJ 00SM0800q0SI RJ70 QŸ(070500RQC 0 9@ 0S 0CS700070 0s70  [P0000S 00S 70010>Q700703/PR0s03/90@-8  \ 7 \   (\9     S 7   C0R  )70P  0S 0S 0CSt70\0 3/9 #9 @0U0@)@Dz y "2 G- M0`00000@`pPPU000"(2 0 0 30 ţ007 0ȑ 0 S 0CSPPP 0 3/00@?PPA D0S0@SPP0S 0 00BP0p00S 0 3/Z00 0s 0<"P  P0# R 00S0R0D0SD0S0P  wDP PU0 0 0$ Ѝ)T)#{ 0A-0(X ` 0@S`Po`P 0800q 0S`0S0 3/807 (40 S% 0S  90@  0s00H0(070 50wPP00@70@07090@ ,0S 03/P7  7 P40S80  Qy 0S/p0p@-@ P8  r7  wPP00pO-tM0ϟ00@`H00 \00p$00夐`00L00Lh00400800l000h0H .P ^  0kPP000k018 0 0Sp@ 0HS40SXU000X*X0p0/HX0p0)00p%0@DpP08 0S T*0W@S 880 1800Sp@808   P RS1S@DW PW00 R>o R9  9 9  7 (Q0#<,!# 00 0 00 0P00Q00B(XRS`0000  013/T4P 013/@T0@  N0 40SQ00Q00SA X00 ; 0S 0S5,0#<0  L 00)W0S0 070,0(0US,0  0  03/70 0703>30S R 000 0 tЍWF (0C(0@04 00S: QS7Q 0 !0`0 0p00s0S 0 00'0`v`V 0 0S  0x0 0 0(0S 50P0\Qc L S 7  7 7  7 7 tЍO0 0O 7L 0xhSP#!   0 003/0P 00S  0  03/( 80280( -0,04000400S R0 00 00S  0  03/80 280m0,0400`4`(0S00S ,0S0 0$00$0<0000R0004 0$00 0s0SX 0S4 008 00400S 0S <0$ 0X00#00D00 000S0 T00R00#D00, 0d0K 0SH7 000S@@ ,0S( 0tY 0H 0000p9/P H000,0 0#$ 00#  X $00l 0s0S70 W (0 (0 \ 0 P05/xD0 0, 0S  0 0 9/0, 0S8 ,000X0SwX0Sq 0S  0S`jT0$ 00s0S h0`H P0800 0Q4 00s0S& $0S W (0 (0$` L `00<0 0`0  0s 5000CS 0  03/(0S0V09 d0S`> 7``; 0 08  00 @04 S40304000 0SD`` D0S 0Sh0`\ p000 0p13/H08 00  @00 00s0S00#6'  0  p07/\ ,0 S\ 0`0S `D0 00 8 004 0 0S 0D0Vb 0  0000 0 0`03/70R 17070070L`(0Ss FX0 p ` R000 Sp 00C0000$0S0   (0@ ( P  Q R 9  9 9  9 R80080 Ao$(Q[<@$0qQ (Q_D0S`M)Ds s s s Dg O-P0(0S P Ѝp` %r  9h@P 0S@8 @4A0P W*0S@S 880 18080 80080 0Sq X0 00S 0S h70U 0b S0 0` 80Y@08070070 0!50Q00500 3/  R 0s 5000CS80ԕ080ĕ70 00R0S020S 80 0s}*PPy 90@u L 0so ЍO0  00CS0 00 0@03/$PTS0D0db C-!4M1 đ0 0,000( R !1 0 ,0 30Z Pp`U${@P 000000 0HP L0S0S5 P < AR*CP 0@ 0>R10 dk0PTPl80PT 8p 0 L @ @L 0004ЍT)H))D00S/PP /00@-@0SS0l R T pP8P P @@o/X!X1 @-M0`@0000070 @ 0S=00@0q(9 P% D0S P 0 0 0 30* 70@S  0S 000P PU 0 3/D0SP  qDP PU PЍ))O-Mp`80h0[Q0P1Q 0I V@  00S xPP` .X7 0SA  N0<0TP SL0S0@PP < R `0  }P < 0( @R2 01 0 c#L R 0Sh`. Ѝ00 0 \P.A-` PPpPpЍP@T@ 0200 |P @P0$0 0x0P p.0@090A-  ЍH0@S 0S 00CSL p0P,`00 `FP 0P011 0!0 CQ UV\ H\  BR*2( R  0d[ O-`0Pȡ@0@<0S ( (0R<@1< L0S ( (0RL@1D 0 E0 0(0S㒃( 3! p 0g'V:(0 S300  ;/1 00a(0_  R r 0S/0@-D0 DSD0(0 0 010#,!0(090 \0S 00110 ,03/0C\^ p@-@Pp@ 00CS 0s 80 9 00 2P500S S70  0S%p00(Q80R01 143/PPp0P> 5@-@ @R38 07  ^ * |% " 9   P (P8 \ Q! !42/P /dP0 PD0/0  D S 01R   0G- 0 00 00(0S 0 0 0 30% 8`QQ100ȑ@Pt1tp(0pPP ( 1840 @3/(ptPЍ))8`U H"H2 O-M08r0000p0S "2 0 0 30x `@(0S8P PP 800ȑ01000o0j0d0S Q/X 0 049 ( R PZ #@ R #@ R P l  Bl  #@X#09000>@0tp ⠰t0( 0W*1 800003/ 0R ;" t ( C A4pЍ))ȷ)1Z Z DX!X1 O-M0@0 00P $!1 0 0 30= ` 0T$4pP TQ5P 8P  @80ȡpPt t0( 80Y*1 003/@T0ST510Ѝ蔵)X)\Ao/P !1P||0@o///@-0  (@4/ЍO-P@(0 @ȁ   Ѝ(0S0S 0, ,9?0S0 `|03/Pd@ T 0 R @P R    0@ 0>R 0200 XpPꀐ0 9/0h0S ^+Yꌳ)DO-Mp0 b@P/@5PP* 0@S': `P@ PE 0 0 = 0 J=0 b@P@0 b@ |Ѝ?O-@-/IM0p0 ?0010,00S Sh T P140(0@0 00SH (0S0RH00S40 0S 4 !ARoP4 !ARoP  d`Vd0S` 1= S\ H0S0 T0(0S01 1T0SJ X.T _ypP H0 pS(P00 000 bP 00CS` P 4 0 00 ! 0`   :AeP 00(0090 ,9,0S3 0L000D02`P .PR*έ<P 0@01180T0@0<0E?P040!(00C80Q$5*<` 1S1Q 00@D 0prR pG*0SdX0V$bV R`00P 83/1S!᧜0P<0 1S# xp ᘜPW i9 \ g0PX0 \ ~<X0h 0h0@Sjp1S# Qp qPWt B9 \ @0PX0k \ W<X0C/0 1@SFp !1R%S# 'p GPWJ 9 \ 0PX0A \ -<X0B/@01Sp1)S!$@1Ys 1.=.408 100800 0 0 0T0@00 0S20 P:( P00* R. p$bW L0S 0@ (")R 0 00$r3P p 0P<0D( 8 0 1 30 H0T0 0H0S00P0 ,90S#@0 ,8 X \QP 0 )R xa > 9P  0PP0 `00 !RR P! 0PX0- 0P80* 40 03/P806 X0 `Z;00 0000 0000T0@0S 20P@0  0X':800@080P0S@ h 0 l0S<:0P 0Ch 00^0@0E ^00 Q00qW  ; 0 S` ;0` 0S `0000pP0l000S .0 d 0\!#0D0<00@0t004000J J|00S@0P:(d8(0,) @- X `\ !10 00X 000:0T00P 0 818( 0Y:40 03/0P<0<080d0e X(@'0`|040`h1``3/0P0 0` `0Z#20 S/ %V+*)('&%Q0-)# < ud |00ChC1#H0Sw 0R0s0S0* Q+2p 0x000 KP^ 0sd(0C 4b`qP "K 쀝X " 005q1p 0>00x0q1p 0000۝P ]0Px0 x1p 00000 (0B0 0C00Z0S00S a`%P 'PXE'8C'@A'P?'440l`V | 000000 06/P 0S`00`0l0S0l0,) )S /S \ |L Rtdo)mJ +kK SG >  8P ? E DzC r? c? W$6 @> f< 0Z0S1= S p P004 00X!00 :#S6L0000001(0Sl0S0E/0l0<20E?0S`  p0WH"R 0S 0l S$lE/Ә  0>RZ4013/P0H 0Q R-0 0Z R000J 0(00$00 000>00000< 0 `000000|0P4 1SN0S 0SL00L0`0 00CS0D2S LVQ(6#(0CD0`0 p040W 1000 0000000a0PD0 `0 ` 00CS`0`x0S (0S000  H 3L  Z4013/P(0S@0St0t`@00S00  0S 0SD 80 P% 5(00S(00 L0 0#R00S70 070YH0S00S 70 0D0L0SW 0SY08p001@/x P00q x00@Sg p8po<"VVD2(6#Y@0  Q Y t0 0ꔕ 5 5 E?pW0p0Dw  pPE $8 @0E/ R RD0  8p `/H0L S70R0700S700Yo 80i L0SD0t 0D080 0 Sup0W0s0S 0S 0CS03S0o R ( 0D0X!Wb WsQ 0S L0, SwR P0,00Z0$ L4 \QPQR Sp(0@ ppR R 0S0@-4pH0 Z0L000L0S 00  00SD00D0(0L0ASCD 0R; s> 0PD0 90@  0s 0PD0z <0S0L  0S D0S 701S (0 70  0 90x 0,) @s h $Pmq0 4$08/W ,90   070 0070R007070707000Y70 7090@z j 0swt0q8p010100x0C 0P0 6 00  0  0! ( 00<$ 0B? .0A? 0E? 0 |0w0P0 0@000S3000Sq70l g 1 S00S qR00S ( 0   C?00 00 00?0:^P 111 R01q 0SN0 0003/05 00000990  0 90909S Q 090D0S)0S7000070 00D0x0SQXRD0SP C/ fDP} 1Sz 0  03/3 pPH '60 Cx0!6 00 ! 0( 00<$ 0B? .0A? 0E?  0|0P 0So 0S  0S1 R      `q 0S0  03/909  090909S Q 09005 0000D0S0SX070 DD0S x  x0@R   T-P z0p0 00CS0pS0 070qa17070070  P1!S 00CS  !C/ 00  ?0:  ]P 1170 Pp 0Y800 00 0w p0QR 0S@ 00,0w 0s0D0 5000CS40  03/0D0,0S# 30 .0P<0QP00S: (07T0\ 0#R00S/ 40 d1 0 S0` `rY# 0 P R      0 200 4P P 0"R0h0P ?"h<<^AQ   00 qW 0 S00 4 0 ؀S`004 0` R `   pX0S 40 03/Pd0W X!0@ 0SRI A@0@q +P8 00CS4 @ 0PP0<  r4P0P 0 DY`P 0R 0R 0R40  03/p0 0 40 03/02S MP!0S@!t0S \0 G pP 0 b Y?T: 0Ҡt`@0@t0 00CS@t0S!400SH0S0(0S0 D`P PH0Ed1Z|0 \Q 0VpZ 0S40418 3/8 P Q 00L^ 0 J^ 0  P\0R!Q 2P\Z0C 90@@090@0S  0 @0Z@` 0r sw  P 0sm 0sj Pe 3/PhKpP( 0S .S#t7p  000 0p H70@ >R p 000-l0P<0 0S 131O<0S@ , P 0@0DX08080@080XP0VP0X0d0R-0!< FP- ]c0PU& `P 004001H0L0402P0E?X04`0D0H08P0S80Sk 0S DHSR0 040  "L03/p P 0S 0(0Sy0sv`Sn gPP P .00S0PpHp STP(0p@ 9Sp 0-)110:00S0 0JZ   0P@0 0 #T0T0 S 奒PP@U40 7*P " R P R Q!2/P R h! 2/PP\UPPSr P0 yP, 0 4 P0 "pX07/Pr  0p13/P 08 0U0 8  X  B0C P ^ 0D0 0H0QHS 0D00Z9 600;!9 H0S@])P 0@S @0S 0| C2@"0P@0/ @0a00,0S#  30H0<0:H0S00  R:  7 02 (0S200 0R-0`V* PT` 0D00H0040 1 03\00-)# h  h h\  B\ 2`0\0S0\0d0 000\ h0 0Pd0{ `0S\0f 0P`0 0"d<Iߍ4 4 V4 d4 SkkD80   0CQ/0CS0@P///p@-hP8@PTp00S @d0S 1= S 0❯Ppl)DC-P1$M`R⨁p00003@0STW 00CSS 0  0!! 00 0  ?0 10>00dYP  40404040 0 0 0 30, s00 U@P 00CS70 40S0 4 S h H0 0>R00 4 $Ѝ))D )$ $ O-MP#0/<00 @00@D00 H0?0$0?0H 00000(00S `l/d? 0 0 30 80[ 0 ( R  0 0x0t t@Vx0S 0S 0 T&p P`㘐Y\ \@`U`0S0\`VR(0S < pP(t`V 0S `V0 090v `0 0S00000S9(1 tP(0S=t0x00 0S ( 00z(1 0 T& |dt h p0 3 $ X00 0X11 00=0 >00GXP} X40D40404080080EPn V0700 ᶇ00 0(pⴎ dp(<0 0V0 <"0ȁ0@ 1 t 0t@x0OU0[9 00S6  7`P 0t <2St@03x00|02U|Y#0H2S090  R=0S( tPp0Hb V20@0D < H @ 00Sj 0Sl`o` 0 49l pW 00SR00T00U,000S0 $0,0L,L u`P 0 P0T L 0 \/0 ,000@00 00R/00 &T0P  BR 00@ ,  ?/00 T0,0,0S 7  00CS0ו00Ǖp pW` 00S 0(0p R    , R0 Q 呎0 | T3%pg0S,`Y$ X00 0X11 00<80>00 WPE X4 D`$ $ 4 8 8 P5  t R R4 R '  㺇 '> |R Q R v R  R㈁ tdU0<Td$,0 0Sp01h0d000{,Y 0Sd0 00dT$0 0Sp01h0e 0S$000T000 $Q  $p 00 0pS 2 0iZ`0Ǎ0 Ti$p 0  0S0p2 0刍P3/P0 498 [^ 000SZ  w H0P 00g0 MPb p00p04 0R8 0RD0S`C< 0R@ 0R0t t@x0OSx`V@LQPQ P P% P/ " P9/P [ 0S 3/P 00`V 0R 0Tm#0` $0@( P P  P 1  P x R P P|!RLP 9P  )PSt0S0@rW tP  nP 0@"R PD o Ih0t0t UPi<2S\ ` 090*ЍA-`d@PpT0lp00S  P0p  @A-`d@Pp T0 d@ppT@00S  P0p  @00 S @ yP0l@L,L< O-M00|000(pW ,< 0 |0 30 0P@ȁ03/000Sa`  1`00 R 800 P sr 0Y\ g1(<tP{ !0 00"0d0 H TPi 0 04P40 S U0  BB ~ ?o[20SN0xd P` %0 ((tP6 1St0 ` S70 @03/0t@0 3/0@ 0L  !@P 0 D\00@4`Px0S3 @H(tPA *Pj S0 403/0t40@S 0  (03/t 0 (03/( 8 0@P |1S Ppu8 \0Rs LE@1 (F`P 0t`403/0403/0403/0 403/1 0S00 S0@0 S0403/1 00403/\0P0DVT`8p!C!0<0S 3/0ȱPR  0YP 0S131@(\)(D00p@-S@P 00S0k000000080  R 7 7R\ !7 77 \R  7 7R\ "7 8 ##380 8Q 080909S!Q 190 0Sp0$ <R$ R $ $ $ $ $@( R( R ( ( ( ( ( rp r <TO 0 0<0<00 00<0p ^  00 00R00S40@- S@ 0H0(080080R80080 0s0<T0 00<0@-@ ( R00103/70 07090090p@-`@PL`\L<@DHL0(`,00100p7@-PB@P D &00 L0PP@ Ѝ0 00$09:00S/,00S0$/00S,00S ,9P//00S/,00S/ ,9/0( Rh/0( R/00S,00S0$//!1 O-M000000000S Pp!h1 0 0 30O >,0@0S`4pP (0S  PP6 ᶗ<P0 0 @0(p1p011 0 Y:! :/ R R ᵆ P P  @ 0PЍ|V)8V)SQ/P   R 00@o//O-$M`@X.K Xy?,X[   !k @ B h?oW 1 #2d&U0S3scSVYRU!W  I 0@ BU$ U* U,@0CS0SH0 X0`1 -[ BH 0 B0G`pGv$Ѝ!8 1/@!!, = U U U@$D`F0$H@03/0@403/$   `d$p@-@J@ P0vP pP@p)A-@T 0P 0`|@pT  AP0|@W@@,0S(0, R( S0S @0?O-M/080 |?00000ȡ0d0(0@0,0 D/S2- -9\QS!  1-90 x0R0?o20S $0T0 00(000㗅0P0  0p@!#$0000,00C 0=0(0$ D0Qs2!X0 =d@ R0 p0 =< 0 `  t0 $ T 0< 0 $!6S!0@ p00S D Q0S0-93) 001S%,0pGX01  BR  0 0  (    00QT 1x , RP$0x00NHqW130CS  0h00,0I  -)0S0T#20 0+<8 Q*0|0|0 0 S  T R  Q Q  AQ1*@Q( R$  (0@00Gq> q| =|P 1= S0T0S |0 sX0S0h0Q0 dYP~ 09S 00 SP 0 XP|00?0T0SG.080080D 00|0@ <PN |0 <  Q @   \P    B |p  {P+ P 0ppz00S 0 13/P nW80P0800 C0000.0$0 0>OPG007, 00S0 0!@ ,01s+0 0001@000d嵃P 0 ፔ<P < 00 0|00000P P,0 !, 0!p'l 0x x0P00!0P0P0S($0X1pP @0P P @0P0.SS1$ P0R l qk03013S J 2300101S413/( P0 #00(004050@0 00 S:00 d 00000x0000 (0Ys pW KP 40S 0 0p  p,08/(0 P!0 R  0 H R 40P X01 01S3P0 0L0 0  ᖾp(0 000000 p000P)P)P)z;PpsZ>D<00 D000S@0 00 0 0(0<08  0R0 -)# Y, 2H 00CS 0St~00 0 0008,0000S718  .Y P0S 0<000`0<10Y 0S @Q 0S @Q 0 Q0C0 R 000EP 00C0 ,01s?D009 S 0 d!0Pl0E @0 D0<P< < 00 0 R D  0 PQ0 000B0|0 lD000 0hP P,0D !,0!#g Tx0  7/P @ 0x 0  7\P0 ;Tx0  #x0  "0  . 2ppRB RK RL F| . "hpp`pp<)<)T)P,!.x<tXH |"ht"` ( 0IL$)DR*-H` l``x0 ````00S0P 0PrPU0PUw0h0S|0 h0@0S 04S ,@ .Q t`0 P00 00j020Sf0PUtp0`X 5\`X[~0PU0pX0S|X+4`VvdPpU@0S6$0S0 0: 00SI !P 0H0S 3/H0S` 0PPH 0 00 H0 0 M0D 9 S R 2 05/Px)tpdP0 x0|0(0U 0`Y#\0S 0 00P 0t0010c"0D0S  3/ 01$09/Pt0儐00 FP @0S 0S \kP  <00@ 0t00D0S 3/0 1 $0b"8/PU3 D0) R0S< 4 05/P4009S=0X0ȑ10;`P 0S 0|bPT `P0X%q 00@0S 3/$0 0b" 101 0 S00<0 0娐Y> 0W0W@ >G0L0QM 0pPUs P50S tP(0US %0< D040(02疂" D0S80L 3/0 L (13/L <00(0 P0 Q00   00#< W00 @0R 0"WS ( ( R 0 0S 0 0嬐 BP0PQ  0S 0G(34 3t(<0 YPw@0 p3/(0upB`Pmup6P` 5,@ 0>Rwh\up$RIsc <%Sa "Sa 010)s(p  !Q  [  R RY"t  0x 0 $t1403/i"L000 <P 00CS`0@ Rx < 0 0P$tptp(0S)(0x0spspspsp pspsp00S  0< 0CSp 3#0P013 03S ^0( Y p @0< 00Ppt0SSxxp@ ! ^  W  Wp00 03/P 0 t$P tpt`(PPW*0 $1003/t0S!0, 00S2/$0padP`U   P00S S 010p(0S <1,@0>X  00S 00S vP <(00t @P[0!jPT0Tt000S 0, t .t0S <0RP5 Cߍ芵yxZD)xoj*KK)IIÿ  S RR/R0//9zA-`  0p<ð@0P S 0! 0#25 0L0 AT0,03/@ 00CS80S@08009@\ 90  0|0SW0H@0000A/@08@8uG-!8M1` P p004000000|Q00L0@0 P@!81 0 40 30D DqP0S U  @P.Y00S R@ @P p0 @ 0PUP 00 P 0 00!R: @8Ѝ)P)@-P` )P@ 0 0  R(0@ 000 0S _P@ 80 0 0 30 pЍp)X)3O-M00x38p0 0W 00S pd@T 1= S (S$ `P  0000   R`d R 0;   P 0d R 02Y0   ᓻP P 0d0S0 ,03/@TVdP0 SYjT U 0eP000000 |   | \qQ  | \  |Qd R      @00Y0`  V  0  0 0} R*0 @ P㐡`0  jPЍp@-@ 0BS90P  0|0S 70 8 060p 0RS5000CS 80S1SDP 0P8 02 0 3/P@-P`pD@`T Ѝp0 90P  BR 8 0..S 3 #S 3R & @\ )D\!\1 C-RЍ@ 0x R |0S 0tP බP .mPd> `0S[\ 0|X 0|0SV@ W>P0,03/@^@o  ! [ 0 P  (  (  0 K>P [ ^0| R @P | Q00  dP  >@0 @0``V 0  0|0S |Z  GP >@0x-P d ` V 0  P 0 S} >`(D(op/ / 0 0/(D011 /0p@-@pQ PTP P0ppA-P0p@T`p >@P 0P0D <0 n0P X Dp @p0A A40@-46065 z Ѝ0A-`P@Pqt0 P !( 4$0P$'1 D0A/ؓ0A-`P@Pqt0 P !( 4$0P$ 1 <0A/d0@-P00` p3@P( 04 07 CQ - 0S"00@ `0D0070  0H`07090 0900.S 00 0103/ Ѝ500050  @00S/@ R  /0 0S A-`PP p0@d 0p004p07/ 00,@0 4//YcA-P00S0`@q0  40S P P3(0S50S P 1   P P3(0S0S P P < P V a `% }P wP 1  pP p0 3p0 30S A[ WP  QP 1 0, 00S ($2/oo=;P0  Q/  R R0#S///Rp@-`P Ba @`P   00p FRp@-`@P? 0OB"p MP 0 @CP0!1S00pU: 0p@-@PP0 @C0T @  @R @pP@G-PQ01封X@ꀀਐ`@㗕' v!`@GV ]QUT  @& @@P=:p@-@`PUP0c0V00 0 3 S 0 ` P @ pp@-P@pO-PA0M0`h1 0 0pPPX0 SG $!  X1 @A 403/0   @ G0 @@403/00?  !!R  2/ 0ᓡ"0 }G[@0 -Z  q@Ѝ80FR  "0\/P/0S // Q0 Q < 8  @-011/ R/ҚA-P`p@ !A-`Pp@  @- ЍA-`Pp@ A v@- Ѝ00S/0G-P0Sp`Տ Ѝ`0@'0/@ ҟ 0 00Q0 0S  @ Z0 -ATV 00S S S 0 @0 00 0  i : nN#3 O-,M00$000S` @P#0 0P*000, Zx#l3 0 $0 30 g,ЍOpP= 0 0 ,P  #2 0 $0 30,ЍO01100 00AS2 00 `IV0,03/ 0P0P P V`!V`  H",2 0 $0 30,ЍF   [0S   P   P0P P`K0 0 P 0 % 0IS0,03/P 010!P R`F [ P 0S:V 0  P$ P P'0  0 0  0P  E [2 0 P4 Q0 W (t((2ߖ4(~^00O-`ᨀM⨠@P p ܓY #  j P YЍ@3Y /㒄(Q|"#Rl  h 00> 0Y A 0PT_0G##<0p@- @PO@_P R  R0S0S` 0113/ `0R /o?o"2RPQ P 000pO-0pᨐ`YI0T U 0 S@I * V 0 113/`` 0R /o?o"2RQP P @P @ 0 @ S@-@B@BRCqR ^ NPp@-@PPp Pp0000 0pp@-,@P X `PP@G $`@ (P`P p@-@L(3@0p@-@Pp$0`PS 0 PPp000 0S  0 Q 0  ( 0Qp0( 0(PK0As/$0p@-SP@ <0S$(0!000psW0As/$0p@-SP@ `r0SHk(010S(b(0!00C0pÏ(01/ 0R/(0@-@KP 0Q(0$0A-Sp`P ,U@@Td#@P0S :T0@T(( !@0 0( !0ǎ0$P//p@-@Q 0PSl!$0ST"(0aA0S0I00C0(00@pۍp@-@Qp0P`SL/$0S4(01 R V  pw[G- pPP# (010S F (00 X P@`0S$0S (R@` ꕙ#{_G-P`P@ #0 PA$  P(00S 0S 0 00 (0 0S 00C 0PDA 0 @D0tp 00 0V 0 0 S @ 0kP p p(\ \ 00A\ 3#/0Q 0S//p@-P`@P 0B RpS ps#`0`S P ///// 0/0R / 0R/0 /Q  Q  Q /000@ <0  00@0< 00R://0A-P@TL `p00    ^0pW*0X. `#p@@D X' p@$ `< @ @D < @p@`X20S1"  "0   P*!@ R@0S`0PR U(@0@@D0# W0S01813/TW@R R@- R S@<080/ S00,0 S$0 03/4"S S S0@0 0#040/0 -(0/ކA-P@0 `p,0 S 0 R:0 QP 0R: 0R/// 0A-RA `0pR; 0R7 P s@P1mP) 0R%$ $0R!( (0R, ,0R 00P80 80@ 0@0R < <0R ? 2RAAOoB@ꯅ7@-PLL300000U@0 @SO@Q񏐼?[KJIW54TDCZdON>LK^#1~}|!1 0 0 30 Ѝ0S Co!1 0 0 30 za Ѝ0@P  P P P 00030 Ѝ0@ 0 0 0 30  0 0 0 30  t X0 0 0 30  L ,0 0 0 30  (l(((h(0((((A-@H0( RC ! @$@ pR~`Boob`V6P 0S1  01-  ڹP) 0@@0 S S R 09013100QQ0000PHx0 A`00D(D2O-lMp@$/  ? d T ( 0R amX/0@ >R $0T 0D0fPZ 0 01813/0P 0P TP(0XP,`(`X`PX0S,0`0P0? (0S(00> tU0P08 D 00p,0 0,0P 0X0@,03/p P  P 0X0@,03/P H(00(0P000T0X0 0010@0000=0H0 X T(04  KR>  X4 R 8  P 0X`0F,03/T0( F R0KP000 0 0C,C1`0UT` (P yPX>@P}0S* R<:0 0000, 0S P 00( S 4 ~0  131$000S 0  00T+; 0 d0 30 _ 0@0,03/P : R7 00  %P. X00 0 0B,03/0 t0P    0 8P 0  0S*X0HXS P 0 <0 0 X 0B0CT0B00 S*\g:0eSj X}X  P X0 L0P X L0RBQS$u:XwV0X00(0X 0 B0YQo:03>0 0eSo 0hS|0X I0 BS B10$00>0  FA? S0>02R2 #T  FX`0S*Q:$000S #Ⴂ<0 p00C?o2! \ 000hS XmPv X 0 B0YQ* 00X0 Vf Rb R_0X0sp ( X^PQQN 00zS  0, <0XMPA X 0 B0Y<0X0C<0< 0< Sy BS L0Cs R,S)'&%<#$Q*Q 00X0V 0X = B0S*\: !P\ 00X0V 0X > B0S*\*\ 00X0V  < XP p PR 0  C0K \ P [000X00A00A0S* R: ş C 0B!0 P  Q    R 00 0 $0 1<13/P >0p000=0p0@0S<0p0PS 0S0000 00Q| 00000C X:r 808 42 !q 0S1! T 0 C0S*P: P SR*0RO@ 00$0P 0 SB0  P >V \X*P3 XT A A0S*\: 0P$0 0H403/#႒ zY0\0\ XP =0S X0TC R *\w:@ R \8    zY C0F \0\ XP 0T 0XX00C R*QY:>  \ ` `0`VOP Z 0 0FV0C 0 0 ?00C?000C0Z p [ 0  P `` `0S3:000>0 0=0000008  R tP 00* 00Y  ~  \` 4 \0Pt `4 0Q00C 1   P`lЍ((D~}j|J|(00SLA-`P@pT:1 @0m 0 BR,0(S,10  PA E@D!4P@0@0S 0 (<0@ 0 0@ <  S ,0(S,/ p(01813/0 0060060 060$00 @I2T%: `00@b Va(0  @"S@T 0@ `p\0g'(`0FWtT@0 x 4Ѝ0S0 0S0  0 0S 0 Q` m 1t P 000000 0 `000~  @@ `y0T0Pt 000<0S 0 02#0 B "4"Q #" !  0C  00CS 0P  , 0(0(0,   $ ( , 80 @y <u =q >m ?i? A2Q2#c00Sn 0 0P0q ` Q0  R * 0 S ý03/P:V0p00T 0000M b`0 S | 6000?PS < S:H*e (0WcP R@ R (0 $ 400 00Y <0pV0  1<13/P0 0 00I 1$0 h0P00S t0P(0 t O (008`|    @  8  0 Y   00 B `S@Y ?E pz P30VS 0Y[P@000`w(>m8 *hi|idA-`@PpWP pP00S0(0049 0S01 0(04@-0PP(0S׍A-hph`8@p`TdPU@ _P (0@ 0>RP_(D!p@- M `   X1R0 PH!<1 0 0 30D Y$@ 0>R 090000@0 S, 00SP 0000 0000 000&PP  404<4<40000103/0S00rP Ѝp$((ܴ(D0ep@-@1= S9,Q(00@C30`P Q.:T40"@"b -  52Q 0 00S0`20PPA#)@p``0S0S  Q   Q@ \ 0V*"cG-Ph"@d2 M `p00000匠,0S(0,01= S 5Ż0  "1 0 0 30s Y09, @ <  fP 0003/,Q(0<@ @0 0<000H@ H 㷻 0003/Y: 0 S (0Q  Sȑ je1Sl^0@403/0413/8/, 00<0@0 000 Ѝı(faX(awa}a__O-P*LM 0:,00D001= S (0 0<0@000*|: 0 D0 30 eX0p1813/0P0<  0`,0000 0 0R0 S  00000S000@䈂 H 0T02S 090409080 0S$(0 0<0@0000P0 0P*0  0  0S  0 0CT ࣺ @ 0$00  0Q(``0`F40F3/ R  F$A0     100 `(0 < B$@0@00C00@< 00RL1 0zS@0 ` @ 0@00$0 C 0: H 6 0@0 z 0 J@0 0  (0-R00@0 @ K(060$060(0Yv 0L0CSywvusb@ 0R 4"D @0 @ P 0p Bo1Q ( < ٹ< PR0 j0H0C 00 0@0@ 1 r0 0<0H0@ 0 @ 0 @00C00C @ 0R $*㡹83㘹z<0 00 0C < C4 2/,000S  @|1` %PP 0p0 S 0S S 20S 4Qf0 05S S /S0t0S 00CS|cP0t0<@0 0 RS0 2S0X<0 0 <0@4c 8<00C0C 0 0S 0   0(  (0< @0 00  !"00p0 S p ` `@`1  P 0p0S0 0 <0@4c 8<00C0C0C 00S. ````0 R:  01$e P 0$p0S000C 0 @0< 000 0 B 0l+;@< 00A R0 $0 C@w놠LЍ0(Ԯ(v^]]\[ZZRZYWBWFV0 R/  R\ @- 0@0@@T < 0(\  RS LP 8 4 J< R 0CaUQUU:S#3 O-4M0P0,000p0WX1S`7(0S #<  0 $00A1SPD1 3/@0(%(0@403/(0$ 0<0000@"2 0 ,0 30 .U0S 0P  @P  P5 0 D001 pD0:/0S 0R0;  0 0 0 403/0S(0 0<0000@TP040 3/x1 0&f0Z :YG P[ @ 㢷 0 @ \ A Q00 014 02/ 0 @ \ A Q00 4 2/Z00 0 C 0 S3[ 4Ѝ (TRRR(y4YRbR00S// 0C<0C0@ 0C 0/PO-Y A  Pp0`@,03/P XP01Ƒ @X:0 !803/PX*0803/p0@PW0=G@@X:S0,03/ S0,03/00 @@X: S0,03/ S0,03/ @X:0803/PX:P@@X:0,03/PX:P@H8SP @@@O-|>0 AR /G-`#M 3@ dp0\ 000X0RF4 R X04P U "2 0 0 30 BOT 8 4  X  PP80PR2*0` 0ES: ` 0z 00v0Sp0  P< R X0T @ <  `  P0` 0ER yp0` 0ER n`0  V0 Pr0  I`0  C00` 0ES`: J` E0TЍ褊(H(p@-P`%D"@0D0SpP8,0pp@-0P `@@PpP 0P0 p @-So'Rp@-P@'`B@P=@Pd@ pP@T@`P Q P P@TO-`PU0<0pd@T=0X8U0Ӽ0څP- (20P0dPUG YB0WdPd@ UT 0 NP@0@0<0<0 0 0P@PE  U0 Ѝ@0ST 0  0S  )P h00W0 P P@@ RU   ( R%  P  F  W  P , DR( P \  R @ P  P0Ha80B\ /0 @-,0 3/0B\0 0/ /0B\ /0 @-80 3/O-M`p S :S/ ` 0SnS!  S GS0 00 040P40S<P @0 40P <P @040P @@0@0 0` 8pTЍ@q(-'p(&#&%c#/? O-|M00t00$0(0S@0S /? 0 t0 30 G,0S0$0%p 040S LPUL@  0 (    PS 0 R0๩Q@@ 0`P`400``0 p `@`FV*` l@0P`X @ p`0FS~ ` V0 V0000T o0#VP X 8V0000 < J0@0e`0 DR`@ ` 00ŀ0#€0CL0D|`0p I0T l< X6:$ePP (0Vp``000000 00 0* pPkP4 0 H0 B0 < 0P1<0;  000P p;  000P D000{0H0 0s0T0`0T40 S 0LPX7 @Pm :p`00[u 00    ` i X ~R | Yp: 0`W0 0Ql:@ 80<@P S* \0 P : p@0@0\`Yy00 \0 0P`@T*80\090 0\@Yf 00P \P(00C(0s ^P;@T00  0S0 #0,0400 `$0`r Y hg0 b_p0SS 0CS &,JS @㚨?0 0,00400$000P0 0  V0!V 1P%   ;`$@0 @0 P0  P0@ |Ps0 ,`0TH0p SI00yS 3 8R0 a&2b&2c0 s003璓iL0y$0 0$0,0 0400$000] P 0,S0!00S010`0I `0 8S0`&0 3`p0 $00$00  90 400S T D083 R 0 a&2b&2csz w`M0 q@00@0<0@ 0R:f0iX*S *0Q 0p|PP4D@ X $㏧  0R.RF?R0Q7 @`P  0 D <0L0 80L0h0D`S  =0S0Ds 0C!R  a`` 0V$:0SG @Tp 7P 01: R4R0P  0  ( P P 001 00`0\00 0\P `P@b0DS.S  S RDP  S4S@@P@ P#PQ PUl PQ @Td@```` 0 R:0S(00(00S0`UV  0$ PG0 `p 0`0\00 0\P5 Ux `0;Sr Si SO Sh000001S8 :Sh@ XS* GS, US&$ Z0l(k(!!!!x!\!!X40>(?xO nS)  S& YSh00h@0 0 0000 0 }P 0SdcP h0 0nP 00dVP h0 0d0h`0S00h00T `0;SG &S9 :S= Sd0S@!23 h P{ 0Sx 0(0`0Rq0CSB.0?4=<;4?S GSahl0 Pp\ W vW SQ. pdPh00Jh@REh00Bh0l 0(P= :00803/00,000 03/"  ⿥0S000SP $0S00$0S$0$0|ЍO-M`P0$@P 0pD` P,PPU5@Ѝ0 $RR    R  X : X* Q 00P UJ Z* PY`VU 0 0p008 0( R`V Q X $@TW@@00P P0$p`O-` PP Lp00W H0SL #P 0D 0@ 0` SV 0U:0U* pW0pSpW  P00(@,$ Q9 0C RP hߤ2  0zS 0W*HH20U 00 U:U "10!S WR 0 ST0  ^ ! \ 10P  2U:$0 U:U * @R P:YP[ 0S@O@`U:00Ug:0^\pG10SW 1e 0RSf  Uc: @! U]* RZ RW  04Q000@ Ѝ@ O@1U:   U:  (#0O-H R БS̡`@L@ TH000P̰S pP00 Ѝh0S  D XD RPDPU$DW PX#PPUP"P0S/PW0h0 @0   Q   p0P0PP(0S0S Q  Pp 0p@-,M d1p0PWT!@0$000 0< 4@ @D   ! t`PU H@ pT$ DPU @ 0 0S  tP 0S ( R 0P 0 0(@0@DiP 40 0 $0 30 @P,ЍQ(P(dhĻO(@-^ \ P@@   G-PUPP P @D`V(L0S wL0tP,p$n4ljh fX0S a_0S jXPGe@@0DpPS L S I@0FHDHWX ` ; 8p3O-,MdpPX$`T4P @0 TT0$00 0S0lP d0`  jl`pPz3# 0 !}TPX  sPP @UP lPUu@SPP P9 NPU1 (09(0oPKϽ&@Q<   \0 SP0S [` x"X2 0 $0 30 ?,ЍOV@P,"2 0 $0 30,Ѝ1P l d0S\x@Q<   0 P  P x00P[ P0 0)(0  00  0 ZP 0 0 00P(0S 01R*   YָP    P` (Y  0 P 0 0 pM(|M(dlضK(4K(O-Mp@0`Q!0D0 010000 !1 0 0 30e >0P0S08BT80P@8 0W0S 0X: 0X *P 0S0 00S0 00Pȱ P0FP Pp00`0V 0  UP1 3/ P 0X: S P `Z  UU `P3ЍH(H(O-LMpx00|0x000h7t00D000Q00000@ Q0(0@B0000'0P 0 @&6 0 D0 30 ;>PXi p0p0p p`@0S<  0 0`` 0S 00 0S 0S0cS  0PS00z P000Sq@Tl0 0 00v 0 ᵵP0 PNS 0  z@0 000$0 Pt 0S 0 0S P@0SWw0S   C p`0 P P p P    0Sp` wp`0 0rp`o 0$ \\$$Q  V :V* AS Q* 0 R ?P  R 0 V&$ QQ! $ 0 00S 0`V 0S 0 000S V 0S0[dd{ 0 0S 7P@TS0 0 0LP @ 0H4080<0@00 080$040 @(0@0,0Z00S4 0S  @P ,0( 0<00$0@P 0S:40S080S000S @0S 0<0 @S 0@0  0 0P 0S P 0  000$0UZX 0 } WP000  S00p00$P00S@V 0S@ 0R 0< 0P  0( S00 000(0B0P ARMڃ!0 H@NLЍF(,F(k 00 0/`' 0 s@-`x@0 P000@0S^4 (0 0 0 30 ^<Ѝp?(p>(0/0$@-@"ᐞ(00 00 0/h'000/ &*@- ߞ0@-@TY՞kO@-̞G@-Ğ'A@-༞:@-ഞ3@-ଞ&@-ञ@-@-@GP@p@-P@`d0P U`( 0 ( pp000 H$*-@-| |0 x0@00000yVIx ヂ@ 40 0 0 30 ; Ѝ@ Ѝ/$<(;(O-Pt`0lh帀p  V Ѝ@P 4 0A P Q !   m  RR  R   p` p  R R`   RL  .@  /40(h;(DL("* (((00/!*!1 @-tM0P@0l000`0S -  000S& #P.@0S pq*P Q* w*P#0S3P 0 0 l0 30 :V  h"P %# !# 00000tЍ9(8(G-`L"@H2XM pP00T00(200S P CUpPT@  !1 0 T0 30f :U DP@ݟ<PP   %PL10 E P 4qTpP$ 0P L@ , ,!P@ 0  4  8  <  @ ! D  H 3/P.0 0.000S @@ `P 00S 3/ U%0S .0@0.0XЍ8(*7(**pl"O-M 2 @0T000 "2 0 0 30 :0ЍO/.0PP 0 5P0"$2 0 0 30Ѝ0S 100SL聟@@0010 01001 0 A`P+ :!P%(0: S!!SR x0|    Q S00  pP 0ا00000 P0S0 0 00S0000`V 0 P`0 ¦ P(0: S0 .00S8@@u*5(\5(4(d('x!h**4(p*00/*00P/*(00 0S @-3/P/d*00Co/(00 /* 0R  \/ 0S 0S/\:///A-`PP \p@p@T*LP 1P 1Rܔ'ŅG-`0P,03/0p,03/0@@,0 @3/ TW@@@  /P@PP<p@-P`@@=0P0 X13/!T T T  C SR` 㗛p S  D TR(  S Tpo"2 G- M0`000~pPPk (XPg  aP4  X10 PP+ @ PM ')+-/13579;=LA@P;   ɼP/ Pc(@@@@@@@@@@@@@@@@@@@@@@@@@@9p ,0 0 0 30 8 Ѝ/(KF@;50*% Z-( 0 @-M0P0 00P@ (@T  ʼP @ 0 0 0 30 7 T0 P TP@`PA~@T:"PQDЍD-(,('0P! $R- aRdP fB| \H^̠ a BRQ .QQ/~@-P0 0p@-P@ yop2p@-S@0S41Pᣮ-0 3-0pp@-@PQ 0PS $0,2GF!  0R  pp@; 000 >0p000000p000000 00 0p 00 0000 0R0P000p0 p4000R $ϙp*("D"p@-P0@| S xS0|00ϰPpx'UQ0|0pA-pW00P0`09 S' S @T 013/@P 000 0j 0 0 0P < 8  ⑙0  ᎮPpPp@-@PPp @PpP 0 CpPp@-@P$Pp P00 0pA-p2@P`S0S PA0 0 0(0P00$0-0@0-0QP @-:0P00S 00CS/O-(P0`4PpH 00S 0S@@0 P  `P@ Ѝ000 @A0_S|P (@ 0 P ӯ`P  00  ЍOmA-P@` 0 R R@|bP (0p ᶭP 0Sp000 0gPXЍ0A-@p`00 0S 0QU` 0S7/P000P0p@-S@P (f 0SP0 PSPp~  0R/-0 R  ^ S 0C 0p@-P,F@P ( $0 PP@p\x0S0p@-@13/PPpPUxPPPU0 13/P|p/O-Mā0@ `0PPPЍ0xp|01 0|100 0W*@00  0  000 P  R   Q6[@ 000 P05/P 0p13/P gP  ;P#TQ l0 000  Q 5x"(DO-0MT` p P<@(0S* @0圠S {< 0R s( 0R k00SP0S LY  0 ㄗ Ѝ@0S$  (0!&R\ , S!1 M?oY20Sx0 0000C?o200pPT  P x0| 0! !S0(0 0 1 0Q 0/S6Q0S 0SH!  P  0 P0   S -0! tpWW<[ Xܖ<ٕ(0 000ሸP (pL 00  zP (uDvV"!$0#0! 0>@0 0<0/(D/O-DM 30 # 00<00-0ӱ ᣊP "2 0 <0 30 3㯖0P `ᱭPP 0;00 0 p2(00E00$000000 0@2040(0S 0S 0 S3;0S SR0 & 0 Qd 000 @Pd0S 0 4 P 0 00@P 0Q S0p00 0 , R S 0 ᐉ0P$0. ,P* 0 0$,0;00 002 0 R7 PP5 0L ` 0S j60  0:/ 0S 0S P0೓KS0 0p 0`S0 0 0@0L  W" `06/Q ( 00 0 ) R R P0 V  0R    00S S S00S   0 s0  099S0S0(00 , W/ i| (D*O-P0M0S D"%@ _/ ⳑL0pS"' _/ n`PЍ0 00 P㯑0 0S0 0000 Z0P  R 0 0@ @$P05/ 000P= Jᐨ?oZ@20S 0  P P d _/ 00Q   000;/P -P ! ޲X $Pa0P0HzJ@-@íP000SG-\ \ p!l g/\`ЍP0 $ `V` p@W  0R",0Q3/@P`V ӧ@P 0W0 p `00 p q0`T `F W0V   `z"2 O-,M0@d `0$000x0|00R"8pPW*t `A P$ 0dP0S0p U'dPU pWdP0S  Q00 P !1 0 $0 30] -p0娐P0YPQ LP 0P00P0 CRP00%S$p圠 0P 0) 0 oSPx0 pZP0 S n P0 0P00S 0C S0 GP p0 0X,Ѝ(L(0S/ 0 BR/ ಥ)0 ߤ)p@-@,PoPp 0P0 p)*0 1L)%8)@-`<"@M P(2$rP0p0 00@ P P3 ! m/⡏P0(08( (R9 0 ,0 0.  0(0@t10>@000\!@1 0 0 30F ,0 0,03/0 ( ( (0R 0 ,0R  0gP 0 ,03/嘾喾 UP 0p,0( XP 0 D,0Ѝ((.D (po0 p@-@P1 Q  p@N/P0,03/p/ሩp@-@4a0`S  \h\\ PdPS40p0P Uh^^Sp@T,   "pp  "p  " Qpp'D 0p@-0CSP0S @Q     R h Q <0@@ 0@ 0@D@p0 \A-PR@ 0S g0`pX@ ^H 0d0 \*T(0D 0C0@dR0D5 00 p(00<00肽6/0@-@00 P 00  BR@0 Ѝ1O-M0P 0@1 0`P0T& 0S p 80 3/pP0S5 p+0` 00PP`000000 0* V 0 0C?o20Ѝ0tP80 3/pP@P`Y X  00U`j@J@@-X X0 0 000004 ,0 0 0 30 * Ѝ4''01//0 0000RS00R00S R@-(㭍/8^/1H.-D+B//'&%; 0 @ S@-@B@BRCqR ^ N@-0  0C0P0B0Q@C@CSA|SP @Pp@-@P բPp Pp00000pG-p,@(`T = V0 +0(0#1#A RH@$A$ ` 3Cc QU&Z  ᩡPP `P  ( ""S RH@ 080#A#R0S 0S P0 S*Z  PPp@-P0@Pp0Sp000 0PS $0$pO-@"p2M `00 00㘋(0@`"^\ ( R @"02 0 0 30 ) 0S <,b D RS* C S@PU  6PP 000P倰V`P ` X;1 à0P0ᠻ00 R    SD\@@ P P $(,`0(0P 0S   0 0P(0,0  PPsЍ'p'PO-M@0x5 00T  R@P[M R ,P , עpP ` 0 RFAQ   [(Q ^ Aa  R ( RU  0EPe(0P(P0S  R0 ) p  0 S  3/(D`q 0I0XU P m D( Q2E PA 0 @ " B\ P"  R X !Z X 00R 0A 0 vP0 S'Ѝ\ RZ  0 A 0 XP 0 OP `X 0Q (QL  S00 %s, ( S,p10 `F90( 0 0 0V:0 Q : 0CA00R0#S0P 0000Q \   A  \P( @`  R (q"d`TO-`RMЍ0Sp @0P q|00@3#=T0S !W  yX< \0 0@Pp <`0 000W0@0D0 სPP T1000 R 0 h0C Z*;9T(  +` T 0' 0  0`pW0(ppW Z*VT   n D[ d}0 ;0S 3Wm'߯G-`Rp@ ,0S * 0u@T(@ P,0S3S) Q0D0S: 0CR0  P6 0, R  1 ȉ30CaS#S: ^ R 0 R | 1 P` \ 1 3! 0A0P0@ PE@0c9˭@-@TӸ@ 0 R/080/0,000S F @-a/U00S/0@0/04000Sꌠ m @-9/HA-@p`P0  0pg , 0  A00S, (  @-  0/Ḟ)Q( AS0C@-àAa0L2 < P 3\$   0 /Yp@-P,00S ,@T(@UPppO-M ` p P20" 0R 0@ 00V@>@ @DOoRB@T 0< 00@T D0 0@0004/P ЍV w   0Pj @0   S@@ 00@ T @<0@00S  T  @  @0< 00@D0@D@0S <00 4 00 RP P @D00@P Y ᴀ؆)0%S ؁@0 #1 4C0?03 'Dߨ٨O-M pXP0W0 @@ 42 0`>R<000` `V D0000B 6/P` Ѝ І  0P` 0@<   @@ @@Q  ᲆ `<0 @  @ @D  Q@D0@ 00 R3 .P,  (P&  @D!P00P` `8)0a %S@s`0 #1J 4C0?03=@('DgaTO-0Pp` `b ?)0L 0O1@0CC000 P 0@  ) . ^<Ƞ12)$ ^$ ^+@ @T@@0,0L ! , @6i 0  !0 ! Ѝ0   @@ ^ C h٣O-p(,@`0P   0P 0  <B@  L B 0ЍOoЍG-@ P`p0P @ F @ PPPP0 ]螴0P1/0T1/W2Q /@-U PD'P*00//D'@-@00S0,03/00=/Q @-/8/O-R3 @P1=F0  000 :/00S )ࠅ 0 0  0:/u0   @p000 :/c0 ,P00k0 d ,P00b0 , 0<Ѝ''('ϡB'ڠDȞ؞$/0,@-  y֞$Pp@-@PPp P0 0pO-lM@0T'$0P7 0D0D7 0P0d000\0`0(0S0@0( R 11cS00 0D 60@ >R @ R 0` 0S 040! P 0 & 0 l0P40 TP& 0P \<`:0( 0380⭠P (0,000801 00}\ ߦP ` ٦0P@0 $0\pS0$00(00<000(0X50L0<0W8:\P`\P 80`P0C S(0090090 0 @0(Si 0^0P0 0  P 0SZs$h4 0 d0 30 !000SP0U,03/0$0S40S 0 0000(00 p000(00400,03/(0(0S \0 0Gă\N`00 H00H Z0U 0,0  0 <R4:0H X LZ 0HP0 P& [dܟP \0[0G0000 00000`㘙PP 0  0 0 PQ Q QS 0C Q0 S`P,T0P 1/(0P%Q Z :P0 T 0P0 T P0(Q |DPPEP0 S0 S ŹP 0 00 0,<Q8*,Q S00000,0C, ,Q0 oQP  q   @lЍ ''D"! 'O-$MŸP0H0 0(`2"0V 000P 0QP <`P~ 0`@0(0Vx #X\0 0壉P PЍpcPP c'DBQ0/, R(0@/\/ 03 !r1@/ 0R:0@/// Q 0 1//,0 P @-܁x| /0p@-S @M 0P  0+ S! l w0 0 C  W` ` Ii d D F fO < `8ЍpSg u  @-@P@O-Pa`l 0Si @  cC! S 0R vwSM PL VWFF .Sa$ qp [   ^P OP ?P t  rgd00p sb NBOBT?nUIiu?'DdT'tv0@UPS/p@-@P|pP00  00000pG-Q`0p113/P@ ˗PP 0Y1 13/P@P00P@ـ /O-- (2 5?0W 0pGV`0$0S0 $0r %$32cR =00Q?00S=0( `F%RR00(0S=0SR: 3 0  0?/=?P0`0wW 0pGV`VPu0S=0 <0$0SU$   0  R(( `6?0PVA$0SP0  0  (P( `7?0PV3$0Su  %$ 0  0  R( `8?0P0+( V$ DPRP< 00 R (P `Ws 0pGV`Wl 0pGV`We  pGV`$0S 9?00 ) D0W1!Z $ R P  A \  By0  0   D0 pG 0CD0D0S.0D0:?00; W% H$ 0R0 P D0S 2D 5 5 70S W0  0  o 0 pG Sb 0 0,0pS?00S 0 00p 0tp0P00X0?0X00p00P0 30C0l08000l0F?0&P5S`F0l0l Q5*X0P 0SW' 0pGV`P PCP45S4c8<Q0`#W pGV`P`FQ5S100Q?00Q S ?0S11000`F%Q Q10W pGV`W pGV`P5S4c8< S00ll0@pS>0p0tP0 0X0p0X$0%0P0$000p dT  \ / \  h 0P0 X00ꌵ' plllklqfԫ'fmd@dMcdbza`aai`9`;^\U\{Z8ZG?00Sx H?01W[00 0  0p? R R  P R?0  0S 00@-@2P0  $0@!@1 A-@0000pPp20PS@0Sp* S?R 0 @0 < 0 S%<@00l0l00C00`l0`Sp'`??0H @0 0 0 30  0CЍL'L'@-P0A/Q@oA-?o2P0SD`@ 0+(3/PP 8pW ( 0(3/pP$0(3/08 T+$P 45R0 :o R B P T  B T p W B0p0 (0 8#8pP@-oP 0:+@-@dP Q 000 0@-VP C\;D8 L\ D @@->P pS>0@@O-MD@ 00P040000 D  PP0d0PsUP 0- 0   00@$84 0 0 30 00SCpP0S+P`ᲀPxJ`VU @P@\@T@`Fd@P`VⲀPP@PDU\ \1 X# |@ @ `V0@T p@rTpᴒDPP  ^P !^! L1/oK", T  R ! "  >  L/o" %T  RD0( D<Cpq$Qc:^d:NppC486App$pp8pp4pWCDQA`VN~F^S; 0000 S'0(`^" `R C<`|Ⴠ`V*``GVL,`T``V `%T``V `JqFa(```pQ 1@ !$  100Ѝl'̘'[Z/;/0` 00/\'࣢ԣG-P p0@M 0` 0<0000$0(0,080 `@P@P@0S0S/opp" PP 00U@8 ,0 0 <0 30 @Ѝ'T'@- Ѝ 0 6 7 /O-pTP1DM `0<V0<0000 8 0`$08(0@P, @0 S``0S(PP 0 0C8 0C0X000S0u0S` U U@ u@0v@@8 ,0 0 <0 30 DЍԒ'W'@-00 Ѝ@-@ pM$P  Ѝ,`V$Pա(P  H80 0 0d`00L0`00` }Pd ($8  , 0P0t0(0p00D0A-S@`& ,PU?dpt0S V AoVP p R2t0S0t0(0p00t p.  pPdR!#Pɱ Ph00Ch0d00d0h RP BR!P000t0SV TA-ph0@`S0 pPV PS $ 㸫$0 d00hP0 0 up PV0p`A-PR% 0@pS X0S 0X0%p  h0U:S50 0 dphP0 Kp ph $0`Rd0d0@`FV`!p ᦴh0 0h000 X0 #pp0P @-@T\0SR  @/Qp@-S 9 R\PU Q@  3 S ,   R v2pQ7@-@P!1 0000  0 0 0 301  9R\0SX PR P P JP X0%ph0$Sdd BPPh0 0h000 0 u Ѝ0輋''p@-PP  9R\0S `ܰ @/o"P RppA-@PM p9 RH\0SE0PS%p\PX0S 0X0%p h0S$ d  d``00C0bPP pW`VQh`0 0`/Wh`0 hp7p $`F ᢳ$0h`d0PP-` `0 @-0 000 8 00 0 0 30 Ѝ Ѝ/؈''p@-@P  9R\0SQP X R X0%Xp\ppA-@P- `9 R(\PU%H0pSL0S X0S 0X0%4p\P0S h0S p  d HpL`Pp@-@P.  9R*X0SP0p\PS ,0Sd (x$v gp~pPjp0X0%p\PPp@-@S!P0/u? t$HQ%H@D2l/ @0 AP A@( S/000pQ>p000 Ѝ((`Q 0S0(0R V aP Ӏ bQ00S0"S'0S0ES IS3 [Sh gS 0St0SV  2R R0@S2000S*S+00SAyʄ0SvS0S00l0S0 1a l0S  0q00R0S09S 0 00 t0  R600 0 0 0 0 0 S0 S00R01 00 q000SY ?0,0\0S00 1\0$ \ R1 200 00 0#400 00 00 S0 S00R01 00 00 R 0 0 0#400,0S  0800 0E00 0S H    R    , Q R B 000 0I0000S0 0 R,QR B00S0S    R  , R  R B000 0[000$0S. 0 R,QR B000S] $   R  , R  R B00g000,0S 0 0S0S300  00#40 0q000S<  0I0 B , Q R B 0h0 0 I0 0[ J /0SPt0S(tQV8 l0`0&᱐01) )t 6 Bt 0Cl Q l \0 BP8] l0\000S6S \ 0lR8 @G l0\0i0PS400t0 SDt0`0Q_` :R㤦 B㾰r ƃ  !  ! &6` B0Bt ?o Bt l 2 l ` S \ 0lR8 @l0\000Sjt QVc Q:V\ 0lR8 @l0\000Sll R 8B0^^^ 0 \&\ 00B0IS`0`\0\0\0\0\0LoR \08l  㾰ƃ !&6 B0Bt ?o Bt l 2 l s1 02#03/ PVJ20S V0SpӺ0SS0  00#400 03 0  0#400 0  M0pSo0c0ŧr|V 0 VL D1B B0 ht0Sl0*\06!c'A?<&A-p`P `@qPPPW U1  02"P 5#0S Rp:6S p 0S`R6S SL D B 06L0 P0 00000|0LD00 C&@&p@-@0PPP$0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/$0(3/qV00PpO-`40pt080 0S< 08Q1S00PP Ѝ0 0S(0 $0S20$0wpV`fV`F0IS0FSR0S WFXo᪢Z @V(& `4/@PE @*   0 A4  P "L  BT 0`2,X  (P3/8 `,(6/@ `L(6/Dj 0(3/6! 8 R @ R D PR 20d0000B 0 0&00p$0 ЍODrR'ܽ@-  0 0QЍG-PRPUPe08 Q 0&(3/@P, @&? 0 ,(P3/8 0,(3/@ 0L(3/D 0(3/`8P @0S DpVWpp, 8 , @ @ L D D 0 0C0060 0`f&;&=0$;> 00; O-0CN 0$@  T 0["2 0 D0 30 q`V`LP  h [P$ !!`@P\  & B&VPd aS  Yැⷐ娦 Y L ׶ *娦P `  Y^<P>` `PCpzW pG BpRpppL^ PSv `~V0CL@!\q!\ v C|'v0`F0 R H02QA R00000000PLЍp=';':&@-Q@@ "$  &Qڲ :@-&R&@@!@@ R&@@!& B& &+< :$ +, ( 08+ &]&A-P*`@s0 P|pp!` @S1s6| 00u00 0U 0 000S40 0ў000y*0@-6 S0q0@PP0#4@@06c 0C^q S600@@0@#4@06 0C0@6CO-P0`@pS O,0S$0 \X 0S;SS;SP,RME0SI  R,0+(+&@40M>0  ! RL\*00 & !^!0S00W0S 0 sU  ЍO00pf^W6& Sr #0r 0p0#406c 0CR r  6N.V - Sr 0p0pp0#4``06c 0CR r+ S6(kB~0pp60p#406c 0C^p6v S0pp60p#406c 0C^p6L S|0p3ps0000#4pp06c 0C\| p60 0M>0伖 Y p   编i I\| ^἖p&> ; S Ѝht:Q@-ƓF@F !& BBoƓDAQƃ<  !Ì!ܕ"܅  0P  O  RRPQQ3 //0P  O RRX R0%//@-Q7@-@P Ѝ00O\)SS0 00qp 0Sh0P@-QP/ O<RD/P/0O) SS Q\00\0s `P////!Z@-@``PP \0s 0`0Vv\`00vU pl`i⹈`P0`\0 ^@[,0, 000 P Ѝ"O-P@ Ѝ`Pᔈ@P :p 00 H0O p0`ppLp,pPUZ6ᬉ0Eq [HhU`URU& +U FULaPEUTU,0wU xUp rU0L0LLO<Z,0S0,0 7P 0! 0 I YO< R0 W 0A0R,+0V!``vF0S0 0090 O<PR P@PDP0PXP"hP ZO,S0 00qp B% Bpp@-PpP`ׇ@P , 0  ,P,P/ 9ORR00/R @0D0s@-@PЍp`O<V\PUuPPP#gqp 0PS@PDP0PPXP hP @-@P` 0 ЍPO  RR\QqSS+0 0UP`O<pRXpU00 Q$P  U0!qp p @pDpXpz0 hpX0S P0T0`PV0`PVp  O<R U000 B      0U P` 0 0X00PPT`V@-?  ~Q Ѝ-X0@-000H00S v$0 0 30  ЍЍ/^`0/`G-p\`@XP@ P 0@PT00`8VVO-Ml2phb000@ 0S xWP 4 00 p0XPPy PQn 51l!pkP@+ pBS !01l0}kPpG n  p@& 06 0 0 306 [PW  p0S K  p0S =0 W Y0S t1P; V@P P Ѝ^`V;VKViVnV{VQVVV@VmV VVVp@-P8@$0S$ VP  $0p`ќV0 $ /`P )@- 0/PVlVVP =@- 01 /PVlVV0p@-S@ S SpX UT PU P Ap p00p Ppp@ꎝVlV0S S S /0 @o/o/ i@- 뎝VlV@-@00A-P@`T T1 TOpW W @ |ppp0@DDBT  @D0AATA":ᬊ"0\  '0S S@0@ pX  ( $ P  p@@ 00 / XIVlVO-0HC2~s^AS@!@3@`$*TP >3T@!P  YN \ LW  Ap RP>C  OGA-`RP@0U0P3U:p ༘0p0P0P@-@PP 0000@@/0   /- O-HMx3plPppl0D00p000S g $3 D0 30 R dS l0Cs RR SOꐏ777t777777<777X70@  T< ` 0 0 0 0 $`$@ E By * @% ox0 0 020 0 010 0 010`oS% dS lS' P PuS xS0 0 010 0 0p1 $n0 0 0 00 0 0 00`uS% dS oS000  0xS000  0000  0 $6~000  l0 ō% C/o" ⾍3pHЍO Ѝ/^)HV$ U-P˺TT@ HYUVLOO.U7@-P@D 0P! @0 0W 00 Ѝ0P_tV$EGWV Vp@-@P@`@Tp0 003/0S 3/P_V-H0@-000$0 0 30  ЍЍ/^7@-PX0^@ @ 08( Ѝ0@ 0+`!gYV[OV -H0@- 00000$0 0 30  ЍЍ/^0@-0 R"갓7ԓ777Pp Ml4P P   P  Pz  }`+YVJuJ@-j0@.ḍ @`0@-s@o r    0 00 ssn r    T08 04D0@ @<08 04401V$EG VԞV<7VVJV$7D  #RPS `U_A-wPP`@ 03S S SnP ( 0(3d7/0#R00P03`VPق  ` G4`  ˆ0080 000S 00 K00 4K,0 ,0K-H @ L @`V hP5P0*V00S0<0  f@PQ: VP< 0.S0 P0PS/ 0*S,<0@0<0 0D0 0LS.CSD0CS񟗇7X7X7X77<7X7X77+V V0H0  L0#V0L0 P@00V0@0 < e@PQ PlS zS I hSW0@`P (0lS 0@`P xQWQBEQy vQ *Q @0`P 0@`P 0@`P 0DS 0@`P@0`@0`P 06S04S@ 0XA X񟗿H7t7t7t7t7t7t7t7t7t7t7X7P7H7H7H7t7P7t7t7t7t7@7H77t7t77t77t7t7H7L H  SP\P \PPPU NGQ^ PV PU P P80@D`40 0ESn8H ᥅80 ใ80 p` 0Wb 80(<0 p0pPpXT~*pG4`  ᆅ,0K0 0 K, 4K o H0\@P 0P\ 0 D0R D0H0 @  00L0 P0S 0FS [0Cs0SP13 @PH0\@P 0P\  8 7  :0D0 0G@ H0 0G8 <0P0 kD gXP A^@0 咓#P0y 0 (0 30  K^ V@VcVڤVVQFVyVVOG 0CHC1@LP*@-LQ10* S1 !/ /᫪ p@-P@"IPH  apBVAIG/0@-M2P 0000~S eX2 0 30 4\480C!R@ 0 CR$ R R@  /R@/P /P@T0 L0L/P@ /\@  B /R @ /R @l0d0d# uL@0 P P80S 1f!00)0 |d|Y0 Q   Q 00 00||d|L|4|w||yd|L|4| _Ѝ0^XVyVV$EGȥVV@- M\0@000Kdw|,0 0 30 |^ Ѝ^0s@-@000P0B`0S \|00 |0 00 0 30 Ѝp^0G-`P000}@PpD@*p8 B Q nT$0 0 30 PЍ^0@-@000ᙇ^: 0@-@000ኇ^(0P/@-ɧ@ǧ@h`0 /h`0p@-@PQU  R |0 0 000p P P 0@-@K@-DM<2p P0<000000@0! 0 R& R [Q ]p`${{^:P0QS :<p`2`:00[S ]p 4 0000S :Sp p R #2|0FQ v0CS 1 #$|W  0 ⃃ _ \{0 $y$U$R{ R 00@0=~ 0 <0 30 DЍ^VQV'VGKwVO-,MD1p@a@P0$00 0 PX `0 0`P  z0 0  q{0 0 / >P ف@Y00 0 z,0 $0 30 ? z\],Ѝ^VP7@-@!@3 qPP$Q J] ^@]     P P Pr 804 0000, , ( a ^ Ѝ01V$EG VԞV(VV7P3pP3p0p@-P0E[@T( `0S0 C  [?CP[S003/0S0 C  [?CP[S0 03/p(V&_@-@[0 @-\  @\@ 00 00p@-@P7P pu@-@Q00 00 0S0 00K~SP|0 0 30 }/S l0`Vt0@ P8/\LЍp^V$EGkV4Vw`!gY*)Sp@-`P @j]P 0T ` V/R 0/S@0 p/Rp 0R0@P//P/@- 0P詧V mQp@-PPUdOI0@0`000 0P0PPQ0zp FGAJK-M0`P0 0 0bUtt0 0 30( @ 0 0@Mp 0ᣑ$Kq:$Pg0P/S L80 L$KF$KC[K^*)S0@-@000P 0S   P 0S h H0 0 30 00000 [Ѝ^VV=HŧV0@-@000fP 0S m XP 0S h_ H0 0 30 ^00000 u[Ѝ^ӧVV=HVT0@-@L000*P 0 0 0 30 8Ѝ^ViV@-lMx1@P0d00\vPF 0`.S<040P0p  V  R G0S 4x04<04 y04 480Y}4xx[ LL 4`Lx4x)xxD0 d0 30 00LxlЍ^!gY^EG*)Sp@-PQ1M0001S!010S1M!01@`}0S P Mx<1 0 30G 8P- 0S*  DaD|\ tWt \,_t)x\'xD%x,P,x,x00000t x\ xDxxyZЍp^^K$EGVkV3V=H*)S$02  R 02 /l`p`O-pL1,MH`0$00@PP05#P00   R000#03pU00S0U ? U  20 00 $0 30  2 00 X 2 00  , ,Ѝ ʚ;^ʚ;AVIVVV@-0  Ѝ!gY0Q@-  r0 Ѝ!gYiJR7@-P R uL 0P2@ Ѝ0k( @02d @u0hVY>U!SR7@-P R VQ@L 02n< 0P2h Ѝ0E@B @u0@ HsV˺Tp@-P8@  02Np)HA-@P(1` }P@/TD @(pFP4pG|F 0wF||VVk;UG- RŸ MP`@DpC R/ Ro@ ! ^  # 3#( Q  *R Q?@ QF R2@!@!`00W0S@Y W@@0 0 30 Ѝ /S  0R 0 30 @ p0 ЍG 0 30@ l0 2  P  2   , $  ^ҨV֨ViJ!gYݨVVKVp@-`Pw(@| wpk;Up@-`Pf(@{ |wpk;U@-V@  02k)H P0W/ 000/oV0Q" 0 @0@/oV@- 0a@CTW0C A@CT70C00C S ",./ ƒ0A-P0000@pwPWUP 0US bUv`qwPuaXT07@-@P000|  0 0 30 - Ѝ0^p@-0`P@@PR00p EE0A-`00@0P0-w ppwjpwp0GUuXO-(`@}pT$0@*\}\#L\YPX\PU@PP*\}\#L[Yp ,p@-P @ T\pHP8a\ .@}^@VV@-@Z? 0@-TMp0@P0L00T0 H1 Ϡ!0 0 L0 30 uTЍ0^@BA-+4`@p_pP  06HV@- @PPҸ` `0QɸtP0  Pp @嶸p dPPWMЍp=QnPVTO-DM(p0x 0|0]h@?P 00lp0X2T0<000P1U48D` `0 8040,0(00P`0`1/P 000[ 0 T0*@ @ ^ @0[t1 <0 30U T0 1 0tP @@0 T0@1p1:MTp 0 T0:-E 0000Z0 00PR 0a 00i0!VR $ F~$ T=x 0 3!(31/=00P0 @DЍ^ FGVV$EGVV00!P]77T77\77d7D7l777t7777|7777 7777747<7$7,77D77777//// ///// /// // / ///////////////-0@S @MP  N0@?S@ 0@ S//P@-,0=( 0$$0 00 ЍV$EGV̪VVP 00#/VZVP 0 0#0P//VJrUp@-`8P@Q uP @ PT@pVPY<7<77D7D7L77\7$7T7|7,77l7t747777777777777777d7/// ///// / / / ///// ///////////// 0@ S!0@S / P @@?P ,@-///M/N/iV<0@- 000 0 0 30 = Ѝ^`0 @- 000@TG,0 0 30 "Ѝ^V G-`Wp Pp㨀@㤐P p90S t倶V 0Spz0  p,@ATW0Gꐙ`V`!_VV:Vp@-@\`P d!bp 0S 0Q@AT  Wpp `V`V0A-P0@3/bVaW 0 0A/003/003/p@-P@@2 @D03/PUp蜽`@-LV@-0@ \ 0S 0s 00D Ѝ䜽`&VT VVP/$0?S0P/( S @-SAA$/8q0P/ss@- A@"0s@-PQ00000 @x`P q00 Or0 0$0 0 30 3 AЍp^^EG0s@-000000P`  U  R p@0S@ q00 r0 00 0 30 Ѝp^^EGA-@`PpTEP0 R    R 0$P( $@pD0000 0qA-`,p(@WP X@PpxP @xP P&U蜽`G-p0P$@0`,} 0Yp$p` 0 G(0XH@<0@Bq@qS@XpV!gYKO0@-S @0< 0808CQ,0 00, ЍV$EGHV V8Pp@-@ P(0( p@!gY*GQ[O0@-,M0P@ 0$000 000000@00<0 (0S 0S x $ d\  p(0 $0 30 ' pDS,Ѝ0^VVVV-0@-$M@0 000 00,00 0 Mp00 0 30 pS$Ѝ@ Ѝ/^@-@ 000V  B V@- 0$  0 ЍVA-@P000P h  P LDp`VP} V/VYVbVVV  B Vl2O-,M0$0000CSH2CD"0@@2UЍ0^p@-@Pj05c9=?0PY3 p@8hGA-@x`PAtptQ'Q "Q &QP e<Q >QHV\VaVVVOV0@-@0000cFp@-@P` CcPET`Pp0@-\  @ t S@   R0SSP q 0x1s@-@0000\4 LP| R&\ #P;8;8<8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8;8` V1v Q01P  $0R0P0UJ00h0 0 30 s  Q04 01Ѝp^7@-@0P0000S#* R 0400  P0 0 30 : Ѝ0^H1A-P000`0p000S* R5 R7 0@S0DJ0D0S P0 0 30&  00R  @D   RR 0 0P@PD@P @00  )PЍ^O- M3M0(0 0,P 040 8A8x?8t@8?8?8A8A8L?8>8>8>8>8@8@8A8A8@8@8@8>8A8@8A8(@8L@8>8>8>8>80002 (0 30   @p !r Q B40  P,` b 40!r Q B P  R P  R @,40  b p40@p @ pp @ $R@z RRv V $@o !F!R`Fj @8  $ R4 *0 R  0R : !BР! k0 0 0 4 !`8 RE @C    $R  @6j2[ K^`X_O- Mp M h H / ( h ` @  x h  l h  X  X R !  M` Md M M M M M M M  R> (0 30 X   d ` p  R pR:/oZ" RP 0p \0 \ P0 \ P0p 0<0 p0R00 P0L 0t0 \0 T SS P00\ @@Ct0L0\ @D0 RP0 0 |0 X0K10 X0娐 s000 080 x0V;L0S P0 <SRD0t 0 B/o\"Q00RZ0T00YY  "  `0 0jd0 0j@ 00 Y @ 0I!R@@ 1 00 40 @0 !I004I BS*W x0S0SS S < 0T0 P0STt D00D0 |d` R\0A0L0 <0t0 ht0D 0S0 0# P0 <SRt L00L0 0 `0pj0 d0jjL0@D0 H0S 0D Dt0S\00JP0 P0@h000*X0H0P3Q}VH0`xVVPH0h0 00h 0H0 0 t0D S 0D\ P00H 0D 0H S  H00Sɟ&X00SH 00XH0XH00PS`0! R d01 SH00H00H0 0R01S0 HQH!H!0\P<`PUPpPR``R`3 B`\` B H`` < P`S  S 3 0C \ 0C0H  0p RK8F8J8K8L8L8M8M8P8R8R80S8HS8TV8TV8X8XS8U8@U8`J8I8X8PY8tY8[8\8Z8t[8Y8LZ800`P40PEPP80 0CS:@0 !400`PV *40@ 0@0`0 00V00P40PEPP80 0CSH:@04  10PU 0P*40@ 00P01l p0R DT @ Q0SL Rz D @ DT @l Qm0ST0S40 L Rc D @ !  !00 R*0T0 `"L0SP D0 @D0T h0 0@l Q  RA  l 0R0S9 T0S @!  !00 R*40L0S& D0 @D0T l0Q0S *0P3 R T0S pR !  !00 R*40,p 010Sx ,K0! !0` ! Dğ R p@!0p 000!!!04 00 10R 4 0x0d ! ß R @!00 1040S$ 00Cs000 00S  C1 0p 10#1V0S x0S0,0 0S S\ SZ 00 KS R0  4, , SP,P 0S0S 0Ss 174 0,0 P0U0 0U,P 0 000pCT0 `00 8 0 BR7:@0 !400 PB*T04 4S 0{[03`3 00 00t0@0PPA> 210p `0`!gV0 1!Rd 1p@! 80S8  0@1C!Р g80@ 080 ` d0`0 Q0U dqW <0P U00U\ 03R00SRp  < PW  Wt 3R 0UL0SWp0p P^`X_`L0S D0 @D0T 0 CD00CR l0S 0lPDqT0@PS40 [ P !  !00 R*0T0 p0| TSh00 < 0T Sh01S40Th00@<0T00 0C?o2Sx|0p RT r0T n0p `40 00P40PEPP80 0CS:@04  10PU 0*40@ 00P0001828 0S:@ 01C!Р g80@ 080 ` d 028 0S:@ 01C!Р f80@ 080 80 0CS:@04  10PR 0 4000P00@0A` d 0 $0x\@Px P*\ x , S00@ I@0I1!@ S Ih*0T0 0P h  @/o"#$ 00 R  R0S 00 0 04pSBPS*0Q3 R RPP  R1 0S2PP P\^0SP \  ^P @0C5 08 S:@ 01C!Р f80@ 080 ` d l68 0R@ 01C!Р e80@ 080 a` d0] 04S0C0C40p000p 40 0x ,0 S * R R 04000 1Q4 00`P40PEPP 04 0C0C4070 p$0,0 040, C40|0T p0 TSz < 0DR0 Z<00T0S8(0< 0C?oT2   JT<   Rp  B/o"R\|0T p0 TS < 0DR0 Z<00T0S(0< 0C?oT2   JT<   R   B/o"R0T <0T0 0JT<000SX)0S{|0p RT < 0DR0)0SZ0T<00S|0p TRb < 0DR0 Z<00T0S)0SU0T <0T 0JT0L0SG D0 @D0T <0T0 0JT<000Sp*0S5T0S40!  !00 R*L0S$ D0 @D0T <0T0 0JT<000S*0S T0S40!  !00 R*+d `0C S0 ,0 Q04, 0 S S0S+S KO-Mp@ DZ R`PdZPJ RU R R!RTkPY! C Y T  R0   -UMTQ G E[Q^A 00p@ЍAQ^ PE@PU T    % P @ L 0 @  Pp U 0PE@¨P@DWT D ط ӧ[ RU@O-@ ?M( 000000p 09P0P0 > 0 30X R 0n 00Q00U0h00,ZV0 0 C Q0_01 SP QP 004Q O00 0,00$0`Pp 048<0h0p0ZV 0H 0C0C400S  Q 0p0R .[5#[$ [ W 0 0C?o 2X0Sp 0^S*S C \S?Q+Q  f  ; {SbPS$ K Rd8a8a8a8t8lu8b8b8a8a8h8^[ [[ \[ ?[ 4U 0   PN{[ |[ 0  |(  S 00( JQ Z0Z5\0C2?o121(R * |R )  0H0S 00lQ Q#QP P @V0`U0PWp0 S 0 Z Q \0B?o 2 )R   |RY 0H0S 0ZQ )QZ00SD 0|SQ  Q#PP P @V0`U0PWp0 0%  p0  P *[ Q?[+[ p0\[RP P +[?[0 +[?[SR0U Y^Q`  Q#sPPx P @V0`WPp00 0H0Sp Q0R.0.Q0S00 S 0 R 0 R  0@ 0E 0Cs S4 H0H0E0Cs S4Q Q#+PP0 P @V0`WPp000K0S K 0Z p^Q Q#PP P @V0`P00p0H0S0 ]Q  Q#OP P @V`U0PWp00 0H0S0P S4OQ Q#OP P @V0`Wp00P0H"0SP 0H0S#0^S0000^Spp0`00I0S*P 0   J C0YS 0 000 03Q_  Q#rOPw P @V0`U0PWp0QF Q#YOP^ P @V0`U0PWp00 0p0[|  0 Rp0\P \  S  0p00R0!!!]P `  S5 X 0S: kX -PQ ]R  N-P(K^[[Q (K^[[Q[^Q ]R 0p 0!mP ^N-Q  ]R  S 0pp00  :Q[P  IS  [p 0 ^:Q]^ X Stͅ00C~0p:Q@]Q tVX0tRX4tNX8tJX<txFX@tlBXDt`>X/oX"Htl 7XLt<3XPt0/XTt$+X?o2Xtd0$X40X \SRH0l S@0S00ST0PSL0SP0SD0S<0S80Sd0Q MG^`fVlVrVxVcI~Vp OJ.XSw OVXj [pc 0d000S0040S00 80S00<0S 00 1  ! @0Ss00 D0Sk00SH0Sc00 L0S [00  1  ! P0SM00T0SE00 X0S=00 \0S 500  1  ! 0S d0S $00  1  !  [xU0s0AqQ 0H\p0 00 0000:0 [P=QOS [p  0\=Q]\  S XtͅH|p0=Q@]Qt Q X L[ S 1 2p1xAqQ CR 0p0 00 00=0 .QLSl [pe 0 ^.P]^ Q t00C~0p .PL]PtP S Q> !1p1 |0s0@pP 0ARp0 00 00@00.0i 1 2H 0 L 0 00$00$0,0S ,0(L0P0 ,00,0 0V @ $`F0H` 0Q`000`00P 0  V  0H0S0 H H H 0S 0 ) 0  0  0H0S0 H0 V 0H 0C0C40` 0< Sp0S   0Kp0[  ^ S 0p0B[!&[('0KS$ꠁ8w8@x8w8(8w8w8w8w8w8,8,8,8,8,8,8,8,8,8w8w8~8w8p8(8w8w88w[ `[g b[ W[ 0S {[ |[ 0!  0 8 Q Q# LP P @WpP0H0S00H$00H00HC 0 0S, 0YKQ  Q#KP P5 0U @0PW`p0*Q  Q#KP P 0V @0`UP0Q  Q#KP P% @V0`U0PWp0Q Q#KP P @U`Pp0F0S 0< S {[0\00C \0 Zz:*0J Rp Y  /   \Sp0 S  p  0R0}SUh0 S 0 P Y$ JOp ,S 0P00C Pp /y Yy9)0IRP  Y[ Y0 0 K R_ KY HHS0Hp 0z0Z0Uc0 Y  ppJ E0 0 0HI  CyY UK 0B$0 Q  Q#JP P @V`U0PWp00 0H0S H0p + 0Q Q#JP P 0 @V `U PWp ~ w s 0p { 0P 0H0S0jQl  Q#JP P @V0`U0PWp0 0P 0H0S0FQH  Q#[JP` P @V0`U0PWp0 0 0H0S0#Q%  Q#8JP= P @V0`U0PWp0 0 0H0S0Q  Q#JP P @V0`U0PWp0 0s 0H0S0Q  Q#IP P @V0`U0PWp0 0P 0H0S0Q  Q#IP P @V0`U0PWp0 0- 0H0S 0Q  Q#IP P @V0`U0PWp0 0  0H0S 0tQv  Q#IP P @V0`U0PWp0 0 $00KyYHu0 0C S P 0H0S 0  Y 0CQ7  Q#JIPO P @V0`U0PWp0 0?S+S\S&0Q  Q#&IP+ P @V`U0PWp00 0H0S0 p   0H0S000PQ  Q#HP P 0V @`U0Pp0 0RH00H0Q Q#HP P @WpP0H0S00V00C0 0  `p PV`F`WP$wp Ay 0H0Sp00 Ѝ 0!/` R0 -000000   /@-$  0Ѝ@-  0Ѝ0@-i  !NP0`Vp@-PP@ 1S! pS (10(1/Wh0!3P P0pvF P4p0 1mFPp` `VVV@-@ W0 Ѝ `G-p$1@ppp Q`PFF00  @FP3 u 00 w0 z01 0p W!0@P0\32 o 00V 0PPP U 0S Qp?GP PO-p41 2<Yp0HS $RX K p .1 p0$0W X01!  10 pLPu pX I p   plH0 pHQ1 0S R /QP  HL 1<S < 1>S > 1S @ % P 0/S$ P01q01q  ~ yx q\ i@ a( Z  Rz Jr Bj :b 2Z *dR "HJ ,B :  2 + |# t l d  _!RpnX 00CQdY J pX0SS04 0Y#S  M $S 0!!W/ 0S81Q01(014!qPpP 0/S$pPX@!D1R<11 @!  00 W SUQ0S01p 1Rp001001  0Z0S 0X1 0 \ C p 1 ` R `W 31@0011P 0p&010S &1 `_W0,0p1 $(P$00\ 000CS ,0S|W1 t0SW01mh0DK1D0 2p1pG2 1 001001P 00S r01C1S  2 Q  1S+ R 0S# 1S (q(1X1WpGq pR { ~} p`00a0CS u00S S`F z ]hH1S !0  ! 0S JH1S01 AH1S011<S ?<< 0 /1>S 1>. G^=S(1 0H 0G P/ 0Q+ )R ! @ p 0GP[0 ] 0 2R 0 R{00>Sw)s ,GP   0 01_0 ;RA00<S= TPR PL0 0 p 0|GP    ,4 0S    W   0 'Rf 0pWW 00S>Y- pGzW꘲888Ȳ8ز8W2 (u i)n0>S-hW[c WW]ZuVlRrnj0 R R=Y 000S 1SXTp "(' ) Jx<    ( )v  \P h p@Wb$  X  `VpO|}E = 5 1 0 1 10C 1}0 } d ]R p0HS pWn P}0 Sp01j0S01$0r0HS e XpG01lЍ0p@-SP~ 0C@8S`8S}갷88ȷ888ȷ8L8\8848T8d8l8t8ĸ8ĸ8ĸ8ĸ8|8ĸ88ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8ĸ8з8ĸ8ط88p@3*0Sp( )   *pp@ & xtp1(S  H p@8  IsIRVVH4gI$V.VI:VG-@p!`0PPQL\ 10(S 1 S (P01 U )( R {)0 1G-@`PU1S0S XP P 0)Qq10q*Q04Q)0 1<b0P0HS pZ`XS PvP ."q`QVVG-pSP [ R ]G`V 00*S@ T@\ @`0 rT )VcK2\ 00A-P1SSp@@`S@T@( T)AA-@PP 0 0p0 `0iS.[ 0XSx `0iS ]mP  = EV 0G-P 00fQH @$` p <R  `$!0lS LS" RS $rS(b  w{x m p)I(E e Z,^ S |VKVI 0VRrRKRP DR/0wC0OSP//QR00P0S000  /p@-P`] @Ppp@-@PP/ `00CU$ 0 0  $R0 0 U| -@P _R.R00$R0S 0NS ,0 000C,0(p pPV5Jp@-@(`P 0 BR (`p0 00 MP A-@0SSp0 00S 0 000 C_S R?A CR@  R``Q C BR`TQ QMpW P00 p(,0V`` p0p,0PP00 0 p`0BSPP# _S  $0 C R1"0 BA CR1"7 BQ 0S 0 00_S 0S0QP RPV0/o"/P R  3   0/RP00 A\0000  //RP00 A\0000  //G-@ P8000P( PP 00FSP 00CS 0 0P=PPt7 0 30 2ZQ0/Q0A*QD8D8D8D8D8D8D8D8D8D88888888P888\88488888888D8\8|8888888888D8aAq Rt6b RP P 0(86 P1!, ,0 0,0 PP ` 0_S 00C S 0 0000C S BNPPP 0 _R0 0K0 *P PCPP ?0P +h P`0IS"40S PT 0  , 0p0IS}PP@ 0 P ,rP300 C_S RA0CS L 0P0IS0 0P 0SsP P 0$[P P 0"SP P 0#KP P 0%CP P 0&;P P 0P0IS?0 0 !#0 00S 0 00FSe T0Cs "R"S,8888888888888888888888888888888 8,888 0DP\ 0 R00U 0ESO] 0L H x ,0 0,0TPLHD@,00`000Cs0 S001( PO  0S0 00s0C?o210_SP PPP 0 _RP 0 00 -ePP<Ѝ^{`VkGYVhV|VVVVVVV17@-@000 P00 0ESS  .S ROSRS0ES  P0 0 30 (0.$P PP  R 0'Q 0 S,00C,0 Ѝ0^ 0A-@ R    0P+ vR 0p@w0 S"` PQPPcRvP004`?o240v40 S0544`PdH0L?0RbpW PUPP200 ` 0Q V 0A-P 0B Q F@ 00BSAvaBQ#0@oR nR0 00000@@P* 02S ,000,0?P0 7}CBQL(pW R,  , R CR DR @ IR0  0  01APR0 00`A (p@ @P 0 BR888888`0 0) @````LR 0 0@P@PrUR lR tR  tR0 0`P@PI00 `  lR0 0pP 0 ER0 0`P@P> pG00`9T 0p@-P JR0 0 Q@ r@P 0P  )p@pp@-@PW<0 S0<0 0 FR U<00C<0p   YR0 0L 0 ER0 0p 0 LRTRdsRA-@ErQ9 8 0R US.BS00C S `4&C0Cs023 080 0` ER0 0 0P0IS0 bP0 A[a0CSpQ:0 0 0LfRpQ.  TR0` 0 1s`P)PP00 `0B QoR nR80 0rPP 00ISC0 tRiRlQtR0 0PP 0 R 0S E!0 1uR 0 0P0 ?`P 02S p,0 P B0,0.>Px0 7z4S2 3S 0S񟗒80888 pW񟗊88@880 6a0mSpS R 0 _R0 0 =PW0 9 0 _R0E 0p P +|p=PEP0 90 80fSo=P=P =P 0 gR0sSsR0rS 0P0ISo0 F`=P P=PpP 0 <,0 ;'0 :0fSnS0wSaSPP_0p 0 ER0 0 pR iR0E 0iR0lSSp>%HPoUahURPVhVp@-00P@00A0Pp s@-P@0Q00000 `   2 ʠ .Ѝp@ PX0 0 30Ѝp0.P 0` R0 0^O-`R 0@Pp P`&F[``V P2 W0 P0S  S S Pr[0 0,0 0,00 qP 0 pV[,0  0,0K[,0 0,00SP0 00xS,0N0,00 OR, OS0 , V0P EQ PwS,00,00P EQ Q 3@-000 0 UR @NR; SR _ 0P0ISP P3ZR0 0PP+ 0 ER'  sRB0 0P P |0 R )Q " 2  h ܟ0 0 /`PPrPP U0P 0 0 ER0P 0|1 0 30 ЍdRp0 0cpP`P w0 0PH  `0G0C0 yP0 0 30 Ѝ@ tR pP0 IRSo x 0 2   Ѝ@pL0 0 P0 c,0P0,00^HGe)H 0G-@ TRGR), ,TQ QPGQ  R   TR AR RR P0 = WQ@QAAQ$8x88x8x88x8888x8x8x8x8x8x8x8x888x888hQ- vQ5 cQP {P  0 , 0 G , 0 ~ 0 y 0 WP y 0MP o 0`PPw 0_Ss  S,0 0,00K 0F 0 0{ 0f 00VR5 rRKPH 0 RD P P0_S`@Bp<0S9 $SDPSU= _U= $U0`Ff P P PpRP P% X 0A g P V!0@q9 0l 0f R  0nS 0KX 0JR/P.PY 0S$S `F  P P P P`PP V 0 00SES 0S3 S  P0PS0S P 00NS 0CS P0CSQ 0P V R )R `  Q 0SS 0CS5Co! 0p@-@ `_R0 0 Q Pp 0 ZR0 0[VP 0 0.S0a C_SR00C S 0 a@_P\0.S  B"0 OP000C S 000C S 0p@- LR Pp @ 0ZS_S  0P ER0 0 PP 0 `'S 0 R ,  B, 9P0ES` ` 0nS`=` `>`  0ES B0 <S  kV 0LS @-@I0CS@XS 9 0 ER0 0@=0s@-@000 0(P ER0 `00 00 0 30 0/ Ѝp@ P\0 0 30Ѝp0/P 0` ER0 0(P^ IAQ /A-Pp 0`VUV"BV 00F SX@F ?C FR8 8x8t8t8t88t8t888t8t8t8t8t8888a0FS00TS3X@ 0 ER00S PlX@X @0 t@SV9X 0@ 0pH-UMP@` YK%Kd@ `@KT@ P@ @@ <@ L@ H@ D@ 8@ 0@ ,@ $@ @ ZH0 ,YK  S 0H@ \  @ 0 S!D04 Р  1AР( YKРL$0o 0 30 &Kp^p@-P0M`R00000@0 00 Ih 0@P .@80 0 30 0S0 00Ѝp^8 $ (,04</O- \M@h2Pp0(0 00_S0ZSf < =PU _R.R00$R0SL 0ISDSH _REIS``V000 EF7p0 9= h0Kp0SP0 S1 V00MD0 X 100ML = 0FS(\0 \ _R8 t =t hK 0hK\0x t0 =t0x0\0 `0 (0 30' k`hK \00SQ00s0 РhK ZR 0\0 hK0  Р K^PV0@-M0P 000000 000M@P <-@80 0 30 $0S0 00Ѝ0^8pH-LM 1`@P00 0000< X0K@ 4  M MH < 'P 00CS8888D8D8888  0000 0 30 ؚ 00Kp^80@- 0000 0 30 š Ѝ^<0@-%000 u0 0 30  Ѝ^0 %@- <00 00$0P 0 30 Ѝ^@- <00 00r$0P 0 30 Ѝ^, ,0 (0( $000000/#EgvT2ܺ0 2/  2/  2/ 2/ 03?0/O-M0 00000L00@ 0LQ :0 0 30 7^yZnܼbTPA<`Q>TpX@TZ\Py$  l$``b1! l#  l.@`!#@ lA "da @`!@ @`,h A-@`Aln1!p00#Z͌b!y 0nA" @nA$\=@l"Mtc1n l#l!x d!#Z  "yl|` ZČd Ȍy̌d.0- Z4a 8y< ,0d1@ZDb!Ha1"yL0@@a1#0@͌n"ZDH  yL=@aA@ln,ZDHn!yL @@@c!,ZD  "HyL`@nA '@ .. @cq p Xx@,,@cq',p<ώc|0P%P%0-P%aA }@?b!@$(0a1" @0ώa1# 0 &`, `M,g"oa.l,`(!!=dAga$`&` ) "/"c$l⏈g  )@t ((  px@m+@n蟠++0c.)cq|0 0* ?#?#0O 弤4@fA. 0@$`@⯊fq  p' px倠M .}..0i 㯊f|0`.`#o&o&@UdA  ?_i$P800*P#0_%_%?ςg$i<0匐0 #0,?,ςng. 00@ ) #0 ,?,jA.ς$0g0`q@$ @#,,j'?@00 (# 0  M?i'࿂䍈j.dD0 @(0 O#0O$$0?$iA*㿂@$ p 0@,0}O#0O$?$0㿂(0hA*i@$n#o.o&h) @濂?. H0,0M# 0_._%g)?,000忂# 0h!0.?! ㏂(0 40䭊/#$0dA/"g$ " !j!$鏋 "g00p #((nj./? ,00 40}/#(0" a!.O?jA " 40@80<?# @ ͌?#?#0?-g1gA a100@<.@..lAgAl@OaA8 @O!O$O$ba8glabq``$p<!_!cq_%bq<clq@ p,(p,p,ϊbn!nqc!͌ $pD,,,fqnq f pcq@0 p͌#''a?@0?n1af=D0?##0b a?D0b1 0f0 `H=o(o& &loaalbm,`o&o&o&n`lna` 돈bH( `+((*m/Ol!c,n H@cA-aA/+cA_"a!_% K忠OnA 0(@,.<70aS  2 0 30Ѝ@#@@ ЍA_2 0 30~ЍA@T\ 0cSYd@ 00 N  I 0 B A0a0 Br 0A2s0 A a A0s00 S S 0CS %98%90%9(%9 S 00  nh@xXTPL0 @P 0 @P 0S, (@P `0S C ! 0 @P 0S 0 @P 0S q^mJz7R@RScK}MSV1WcIXiJI=T}QIOIOIOIOOA-P`@pT 0S xS NS OS yS@PC@@@;0gS@ @VVVR@-@P0p000p 0QS@P `QP 0 DR0D0@ 0 0 30 r Ѝ^F0@s0S 0/ A-@Q5M000N 0Sc A0CP`9S])9+9*9(+9*9*9)9@*9)9)9)9)9)9)90)9*9-9*9*9*9*9*9*9)9*9)9)9)9)9)9)9)9@-94-9(-9,9,9,9h,9t,9,9-9,9,9,9P,9,9,9-9-9,9,9L-9\,9X-9)9)9d-9@ @p4 0 30dЍX@P@0gS@< hS@0 @@0pCpG0  z@v 000 00i1p b|@^ `W-HPM0@ @2 0 30 0 ЍAk00 00@0pQS00DS 0 @ P@X  @@Pq  r0S C M  @Pb 0S @>@;@8@5@2@/@,@)@&x@#p@ h@`@X@P@H@@@8@ 0@(@ @@@0iS kS@@0p0DS0c@ pP^V}MVVV;VSV1WmJSFMNљKV@RH WSKbiKƪKGiKͪKTiKҪKLgIQުKKKKKmSIGKKتK٪KO-pMQ`X#S@    R FR R BrQyRv090909/909/90909PV`0Sh ȒPĢIJ0U@ENS7 WP P'뜒`㈢刲T 0S YSP ZSU XSU@`W P 2 0 30 l$PPPPP0Ua0C S#p090909090909H/9H/90909H/90909P   @V@ @V 0MS @0NS0kS @0I0CSt1919191900 0KR@ @@ `@h@Th@Ѝ^vVoVٟGcK@RI}MVVVV#V8V>VGVLVWVaVhVQ}VVp@-@Q10M0,005 P0 R@/ 0` 00 000(0$0 00P J@     `:    0 ,0 30 0Ѝp^}QO-4M@03P0,00qP, 000S( p pp@ppT 0S ZS@,  0Ts 0 0DS @2 ,0 30 CW 0HS@0S0CS񟗓49L6979`697969` ,P P  Q@0QS0  @P@p `V k P 0 P@ _Z 0@IV0  ` +P P   Z 0DS i`QY 0@Pa 0@ (@$@ @T` 3$0@ 0 @  S@P .+ P*@= 0@4Ѝ^VV}M@R|1@-M0 000Q@\ Q\P@&P  P 0 0 30Ѝ_\p_\TL\ 0 0 30 X0Ѝ@@P `V *VV0_S 0_S 0T0CS0 @ ^O-$Mpp 0Pd1`@000@00S  @P8 MP P, v0MSCl` 04 0S [ JY RS @XpP<0 0 30 وW n$Ѝ$Q^0@-M0P0 000@P 0ZS@ 00 0 0P@ % 0 0 30 Ѝ0^@-@P0M0000 0 30/ 0S  |*P $PP 0 * @P 0S Ѝ^VVLKP0! !PrA P P t g S `b\/A9<>9D>9L>9@9@9T>9@9\>9d>9@9l>9@9t>9|>9>9>9>9@9>9>9>9>9>9>9>9>9>9>9>9>9>9?9 ?9?9?9$?9,?94?9V LLVZVkVxVVVV LVxULVNfLVVVVV$LDL%V6VGVXVfVtVVVVVVVVP0%P/0@SP9I9J9I9I9I9I9I9J9J9J9J9J9I9J9J9J9J9J9J9J9K9K9K9K9 K9(K90K98K9@K9I9HK9PK9XK9I9I9`K9I9hK9I9I9pK9I9xK9I9K9K9I9K9K9K9K9K9K9K9K9K9K9K9K9K9K9L9L9L9L9 L9(L90L98L9@L9HL9PL9XL9`L9hL9pL9xL9L9L9L9L9L9L9L9L9L9L9L9L9L9L9L9L9M9M9M9M9 M9(M90M98M9@M9HM9PM9XM9`M9hM9pM9xM9M9M9M9M9M9M9I9M9M9M9M9M9M9M9M9M9M9N9N9N9N9 N9(N90N98N9@N9HN9PN9XN9`N9=C"0C S P9hP9pP9xP9P9P9P9P9P9P9P9P9 /# WP W^ W* W Wo WP P/@PU9U9U9U9U9H/P P8/0/,/(/$/ //# W W W W W W W W #C-$ R\R/  q0CV0W@-!op@-@P@`p/A-QPP` 0 B0C1  1Q#ApAL@DW"\0 ` 1#\A-`0P 0 00@0 0OooBDoЍA-@`p PUЍ U0 P`PE O-M0Pp @0  0`  0@VP @TVTS J50FS040FS`0``P`VA 0P` 0 0 0 0CbP@+0 0 VP x` 0Vx `0hS`0`S`V 0 0 0C5OoBЍ@A-QP@P 0 B0C1  1Q#AqLpGb.\". 4A 1#\0O-@Ѐ-0M` 0 00P656 P`0 00 0PHЍPP pPe $ P@RP ኋ@W W 0 PE  pG @ w80C-P @-2M!0 00ZH000 t@ H 00 `0p0 0d0```1 0 30N G xH 0000 0H 0@ 0 S+0C 0=3 `Vڡ V 0p pS{g *` p$0S00S!pGV 0g p2# 0p`F0 0@@ ЍA^,0/C-M1@000T3K00S-ŏ@P`t@[kPP p"W# p@0/Sh8gP 3gP`d 0RPhl0RP@,0 0 30 `Ѝ0`^\*W$Q`0-TM0L00fo@0   00 L0 30 TЍ^@BAo/|0p@a0p !:#l0#  B$"@@ 0C0C 6# B B("@@ 0C0C1# B B%"@@ /̭콅'$\4RBP @-P2S(,0,则0@0^2!*W!_`*W0@-@0# @032" BC`*W(-0# @0 32"`*WO-@0 P0C `U8q:1 S 03U,1R00S# , 3/P7 0 0C00P80Z"0 3/8 P!P 0Pj$03/P[ PE1!S S W(0S 3/ Ѝ40S ,3/*W/ B/O-0@4p8`\0P< 7/0P  Ѝ0 7/0P V 6/  8P,@0p4`*WO-0`p-0P<(03/@P ,0 3/ PV 6/,08Pp$0(`*W@-PЍ0,0000040/@- ЍإAh@- ЍإA,A0p@-S `@P(0S40Sp,3/40,p@/P03/PEU3/(0p@/0A-S`@ pPF V !P03/PEU 0Pb(0S 3/00S , 3/ `8P00040S ,3/$03/*W0G-00@p8 0QUPU`8 0`Y0 `F 0 0QU U 03/P 03/Pp@-@0P3/ p@SO-Pp`  0SnPp@8 X000 0AP- P 03/@P @ @8 2 0 W0J 0 0  !PV T 00C0PT@03/P V 0 @0 A0p@-@0`P3/ 0p@p@-0@PPp0S 3/00000pp@-@0P3/ p@ 0p@-S @P1Q*P0S 3/00000pA-P @`pq@0SW5/Pp@-`0@ P0C 1 S 03R p@0S *g:g   / C0S/q0C0 @-o20@-@Z ^P Z P N PP PČȌ PPP̌ P0 P48 PPP< PL @P$(@P,L,0C 0C 4# B B&"LL",0C 0C 8# B B""LL,0C 0C 5# B BG"  N 0 L L,0C 0C 4# B B&"LL",0C 0C 8# B B""LL,0C 0C 5# B BG" ^P  N ^ l9l9xl9pl9hl9`l9Xl9Pl9Hl9@l98l9 , ($<840̌ȌČL,0C 0C 4# B@ LL ,0C 0C 8# @@ LL,0C 0C 5# @@ 0y7/0 R//R08 00 0:S 0S/\S/SV1W@-M`0M*@000{P+(0 0 30 {ڍЍ^p@-@PPDpPp@  O-0S`  @ Ѝ/U 0/Q 0PU @PD 0pYpGW   \  P011`V0P/Y0 /R IPv p `> pRQO-PP MPP0 U3@0(0 0Wp`qWa_P] P@@0? PJ*P 00M @P P:PX./   B  U /P/!dP(KbP# * Rp0S" -P@ @`pA?=8 `2 (0 30 "{  @ UR00 FK0 X K (pP@` 嘐J Zᜠ @ K`P@ 0PY0 @@UU@ @5P@YYZ@`ʫ'PP \ @ Z I0 @0 0S @P   ZD0 YY  0S|P@ .   s  0  /00B0 K^ XI00p@- a PP ] P@0P p0@0?@0Qp@-@!@3P@@P*p0S:0C 0p T :4 0P  0  p) 0P  0  0Nd0@@pp@-@Pp@F PD G-`PUpWU*NV:P0V@P@0SN@D Y Y  U@DWpppp@0SWpP @G-p,0S` @$匝0$ (ᄝ(,P`0S,PЍD0$  0!(0pS2P:/P`p@-PR @Tp@EP@P -@YkP p@ Pd P  p@BJA-pLP@`)p `0P   0 $ ( , 0 4 8 < @ D@H O-DM@"h00,0p0Pl 0h4t0<00$ P㼸pp0P<4`000W?0S D0 03/0V?0S D0 03/U S 0PUK 00 DPP D0X"03/PP`D00l300`p0S 1 0000`/ Y P P   PR`p0 0W/U   0S[ @Y 00200`Z P PD0  03/ Z2P00PP/ pP `` `Y`p`D0 "`X46/pPD 2 Z00`u<@<gY@9<0@ 1CD04"03/PP8p40PC x1pPu 00\1 D0R@ 04#3/P408`0C001`4# 6/`PC00000`00  , D0 P P `pP"5/PPk 0 1CQ,0 <0 30 Wx40 DЍ^-W-W-W-Wd-WV.WJ.W-W@- Ѝ0A-S 0PS0S aC00@`pa@P <0 8`P+ pW@p0`@pHPJ1@-M0 000S10@- 0S*PU'`QD0` 03/PD0 03/PP0 0 CD0`p 03/D0 03/p40 0 30 wPC00Ѝ^@-@P`0U0 00! 0 PP B00  2  w|0Vx~04S  00004P QD0 03/40 0Ѝp^{T H QD0@-@03/800/@-@$`0PQ0 000 ~P P D!@!$0 0 30 ]wЍp^@-@$P0`Q0 000 VP (P P D"@"(0 0 30 2wЍp^ 0@-Q81M@0 00D0 03/QD0 03/4P n8P j$0S0 0000S    $ ( <0S P@0ˑ@0P <0S@D0 0S 3/$0 0 30 vЍ0@^/@-@ aP@öH彶{T!ba0@-TM@ 0`00t00x0 0 50L000$@$0$0S DbP$@0@(040000,0,0S8:@P(8(00(0,00,0 0 P4PR0(PR0)0,00 r@4 0 30.$ЍOЍ/.ST 0.S p\`@D pTppT 0.S$S  0S03 0 30 Jt $ЍOЍ7ꈀ0S00T P0 V0?0H【 0Qp`0 qW ;CCCC $`p#*^1#\3Q# p0\bpppaA A`q Q$pl▱+$`* pW1jWQ 001030$ЍOЍ0 o `P0 D !0lYY)' 30 #  Y 3:YY 3 #   YY 3 #  ? ,,  R  #2; r[ *$ &@0 i;$ Q iGS QuSP P Z00à? pP0P  a^$Q`QV1W 0S/A-p0 @BW  0000R0 0R``S PP RPPP`R 0P`S 0 @- M\@ @  0 0 30 s Ѝ^LO@-(M\@ $ @   0 $0 30 r(Ѝ^.U@-p0` 000@0 0 0 30 r  Ѝ@(P, PUpU0 * aPPX0 0 30 Ѝ@ (0 0 30 0 Ѝ@^)XFL 0R*P  /  /A-_P@P!p>`_|P 0&@!0@ W@@@ 0@@Ï00V1W@-@YP G-PUG@0p`p lM(0, 0 (00,  ZP VW G9 6.W@RTQG-pP _P@`B&Nb`@v00000@a @r RW0@`O`@  V1W0@-M0 @0 00PPl 0 0C<0 0 30 qP00 Ѝ0^k;UG-` @xp up8(00  00P00$ 0P0P@ x _0  #3QR W 0" 0 0P@0 S0# 50700C_\ 0ESQ0P0P00U V1W2@-M0000SB@gP 0SPPd2 0 30KЍyPPKgP0bPB cPW aPCnDP  L0S?`V0S aPE uP;U1a1 030Ѝ@*xh0@s0 `1pU 81030< $qP 00 0  0C0 @P ` 0F0  0F0  0F0  ! V0]R0`5 32 :h  0L ( ^iJTLO.WRFLOjG)XIOIOIO.WsLO3C-$M0000S@` NPPAPB0@ S9999999|999999XP| YP 00cs P'p`000SR   0Z2 0 30 w p뤒 0  Psp 0 `030`. < U 0CS $ SS   IV  C00W : 00 21 0 30$ЍV  $008sp00UpD MU ( E0 0 30 $ЍC6V   `P0SEPU  P?0SPP^mJSV1W.W&H.Wz7RDVsLO`QNI.WV@R0p@-S PpB@`P 0S``PIPP Pl` h0S PEPU  P@RNIO-$M<6@8v000,f,0Sa0@Ps0S&QUl 5 030S hoA0@S]9T99ȣ99999999999Ƞ9Ƞ9X9X99T9l >L-P  0 H, -RU  ' "PU  AU 4 0 30 $ЍO dP0S U`  4 0 30 < EPU  P_؂zUP  KP* CP `V 0S 0083 0 30X$ЍTcpP LPU : (  bP0S!  uP  0_S  pGpG~ z0P`PEdPU  jP< r0`,`آ0SD LFP00 0`P  Fh1 0 30 0$ЍOQzPp&PU* t ,%U   P#B004 PEPV  0S `j0SCP|P=00C0$0 0 30$ЍO*^FMLUQ.W5gI}QmJSScK@R6M}M.WW P.WiJ5V.WTQ.WNI6pRIV@-L@P 1 0@KP @9@;C-TMŸ@L 00_S$ (,048  2 L0 30 m0RS ZS0NS0808q  203 RL b000 _R 00q$ Br R6" 0SqQ`V F0ESX`F IPpu,QPU (0X 0S0hSOPXq0QS(T@`P00B(0 S:,o~0S  S,Q( 0R*000H,0( Q0,0TЍ^V1W@.W`Q@-Mx0x 000000 0002@P 40 0 30 l  Ѝ^Đ9T/W{0A-S`P03/pP0 @@T03/PW0P 0 0 P0@0 0S /? Z0 @ 0 P 0WppP 0 @ 0 P  0 @  0 @ A-` pP@3/P D @  p @-Ѝ0@-000 0 Ѝ 99A-@PU: 0S 3/ 0S 3/00`P` R 0S 3/ 0S  3/0PP R 0S 3/ 0S 3/ 0PPp03/WU0A/A-@`p>PU 03/P oR㨂X 0S 3/ 0S 3/0`03/0`S 00 U0  0 p@-@P0Sp 2/Pp 0RP ` 2/ 0S 3/03/U PVp0 PU `p`pp@-@P0Sp 2/PpP/0 P/P/0P/0S p@-@P 3/Pp0S  0Spp/0S p@-@P 3/Pp 0S 0Spp/G-p`Pd@V T D a7/@P  ` TᄐPa` @UP//P://XCA-@0S   P0PQ0pW pW`PP p0 ` 0 R`aPP  j0 0R !8`x3W@-$@0S 0P@8`7@-@dP0ST0S0S P(0 $@i Ѝ08`V3WH`A-PP@H@0S`@V Q P @8`@-pM`0 @0l00KRP 0 : SW$0 l0 30 jpЍ^0@-@0S 3/dzh`p@-P @ p@#@-@ P0@+ }iЍ5Wl`p@-P @   p@p@-@QPP  TP@pA-`pW&P0z@+z@&zph`PP ȍ@l @0/  p`V$Q'5W+5WiVX5Wa5WG-`p0WpV0`  @@ PC  @ p@< 9  [p D0@"5+ 40 !eUP#V!gYBJ!_05WO-P04^@ `0P U P0`P p P^p#p^1pVLV3P`Sp0@W7:fpFS30SP !*`qU 8%0. 0^13 :^H၂aN~^<*`V: D B  0Q C[  0CX 0D8.^13 :^ ၲa N{["K"p= ၲa N~^1A"N"A2!A"N= ၂aN~^1A2:AA 0 CR00r   P:0CLP l  S0C0L ЍQ/0 0AG- C \$@ \ B 0S0>0PAPQ0P PPP[PPUPP S0Q B 0 00 \000CSQ0000`\PpW 0L\L D100S0%030"00S 0 00000S0 0W 00CS`X0 !78 8!R  ) p"(2c0p0000STpC0l0r沐Sڲ0Q 3, (2c烚0A8W06W@-     0P Ѝ0- R B$! B 000 0C008Wp@-@ 0RP Rp  0R  B0C R00;p0p  R 9090909099(99 P0> @P-0 ^ ^l^@P Q < 4\Q\p @B|-0 QSp@-p0H R b0% ^P0R@. ^|1 B0S!R 0P00ì?0\P  pT B@R0R h4LT b pa0@  \`pp8W5wɚ;06W0A CR/0QSP/@ S/cS/0 !    !O-`0@1V` d%6 ` aFR`-  ô p @ ,$Os  T0 QR `1QP ø$5 PTtPEPPAPE ppp  p pP Z W `  P bpGQPp @P08UX! @VP`F!T T@D %T @D %! " %T0@D PE S% " C%T @D  S% " C%Z Ry 0O W3 HC0E pg +  -   08P !W0 W1pG P%W pG %#1 " %W!pG % " %W 0%pG 0"0%00SQ\*00@u0`F 08U 0PX !T T@D %T @D %! " %T@D PE P% " @%T @D  P% " @%  GRRpBWU|08.00UX @VP`F!T0 T1@D %T @D %#1 " %T@D PE P% " @%T 0P%@D 0"0@%0.  `0   8UXN @VP`F!T0 T1@D %T @D %#1 " %T@D PE P% " @%T 0P%@D 0"0@%06WV)6W5W8WG-HM`h@P`1T0D00YKQA0PPV 1 D0 30@ eS uQ9*@1T0010 Q,0Q2PpPAp0  D! 0 b  P@ @pG@PT @T@ @HЍ^06W8W07@-S0@ R p I T@I R@@ SQp 0 t@BT? T<T; @0 @ @3 @@d@/0 R0 @d  1QLˆ0001 01S0P`P300HP@ T @S0S0p T@ Ѝ006WO-Pʜ1!0c0 Ѝ1Q0x13001R\1C1Ѓ01R08@Á>N Bpr " 1P@P`>@N\ l 0 LS 3\@A@R@N\ l 0 LS 3@감PE9ᛞkY`F A! 8W06WR /R/R00/1R0O-13000C0B^1R 020 Ղ  0Q@ BQ31S @00@Q `30ntpN0@03>8s0ಠS ڲ BR1>8a火F @06W8WA-R `@ 0PS񟗈X9(9P99x9d99,9010Cs0SER  S R ЍRR0 0 p R`APf B! A C\ B ` @0 00 0S ЍAR0S0R 0ᰀS2 CqXB HⲀ@L|^"PN@\RS0pG0 Bp 0; 00SR0@00 P B0@X0C0 1Q 0  0100 o08W06Wh_C-Pt1,M`@0$0000C`F0S0S 0p 0S`@1 $0 30= c0* ppFW : 0 0 C  P B _ 00 :0pW pG&p0S0S0p0;,Ѝ^A-@ `pP N X, p < ;cЍA00  P00E o  00 h0 0 30Ѝ R 00p pCpR0C0R t0 0 30 ЍA0S 0 BQS0p p0;0^O-@0000p704`SV0. p0F0 0 "P  U"U  0+R00S 0C00CSUPp1V0Ô0 10`F00p`P Ѝ谀8#P(X \  R \ 0PS006W8W0@-@S0Ӻ0C 1Q0 P0300!C0C0A Q (0< Ѓ00NLL^N!000PQP``ёp p;pkg{`wpW^\ PU8W06W 0O-SM@ 0p 0S0p Ѝ 0 p⌱ 1S0|3001C00001S0H3001^1C00001<01^0P1L30Ќ0 0C0PN 0PE P ^N000P`QPPёW``ב 㰐 :簐ZizP:jf z`yY ^ Y Xp8W06W-0 p 0 00@0\30    0 0C?o2 0O-SM@ 0p 0S0p ]Ѝ 0 p⌱ 1S0|3001C00001S0H3001^1C00001<01^0P1L30Ќ0 0C0PN 0PE P ^N 000P`QPPёW``ב %㰐 :簐ZizP:jf z`yY ^ Y Xp8W06W P 01P/06Wx5WP/000000000S/1S 00 30- 0Ճ00S𝔲 06W@-@ ! 0S00 0000R   01P 00d0300Ճ0 0 R1P04010ՁPA06WO-  `F5`  [ B 0 00^0@-Ml@P KQ   0 0 30 C]Ѝ0^0@-Md@P P-Q   0 0 30 %]Ѝ0^@-1\51 000S0_P00  0000 0000n{ yQ  X0 T0 30 ]Y000<XЍ^06W0@-Ml@P ;Q   0 0 30 .YЍ0^0@-Ml@P Q   0 0 30 YЍ0^0@-Ml@P Q  t 0 0 30 XЍ0^O-mMƟ<0P؁ @.@8@ @p8 0 tƟ< X؁mߍO}@ 00S00Sp @0S0S p 0005 1 30mߍ0 0 080 @000 0R00PY 0@4`(P.b((P-\ aVB@S@p!RS00W0S0000 * s q4 1 30(mߍOg0(0T000 0|00 0X0S,"E^Z PUT0A@0 0,0 0ISPQN,0P G0p0GH0 G0401D00S ! 3 ,0Y=pß004 S:D 0@40H S308 PP c 0  Rá   < @P<0 t,00!"00IC110C@Q *,0 BYR00L0P9P@@2PSL0 0)*v?  1$S1 0*m?   E$0! 0c $00$ 0  !0b0 0S 0 40U: 0 00 2r bC3As00Ac!B Ab!1UP0P5 PbP@ <@P0 @(@000 p≐ ``Y0 0(0K0S0 A000 a `ʚ;d ^8W@Blʈɚ;c ʚ;06W0@-Md@P 3Q   0 0 30 WЍ0^O-MP̟"p8@,@ @@p8 0@ p@@0@P0 @00000 0@00pS , p0pd,0p ~0 0 0 00 ,08 00C000;00@(00S%(00S!pT 00Sp0000 00  P@ 0000 0@000T&X$p"0 0`(0p@0`F 0`0,0p "0 @!(0`0V`t00@0(00<0(0@0 <0 0B00S0? 0 @ @0@0 0@#S 0 S3   , p0pp@80.S 80ň98 030!0Ճ0T0"S 0P4000 40000t04080 00CS01S0 )300001H0S0000≐2Y@` `P@ 0@008 0 30 UI 01X$0 0 0P83001C0A0I 0R`D0$00  w0 D0R f$0i 0F Q ` 33!&1Z0 È73 0000(0 0D000D1C 0`000 Rd0 d /L 0 R ` L R L 0 RL  L $  XRV*ST*HQS1X0ð680[0k KCi ሀ 0HP002$0b  0\0T0440C000BT0T0T 0h0000l0$0 V0#03R0S0 lS)$05`0DqPӑ\KV 0CKS0KA  C\0P00C0$00C$000y0040YS00 40尐SX0 0S2#d  Y*40J04080S!400 SR 0P\0H [00Ӣ?T00CT0H0S[" K0040S0040H 0p0R< 0SR0 p0 0Q00S  \0 S X`1<8X`Q R 4   0p`, 000p`0 8 Q000 P  < @ R RQ 0 0 p 000,u00P0 @0 B<0 P0R 1P0 0200;0^ `0000 0 l<0 0C0D 003P0F00 0Q1P000S: 80S0J X*R. (00 0C C(0 A1R0130!0!  b D 0`s 00# 0]  S}/ C010CRbHЍO:$00S2#L 3TS00c0yh0A000D 00h^06W8W0@-Ml@P Q  : 0 0 30 SЍ0^0@-Ml@P @Q   0 0 30 SЍ0^0@-Ml@P  sQ   0 0 30 tSЍ0^0@-Ml@P SQ   0 0 30 TSЍ0^O-tM@pƟlP,% Pp ! 0P pPp6 l0 30 -S0@ @ 00000@0PP P00`0S= R: p 7P(0( p 0 ` " 0 `ER RpVP 0S0000( V 0BQ`B0 f;0  000꺰"[Qpp(0( Q0PUZ 0BQPB0 e;0 00z EP6Q\L\^^Z [R31[V !뺰T SV 00 0C0 1Q0Ð310=L0`0 00P0 0R0 PApS00(0(0U 00C0 0S]0  "0W0P0 ì23000C!C !0 S b0  P \PDQ_oRPU! 1PŸ0>PP,"P000 P    1[Œ ; 1S0h30    (`U`B0EE0#B0A0E0(0 0 S 0S 1Q 001030 ` 1Q0Ø010"0 ]0Sy0Sv0 p/  Rn k R<0<~tЍO^8W06WO- gM`P$6p010P @@  P@P00Pp5 1 30i oQ@P` 0 @T0S@0000008 0 @00c0P00 P P@ EPeoP0>0@ 0$008@(00QC$AI/@01 0P0p0G@S 00 1 D41纠0 00 0000 "   Q R p   Z` 0 Z ` 0 0Sa  R AJPcPEP> 1S0P#00<P pP@0@P00I@p SP 0@R@@0 0001S0ż2 000xPGP PP0@00 @p0/S0H20"HP g0P0@0@P00@00  0 00  00( 0@0<| 0x t07 0R W 0$0l S0S0 1R0084R000P0h`0 ?0P0`0P00 0p1W003W00<P%PP000 ppP@ \0 0000A0000 0 0 P 0ӓ20ᴦ* j00000$000 000P0540X00T 00@ <0 4004 0#000K0 0#0000400P 00040z 0RSp 00S=0 P SQ*0p'0P 000 0\6S00>0000S0S0p000 0 00  4R0S0p0 0C00 0000" 0 S 0S00}ЍOr^5W5W06Wy"#~{O-MXƟp@P `pp pN 0 `2@E  0S0Sp 0 0`@H` 0D`@ @@DL5`SP` @00eVp@ GpgE>p 0  Q 5 0 308 M Pp0 00 !@0R    3t 30@00 0 W000  0S0S0@0000S0Sp W ``0`@000000 0S2R| Ph  Pc@$ 0 <00xSt0 0$0$`1V`0T360```0VL@$fP @ 0 `0 0sWp0p005 $000 0"00S$03Wpg 0S7 `$ 00S"Q0p0S ` `  F`f} 0`> 0` p0p 0 )`$0 G0$ 00000000S`@ 0 000@$00V 0`P0 0 |`@ 0"    0  00 0 00S0S0p pZ 0 0$0[ 0 0$0 00[ 0S 0"  Ѝ^?B06Wɚ;G-p2MP@` 000@ @P-@0)0S0S# 0 00000040 @ @3S84D@00 040 );0 0S0@1T10$P GP000% 0 0L0| 000@ xp A 0p0S0S @LJQ  0 0 30/ .L1Z0ð0 0$P@Ppp ppp@0<0 80 030404 020 000000Ѝ^06W?B0s@-`P@000 00P 0  Q  \ 0 0 30 KЍp^O-AM7@p0000(@,@p0@# @P  0,0PP P ,Q  -47 0 30 K;,000 UP U $  R )0$  ,0( 8 0 R R 1S   t&000S0 0N0P 0  0,0P0001S06 @004@@@$T/,0PPS0,0 @``@PP @ 0c00\ X@00 0 0S 030C!000 0 @0-00 @00 00|00x0008000( @0@0 S)\⩟0h0000040040\ (0r 0( \40, & ,0m03# 0C0S@0@ ŀ00 @000 @0k@0  0₮0,0C@ 0@00C@0000000 N L @0  @ 0 0S?0 (0000 @0, xd00Cd0`00C `0 00\00 008000 |0 00CS2ڂ>,0,0 y  R:,0,0 p:m 0 0@00L0 @0O00 @020S00008 00<<0 @03<0 00 @08S0S0p`$0S;CJ 0C$ 0R RC;,08 R,0;,0Y ` 1X0,010 H`Aߍ^06Wɚ;6e0@-$M0P @0000  0 01  00s Q  = 0 0 30 I$Ѝ0^p@-08M`@0400P 00 R 600|0 40 30 I00 ( #L 0,   ( 0 02,0  8Ѝp^6eĀ@p@-08M`@0400P 00@S  0 40 30 VI0 0(03( T0,0000000 0,0  8Ѝp^6eĀ@0@-$M0P @0000 0010  0 00000 Q   0 0 30 I$Ѝ0^O-`1|M@p0t000 00Pp& 0p P#0p P0XT1\00 P  Q  G0 t0 301 H0 0<PP 00 0 8 0  0 1  0 00,`040"300 0 @|Ѝ^ɚ;6e06W0@-$M0P @0000 0010  0 000000 Q   0 0 30 cH$Ѝ0^0@-Ml@P Q   0 0 30 CHЍ0^0@-Md@P PQ   0 0 30 %HЍ0^@-@0000@-MP0 0@0 00  000Q  0 0 30 G@ 0S Qp?00000AЍ0^@-@o00#00p@-@Pe0P0PPp0 0@-0C0 P4Q$b C  @-@ 01S0Ü3001R1C00 xP\ B^ <L`A@t@`G@V\ 0C pP@06W 0p  PR/0 P//p@-@p p pPPt@ Tp0S0STpTppA-P18M`0400@ 0000p0p 0 00Q   yP00 P B00S0000 40 30 G@S0p00(03( H0p,000 00eP8Ѝ^6e 0p  PR/0 R//@-0MX0@0,00 0 000 ,0 30 F0Ѝ^/5W    /   /0 @-@Q 0@ 0"!0 Q Q 00RQT "^ `  00 ɚ;6e // ! !// /0@-@000 Qp@-P\@PG DPA 0P; P5 P / P) zP@# tP nP hP bP |\P hVPp@HMPp\7WlQSn7W7W7W7W7W7W7W7W7W6W7W7Wp@-P@5P00 p.P000pL$P00 4P00 P0 0 P00 P0@0 P00 P0< P0; P0; tP0: \P0: DP@\7WlQSn7W7W7W7W7W7W7W7W7W6W7W7W   /0S4 S4 S3S0H:H:4H:H:H:H:H:H:H:H:H:H:H:H:H:H:H:/ S  S  S @S / S l Sl h/d/`/\/X/T/,/H/D/@/</8/lQS8W7W7W7W\7W7W7W7W7Wn7W7W7W7W6W//0/  /@-0 S3:c 0 00'00@8 00800p, @3 0RS!S  ,0 3~4 ,0R1,0X 00$00(00,0 0 o0 T0 302 ?P U0S0R+  RP_40, = '0[  P U_-B" 3 B"_##L,0SS#'5! ",0"410!02010#XЍ^0@-M<1@ P0000P00U]00 00S  ĵ  P$ Q@       S0Q0 70S 0S0S0S  \0 0 30 S?S'+B B& Z  Ѝ0^H8W8W@-(MH0@ 0$00 j 0 $0 30 +?(Ѝ^G-@ Pd$Up-00ĴU=D$1SQ0R(Os00G0 0U 0@ 0 UcS  \l SS])]P  \l YS  \l YS  \l  S? 'ቐ  \l W S  \l WS  \l qS*p  \l Z S  \l ZS  \l ZSአPQU ePU0P000R M EppyE00ppIY5 Ue EP.0 0W E0pg0+00ť-00ŵW!0b100P00 U'Q+B0 B&0'1$P80  Ep s'a000iP00Q*0.0 i0y0Q0EH8W8WV)6W5WH9WHAWp@-P0HM@`0D00N 0  0,  Q  0 D0 30 =HЍp^@-XMp0@0T00*08 0  $0 T0 30 =oXЍ^0@-LM`0@P0D00   0 D0 30 =LЍ0^G-`4$t p0 000000W4P0@H R P R X#LP 0 S#L 0 S#TZ V 0SD400Z  0 0S0PV Q#  C"TDP#  C# L 3pP08P |}0P  % 08 4&0!R  L R8 46S(# 0V 0SP PH(L 0C#LP00圀PPU  0 C# L 0 C$0H0PF P@ `0@s*P IpPpHw *P IpP(60Cs0 Cr(600,60Cs !0Bs 10Cs10Cs,&014s r 00Cs$ƑwXo0)@80@s *yP IpP 00@s *kP IpP 0 0 0 0 30 w<TPZ@ 0X0 B!DPDP 0S  C"TЍpC$lC$( Y&xh|X&hX&Os ?$0 00H>$1Pp@-@0 R  Rp R  R P PU 0P  P,0 0S p" @ C ^^ B/o" \  R  R 0P>$(0 00<$,1Pp@-P0 R ! Rp R  R P @T 0@ A P'0# 0S 0Pp" @ C  ^^ B/o" \  R  R 0P<$(0 00;$A-PapP` 0S100S@0S 0S P @T<10@ P!A R0A0Ds00000T00 2#L0S@U P @20A0B 000^^0 0C?o20\00S 0S  Qʡl;$(0 009$0 O-QPMP` @%00 0pWX R @%0P0000Z 0PS0PЍ-W2  W1 #W/  5  ! 0G %U :W` .WpZ0` P PXW cGpP(< pQ p`!H0H 0@-@00S(P 7$p@-@P,P@P00 @p7$H0H 0 0S00 /  000/P7$N&L0L 00 RB1 P/  000/6$M&l0l 00 R B1 R P/4/(000/6$=<;:9876543y0/.-,+*6('&%$"! A*r:I7 o<0Cs BR0S 0E%0S0  uS뼐 00 0 00P0 010CSh 1LP  @(@A0DS1,a0DS10ACQ1,aCQ1@:3 0@   00C0 @ Y YiYPzx0sq ~nlyig tdbIom][YfVTY_Oo[KXX/0S@0W0@00 0SD0W0D002P0 R@%R@ @0?S ;SP @0S@0PeS@ 0S %S0 0?Q  ;QR  BQ0@@ 0DS%Pu lЍT2$(2$2$-@-l l0 0 000P00  < 00 0 0 30 H7 ЍЍ/*$`A&`*$-@-h h0 0 000L0 0< 00 0 0 30 %7 ЍЍ/ *$@&)$}( 0S 00x4/|)$0p@-@44PPF0P0T 4p  1pb@)$0p@-@P0  R Rpl `0 0P Up 3 PPE`0 SSp p@0ew($0A-P@P00  0S?o2S 00S Tdt00alpp(3000HppU<00VPE6/H($(>&>&`0 00L'$7@-@P 0 0  2 R  R* qPR 0 0S:l0 P p0 0 0 30 V6PPL 0姇 p` Ѝ0('$'$(&$00 00<&$0 00%$|O-@P`  0嬴S 200SN20砱0FsT X0 2P0 Q Hop娂W 00S T 4S4200 00Ppp201Sp T10砑pp㬔Q $Q P9/0ScT㬴10 Ѝ0P<S 9/Q 9/P0 0.`R`0!e>P 0 $9/<9/`0 @  .P 0@  0P /S*S Q0`v`V 0*S0`P%$(;&0 05 0 00"$R 0 0%/,0 00H"$p@-P` RM@0 0 % 0P0%\  $T0 d0@ (0 0 5 30 5Rލp"$"$4!$P/0S S[@o///A-@P 0A`sP|Up P0 ES"@-@0$S0<S/ @ 005/Q0S>Q@p@-@00S P;U@ P/00 @pPQ00- p@-P@ RP00R00S  0R P@`VP 00 V k?o2p/ 0S0/0@-M@0@ @@@@ 0@sЍ@ЍO-pM✐0Is 20CsP@vd`BP TV HX D Ѝ0/P 0)P rPz mPPu0嘰0Ks< Y50I QZ(  PKP뜐P $P  0   0RY @ PS*PP ]0PmS 0P1S  Y PE @0E;QPP P :E . @e0 0p@-@ P R  M0 RM|00 RlM R 0S HM:݄ p@ل$ uJd2&6SD2&eF0 00/$000 0p@-@PP ep$X0X 0p@-P@0S!0Sp U p,p@X$$0P0/ 0Q l$5-7@- 0 @0@0000P00S rh0 @GN sD 00 0 0 30 3 Ѝ0@Ѝ/$$0&H$-@-T T0 P@0P@000G40 @N HB$$-@-T T0 P@0P@000*40 @M +B|$l$A-`p*pWpM0P3/@P@0S@00S 0p@@A 03/P R00@@t$G-`p0P3/@P@0S@00S 0@@A0S 03/P R00@@$A-`e0P3/@P@0S@00S&0p@AA 03/P!R00@@t$0 R#11`p/$0@-moA-``PUZP@ l`|p`0@`0 0 0000V0D0V0DTP 0,&+&/(#p@-PP @P 00pp@0Ps0Ss0l  \p/P P \/(  0/ R+&8+&P 0 0 Q/0S/p@-@PpPP P\00Pph<0p0T 0S000p$(0 00($0Pp@-@`0P0 QP d000S 1L S 00Q 00 0 p*&*&$x0 00P$A-@Qt`` l0PpTP B80PP <008,$()&0 00$P/0 @-0 00L$Q00//ᤁ$P00//ခ$P0P 0 QP//$ 0 0S $4$P/0S/P/0S/0 00/H$0 00/($O-P@"M`P2 0  !!p0圑 0 0 0 0T P 000   PTV 0S00000Z" Y V 0S,a`XP{ a`OPrGPBP 0R R R RP 0t 0 S00` 80 0 0 30 800S Ѝ$$(5*4X*~$ $@-@P 0 0 00 0`P  U 5S QU 3/04` P0 0 0 30 /4S 5S 3/Ѝp $ $(0 $ @-M M0@0 000zP0 \‡0!S:0S :T H0 0 0 30 / ~0ڍЍ $4 $p@-@d`?PPp1P p2Sp01S Q Q0C%B["@- )odp@-P,A@f?P p@] PpY?@Pp?P0``8P F?@P /P )P Pd@T .P)P  BT !PP p#zZG-sP3p`0P?P 0S V 30p@@ PV PP@3,@04I X*PYU PP@V2 02SP (P" dP 20,A V000 Rv 0(  Br,  Brb0  Br^00CsZVR 00+H P +C108 R8P FPQ % Q 1 0 市20$0S P YV0 0gV00I0 0X2V0|0 0MPUA VP0 |0ByKV0P0 $( U!a&|&LJFA<dp@-P0P@PpPpK>04 0000140""2222 "  4$p$00PA-`0 @T 0@T OP,Pq PU02 0G0EP PW$(0 00 $0PA-`0 @T 0@T P'Pq PU 0PP2"0G0E0 P PW$(0 004$0PA-`0 @T 0@T PQr PU020G"0E00 P PW $(0 00L$000 0@-@1S<,$|0Pp@-@0 PU\ 0PUT PpR0S < Tp$(0 00\$|0PQ0/p@-` P@UL 0PU  Pp"0S S02p8$(0 00$p@-PdPP @TP00@Tp,P00 p0000p$(0 00$T0P@-0 @T8 0@ThPl0;l0#(0 00#l0p@-@P0 PP 0PPphPPT }0S  h#(0 00#d0P@-0 @TH 0@T , 0@T ,@p #(0 00\#@-@P$@ 0 00#@-@P$@%0 00#O-P8"42M @p0 $0000 0 {0 0 ` +`0 0`20@ 3S 0+00 V0 `! U00/0Sc 00 `  0[=9 = 000C0U! 0C B2#PEXPV@T CT@ @+0 04@@B 0S +0 0 #@4 ,0 0 0 30 +Ѝ##|0| 0p@-P@(0S 0 (R  (  |R 0 S( R(P(p`#P/0S)/ U PU^P\ 0S 0A@^ ^ 0\ `Bp ppp@-0@-A^A0 0P< \s s  Ss0?0@-A@\0S^0S^0 4s00A-@P`p^玀\X \X Č|\ Lx\ aXp@-P@ BR@ T@ }000p 1@-@!0$00S,㟻P 0SN㔻 P 0S 0 0!R0!R"0R0xvP 0 ,',O-AM8 MP@A 000HpI7 IP0`0000 0 0 C CC 000 P 'A|7 0 0 30 ^* Y0Y4"SSS 0,0,70Y(00YY0Yp Y0Yz4J s00I0K0q$ 0r 000 q00 00$0 Sr0pp0P  [ 01<# 00 04 0R B 0| 0 S=<_\> =\= ^[ Y 0`B|@aLZGL P0Y 0 0C S I2 100?SŠC Œ ?\ÌҀ>?@I z P @ @020@ QA@Q7@a@QW@ Y0SN Q0 0SPڍ,Ѝ#F,#C-p,!M(1@P `0/0 0010@0MB0S P 0 0 0 30) ='P P *P: P Ph PP 0 PP7Ѝ#Y4#;dP/@o/@-/@P@@-@!0@-M M0ʍPP0000  0 0 0 30% &@P 0SV P*@*%P 00S 0lڍ Ѝ0##;bp p0 -tM0 0l00L P@0  0 @o l0 30 &tЍ##p p0 -tM0 0l00 L P@0  0 @o l0 30 q&tЍL##O-p0P@`TX0DH 1!R @1qV Ѝ0 P P`P0 @  A-`@PpT@yP @O-@R$M2U`02 0 rrAq%P벂pF⼑HIWK2S  tA q t    Pp 1DⴒC0I1000X:022H S"  P H @r  H rAqP` H0尒ᶂpCI0HA 10W$02$Ѝ0 1y0P pGH 0 1iP 00 I0H001 YP 0H0pGlRA-`Rp R @@RPT:B@R0P@R R" 2 0C0C1 0C/10Cp@-@PPF"2b0 00CR U U10C20CP*2`Fb  P20C210C1p10CP20C210C1  pG-Rr@2bP0`p RPpPU2:p qP& U0f0G FpG01p ! lXP( XE 20q2P10CH P GLP C0S2 q02 P 1 C0c0UL B00  42q02P 2 C0c0UL B01 !DG-@r2㶒pP U2"0C0C0 1s0 aP P ?0 PP P  P  $ 0 PP  P   0 !PO-PP$M@ 2Qrp2p 0FP`V$Ѝ˴`P2S 2"s n2S 2"s d0ᲂ 0 2 00 0]2" 0001 Q 00 1 " "BX# 0|P  X`P 0 mP  6U$ЍO薵Z PQp "20"0 Z"2R$ $0R|`vG-@`輑 :P_밂p/PP   QP P  2RP2P QP  GP蘈0 R#11`p/$0@- 0 00000S 00S0000 0  C0 (0 0 0 30 " Ѝ#0#A-P0`S@ pжP 0E%0 S0 0 0QS00 0QS00 QG-`VP p᭶P@ ] 0 @ P00U 0D0U0DA T`` @-o@-oP < << , , (].  %%0P @@/ /᜸P D,0@-A}(0$f/ } \8%8%00/e#,0, 0p@-P@iPfPp#0Q0% A-`p1P-2@P u@0pLTU ႾP 1pP <@/d#p@-X@T0@0 R @PP@TpP p#l0p@-0d dP@P0SP 00Pp0p0S1P<#q@-@ 0@0 #,0, 000S/@-P@m#D 08SP/P00//L#ğ$ O-,M 4 $ 0 $@0S P ?0p p 0d4P`00 0@0D04 6(200P PU`UP P:0S `P`PU`0HPU9>ph9PW` @@p 00S#p ࠠQU<h 100qW[P"2 0 $0 30 #!:U`:SP 1G1 HR 0 P 0 P 0p00 0  0S + 0S0PᠠW 8PpG00Sp\S P 0 CPP Pe+  P 5P 0 0  RPE 0: S  S004 0 0 UPrP ^`d`dP ^  h0ᦲ뜐g,ЍO蠲` $0 0 $0 30c,Ѝ##͔qf T(>?#\#0P/Q!DS!!R2 P   P0o0%%@-@@P%/@-.0/p@-@PPP TP P P LP HP DP @P0 C CC00p@@#h00 /0>$7@-P 0 0000P/@P  55P0S 0S 0 (0 0 0 30  Ѝ0#(# 0 0@-M00000P0Q0S d0 P@0  ^44 (0 0 0 30 Ѝ0#K |#h0h 0p@-P0SP/@P D ╰P(  :p<#A_ zp@-@Q 0PS PPpppA-pPdPP@p`P T P(0000 Q`#(p@-PPp@UT` @@@Cpp@-Po AX00RP @R0 00S @OBpp#(0 004#P Q0$00$0//P/P$/p@-PpP@P P X0TB000 @!p,00 !p#(<0P0 R$ 00S //0#(0 00#0  P/t5#0 00#@-zp@  P0 Q0 Rp@-P R`@Q 0 0RSPbp0V V HP p uP$@ 4 <#(0 00d#0p@-@P0 | QP000 dd!|0S _0|0`!R ,U}pp@#(V0P @-@ B@/$$!@-`P1DM 0 <  @T 0@Tp' h P 090 00; 00<1pPh V022< ,0 0 <0 30 DЍt#\#(|#0 004#!@-`P1DM 0 <  @T 0@Tp% h P 0 0,0 0<1pPh V02< ,0 0 <0 30 DЍ##($#0 00# p@-`P0@M 0 <  @T 0@T h P 00 0yPh8 (0 0 <0 30 m@Ѝp##(#0 00#  !@-`P1DM 0 <  @T 0@Tp& h P80 900 00; 00&pPh Vrr< ,0 0 <0 30 DЍ#x#(#0 00T#  !@-`P1DM 0 <  @T 0@Tp! h P 00 00<0pPh Vr< ,0 0 <0 30 DЍ4##(T#0 00 # p@-`P0@M 0 <  @T 0@T h P 00 0Ph8 (0 0 <0 30 y@Ѝp#Կ#($#0 00# p@-P@M `P0 0 < 1 \ 0\) h@ U Ph@ 000 06`P D 40 0 <0 30 *`@Ѝp輾##(#0 00ꔽ#G-PPpp`坁t` @R$qt`2S"0C0G"00 1 S 0Xk0C?o20S Pa p0ST$@ `l#(0P 000 RS 0 R!R|P/P/T RP///d#(0 00л#l0Ph 000 RS 0 RP0 X R00P0/ᬻ#(0 004#A-PQ `V@0S pWPPP@TWPQ t/0 00\#G-@Q0pRS `V.  0P R R QRSPR PpS R@D" P` 0PS0000 PP 0``S000PẐS00P ֮P`V`-@-1Q000 00 4PQ QHQQ 51L :H LLa$000 pS $@P0S 001 0 307  @P00 P`P@`u@P0s kp;A S"#à50 W@Ѝ@ Ѝ/^`O-BM\54MB͍,0000P0 0R "S, 5B, 0 308 US#0SP {S` `P p@@@GP@0@t0D000000P@0pGc(0D0,00000400( ,QS00 4QS00T0K0W/0pG0 @@D ᦴ0S[`ᕬ0S00h P(@wPP T @0 0D0$00800<0k@P P @00PP 0S Y0SX PT  0S 0SëPSPP 0.S0S 1.S Y $SR 0 0 PR  0 P<@  PP0: S$SR*SR0G00GS 0S "000[ p!p1 00*0P 0  K00p` 0G 80/  @p@0<00 00$00QP+ @r00;cmS 0 R$S00 00S0S00Bݍ4Ѝ^$Q*)SI0 R/\R [R \R *R ?R 0]R /Q  R0@!0Q R \R\  R0S/}RSC 0{R0S,R0P/۪P P Q ɵ///O-Mp` @P@@/@T@FP/000U .0 }0PQVЍ5妪 0 P: 4ᘪ 00@-L0pM0l00 0 3/P  @oH0 l0 30 m P@JIDOoBpЍ^O-4eMq`010P۹@@3@P-00"ʹ @P  0/  ڼ  03/P Z0KS`@0`Pㄠ}<0 03/P@AQ Z  `X3 1 30 :/P P00Ʋ ℠<0: 00SC  2/PA 0` S R43" L0P0 R .u P 0 P P   P Y:`VD`VE Z%18`_Y0`V "`rP   P5   L \: Pℐ   R`V Z# 0%`G`tZP m   ZP \0 0a0 0T: s0P  03//K`*eߍ^0WWWO-EM M@SP 0. T$  ~<`0S I00= T4 30t 00S 00P/Sj00 S P uPQϧP  Z  @V {DzP^ /000f0P0  ~S\Pp = 0~S9 /RR @00\R00Sd 0/SS` &P 0SP0H0;L0$000 0FMP H- 00 L00C "ZH.P0S \S0S{S @]P 0PH "00PPpk }upP 0}S0 000> 00E    0 "PP UZ.*0}S DPP:!  ?0 S CS(0 P[ 04Z p 0K S 0[ 00\S@Y0 0p:0pKPP  ᫺000 00S>W> @0G 0\S 0Ss\P ppG~00p 0P 0p0p pV0H?o20S 0(0000 0q$/'Z H 0 Y 0S X ᲧD *0S[ ᥧ  Pp 0S0x唧000 00V0P0X Ⴇ[[   [ t0XPpC jP/7Y+P#\/P& ԶH #0P0 YN IJ  Y 0\SAY> R000  @\P-00 P0 H0;L0$$6"P' Y   0S9 00ᓶX ፶ p[PڥP H&00J ᘹ HPS Ꮉ X ሹ 00 P HC 0jPC H  <P ⚥ P3  a0/  [   ᾦ000 `00p[ Pѵ P@&Q WQ 0G 0\S 0U*s\P ppG00  0<0080040 0D00@0 A$0@PK 0&S2X0S( 10@0  P P $0000  (0 BP $$0p S0lp0Wj $0  AH2 q%> ᲦpPS pp@P${yp00000 `$nZ \֯0\S  0pG00SX0 @~P V0H?o20Sa  00 S0(0,W 0 0 BP ~0`0 0 S0  'P 0 a1A0`P`(pEލ Ѝ^=H @040  D`@ `B!ᱶ80`8P PP@ 00 M PU|S00@0 ?0JS DD B! 0 "!0JPPcPs j? \00? \L0 H H`PL0 0   M4 ` @  Dp0B!pj80p`@08` 40 i0)S l37$hpl+ZK !Z! *Z9 <3$8D`?Z @Z0`@@,P 0 0P000Pq 0,0 S9 `0@00<0 V.8P 0 0<0000Pl` 0 00000000PE 0``<00C<0 0@080 T,0,0 S00 0 0@00rPP @T00 0/S0800C?o2  @]0P T 0 </S@80PC_o 0R00K0P4 R4 ( 2 4 L 0 000000040PdPUV00 0/S0D0?o2  <  0P{ Q 00 , .00,P K^ `VWWfWWWWO-MM`=@80=<0 p0 0|900000S/00,00(0000 PUT @ /P00  P?U1 +U !U *Uk T+ 0Sc Z/U0ST 0/S`<[U \U; @U  0(S= 0@00p  T 0(S= 0@00p 7  0 30 0/S0 .S``V@ PU 0S  TP T 0SPd + 0(S(= 0@00pT .R00SP*U?U00 U/0S   G/B!ဴP 0S @`0Z(0C?o20S ?UT 0/S0Sy@ Y P G,B!80TP[U Z& ! ER#5320(SI8P TU*=  0P00000P80S 8[B <@@`@`/U0S; T5*0/S=  0000X1P%0(S\UP0S  PI T*0S  U = 008000P `(40S#P000T .ZJV0!S #^0C?o 2?  000S 0(0$0$ \P  R2 P 0S 0-S ]RR P -S l]Q $0`\Q00S `Q P  Q03PV :/Z0S[PR0:SQD 0`:\7]\͍!   _R&@R#RRv^t  R 40u 40Pj 40 40P ` 0]S#0S[`{%B[UaB[a`LV  RJ 0]S0SC P 0Sz  xS8 $\SQ 0S/  `[S0:S0Y# :S0]Sa0CSF=S 0S 0=S0]S .S 0S .S0]S `T4ݍЍ^ `VWO- 08Ac4 Pz 4 q }4 P `(0]S0Sa`NV Qa ]R0SZ S'  R 4040 s01SJ $\SQ 0SA  `[S0:S0 Q5 :S0]Sa0CSF=S 0S$ 0=S!0]S.S 0S .S0]S `WH ލЍ^ `VWO-p-(,M2@ D 000 0qP @ < 彪 P%* <K00M80K Ep@H2 00 30 ]Vh@8",2 0 (0 30 2000 0@ *-T @P4 V0  g R0T ` @ XR`@P BRP`@`P0T8 *4T@ 80 E, 80 Q*  M  U(1 @B 06#0$0QSS0  40S`,P J@000@80 ,KJ80  0Q,P~ J|@ @Rt KW#W#W#HTO-PpUeO(PeODT0@P0p 0S` ` 8pLZT5 U  0'P !T`FTX"@1PSC V T11P1S@D!P 0 `FTX@d00S* 0`FT 1S@D1S@DU  0P !T1P00S V01@11PT0A-`P0X S@UP@@d@O(pODTq0X # *P  T  Q P010@c T T0TU E@ UBP  T   T  T QA P1D1S@D0  00  00 0/O- 1$M4 ʏ*Z0ʏH0(0 0400#G00 0G80 I`PV00>0S@@0,0 T  Q8M<  \G< Q-M40T4  JG4 0 d 800 1,?o 220FP0C@P0 GIH <0 0 (0 30 ,K)I,K&I KQ#O#O-\"X2  4M00(0 0080 0<0 80ß#ßI<0O#OD0I@0 040 <0SH0p`SPyP40SX  F0000!1 0 (0 30Z T04 S000 X0 0,0 00 S U  Q9MD  FD00SU   Q+MD  FD00@ PE00@ 1?o2T8 <,24 0BP0C@080S@dP@ H,KH,KH!R@D KTO#N#@-0 Q J ЍO-`" LM@pPT@dl0 X h2 U` 0 0(0 00X \0  QpM @P L@  QiM PD @P  QbM 8 0h0 XK  @KHT `0R 0d0 PQ[ TA4  QDM , 4@K LPK;H  7H I Il0 3/  HT R$P  R ` dI\P H 0 0 (0 30( \\KG\KG\KG\KG` G G L@K \Ih  XI` l03/h KL#J# 0 0 0=I# 0 0 06I#4!41 pH-M0@00 00S9 0c0 b 0(0 0QaQ$  Q)M  `$PK G 0S00S  G G(P GD <0 0 0 30 G(KbGKpI#H#p@-QHP@P <0003/ Qp00p@0/HH#O- ,M8 0#P U ( 8 Pl< \: 58J `%0 0 0AGBIo^ U PP8 0 pW*0UPcPP 00,N0@4 \ \ Pe!1 0 (0 30m ]Go 8o4oL` ol^: QY, +  Q$M@D80#KS00400 00 P 00JT@D@T+Z@,P FUPdP,KF  QMR 0p0 ]P@D@0 ,K< F@0< !1R @@ KG#F# 1  .4"O-`" 2DM 00(0 00SFV@p V  "2 0 (0 30  S0c    0 b  PU  0PS 000Ï#UÏHPeU0\0 X  Q^M UP @  QUM P8 UL  QJM UD P4P  QBM , XK LKlF 0@PK`0  eF 4pKF`0 F jG E E  ^G0S0c000c0\Pj Eh\KE\KE\KE\KE KD#HD#!O- -1(,M`0PV000 0V 7 UƟ&0ƟIPe IpD0  b0RL0 0H0 1 Q+M@ c CL0H @@KP 40 QD@P {E x0 0 00 30 DK]E@@J QMDKQEH (K A#@#L0 Hp@-P @ 00  P003/PPp?#dXHŸ2 O- QDM0`P0(0 0F FD"<2 0 (0 30 @pYT00 00 0S ~000\0 T@d T X  QWM P Yi X L  QLM TD  @  QCM X8 0 040  Q:0M , 0`0 XK  LK @@K7E 3E 4PKD D 9F`0 D D  ,F\P~ D|\KD\KD\KD\KD K?#P?#p@-@`P0`V`fS wB` 0`S  p@jBp@-PQ@` 0`SPP 0PS ``V``pp@-@P`0PUPeS ?B 0S 000p"O- -2M@0/0 00:#8C @ @@I CPPPb0S_ @00 0S 00!1 0 0 30m n0Sptp  R0 000` 0`FSP ]PV1F08oX P0  h`Fw1I1SI P`PeBP F!ᕖ0S0-0U    U  E!ဖ!E1    0S ``Ѝ;#:#0 0 0  00  00  00  00 0/C-\C-p  P 0 -S@0C P `p3C-|C-P  P 0 -S@0C P `p3 000 0  - R0 C- 䞓 P㜃㞓  - `S ppcs㜃㞓 R p@-@ `S `PC`@S ! `PC`PC`@S`PC`@S Bpp@-@P `S\ `PC`@S ! `PC`PC`@S`PC`@S BDp-@1 cs  R:1`1 R 16|p s`18|p s R6|p sp4 -@ c4s  R:` R |p6s`|p8s R|p6sp O-#R4 0ʟM@P p`( @ 0 )9 `0aF (0 30k R0 j#TLT}R@}/}^⸐K}~}oF  ?10 0}VV@ 0` 0 Ѻ0 u000:000S @ 0}/0 `0 000*}^  }~}oF?000S |Tʄ Aό M   \i "BР @ 10`F1pP100 00S0!SA0 @0 0 0  p t?000U:000S O0@ 0 0 0 `F0p0  T?0 0 0 *0P000S 1dR 0 @0 0 \ L ^  - \Z Y1T㆐0 0 R00  QMK A100 1Y0 1d|0 QDMT00 0 ;ʈ0`F1pP10 10 00 00 0S*V `0@  0 0 `0 p>100:000S P @K@T 0  C0 `F0p040   >0 0 0 *0 P00000S  R 0 Y 0 L R S 0گT mT 0   .!T 1 00M00 0@1T 023# 1=M00 0@3q0x<!a Q M 0@ ]K@R m00 K `F @@ 0  00 00 0P10C0 10 10 00 00 0 p0SV` 0 @ 0 0 o =000:000S @ 0 `F,K0 0 0Q =0 0 0 *0 P00000S @ K3#L3#pH-`  1OM#R M000 0 0_t!l1 0 0 30Q |RO>K0C 0 R ʂ0100M0 0.1R ʂ0100M0 01Rʂ1=M0 0ZZ RP0b@4 aρ  Q M0 P M?% OK @6?% 0KpT)#)#G-@p`0@ PPEU0 , @O-@X! pM H1`0QT0(0 00,0 %$/T00P QM0  -,P > 0 0 (0 30 O,K>t-0XP0T 0 Q M0  p+,K> K('#|&#O-p2P!0` 0 0  J Y@: WFP0 PEPE\:[HT@ Ѝ W   Q$[ T@ $P 0 c0!# * Q [$PE0 P PEPEP$ 90@@!# *0 000S[0%#TO-M@P84 [ :R0ЍOg@D pBW0  ]P` r !#4[#0 00100DP0D  V 1 00 0`  Z !Ɛ0 (Pp 0 m1!01:000S  1@1S@ЍO-M✁`p@P C$h1 @D0@5# P 0WS1P4!$1 0 2 30ߍT<\1 L 0BPQ3b R  < ߍO000 ;A q=0 P Ig= [#.PP n=!#!#T|!#!#O-@M`050`P0,000SO BJ^O  Q% d 3PZ 0  00 ` 00000 0 p$ , o  Jr0Pg P0P 0p. (@`@,0$00SG@$04 0 0 30 Z0020V ,Q \\NP: 0  0PP?o2PEap0<@`00JP p0    0 1P 0I1E≐1oSPE0媢! aS PEp: 0  { 1PP?o2PEap0 0$0`1P0S p*($ 0  ^ 0 ?oP2J0($ 00@ 0C0e 0  J0(`0p 00 0 0 b 40 0p $0P ᇰKH$0凁p,0 ! 1RW 0 S?8 0 91K1SK00G p B @ P R (  Iy ` $p0  0 3#00@ Jz0@D?o2!  0A 0 0 ?pGЍ( # #T#m.:O- şP0S|H00H,K:`H,KT0 :T0p<0{S&H00P88D0!0:U@0C@a0C 01:U@UR!@80 00 0,< z8R'H00P 8D0!0:U@0C@a0C 01:U@UR!@0 00K0 8000L18 6 Q M80 004,K9P 80 I/!z< p70S0< `Q U00M@<0P00 @N0S`FZZJL0 ! 1R 0S C   j7<0SP0 )>?<0{S& 7D0! 0:Y@ 0C@a 0C 01:Y@030#R0S@80 00 0",< z8R$ `7D0! 0:Y@ 0C@a 0C 01:Y@YR!@0 00K0 800008 k5 Q M80 003,K8,K8@h KO- LM@ `RH0 0D0 700(0 0 '2 [8 0S S@ Sko8D0H 000<@0p'`7 0 (0 30 0D04` 0QQ3D0o0 g3(',  Q700 # 00M` 0H10 00K00P0]= Y2P@ 3704P 84K8` U00M` HPw6D0 008=0@ 004Kg8`0H  1C4` 1P0 0C 1T0 D0 1X0 X P0S0 3 #X0CaD0P 1SQoo 1 QC 00Mp 0D U<PPMP 0H  X6T00  0:Y@ 0C@a 0C 01:Y@YR!@ 08 S* 0h*VW 0@q4K7p4K7P U 00MP H 5Dp004K7P 0Q XS ڐ: ;+ b a  80K 0 000K- }2 QM 0 00@p1@P4K7 @5` H 0冀0CPL0 D0L  1!LS\ D Qo QMp 0  j\  UD00 0290PPMP0 HC 0P0X S'P"*0H 0C1C!0290qFV1P0 500 aS0#03 B0c00X0C 0 L0*S0D0\ 0\ 0B D00:21!1S*0 RB 0 P P0p0Z 0j H 0 3  D  3: \P0W0 0S0C #*X UT 4K6pk4K6Py l@ @#:;#3300 UPPMP0 CH04P0X S01'P"n4K6PV0 ;{!X 410X 0:R@0C @l 0C01:R@030# Q0S@8 V 0 @@(P(8V`80K0 0,D C1 QMH0@ S `0@CH00X 0X k4$4Kh6pDYp0I#30L00CL0 T0 Q 00ML0SKS@ K4 0W5 "i g4K@6L0 0D0L0L 0!P,0P0 @0L  ` 0 C#4P0 H@L0@0@ 0P C0 %0Z 0S C  @ 0D yL 0D`1W `RB 0 0RBW0 K0@-@QH L\?:o \0 PNA lҠ5 TPN l@D05 L+l\T^>  Q Q|QL\0dL\ l 0 30  ,$0S ,0" 0 (0 !S< 0 |$000! 004 t0P8 LЍZw ^4U~ ^1" P0$ S0 0  $ \C(PBPA@55 PC,b  @b $ R  R 0C(0000$000S{0@ 0000U 0 t 0 -1 U0t 0 ;t 0 50 0`0P>U 0 {4 0 u-1 U0ʽ4 0  4 0 U 0 T0 0 N-1 U0ʖ0 0 0 0 U 0 -, 0 '-1 U0o, 0 i, 0 U 0  0 -1 U0H 0 B 0 U0  .1U 0 'z0 00 O-TM` x$0R 0 ^PBQP1E 000000 ,0(004 ( ,p0e' @ 00@ ` PL| 040 @0@$0, `P;40{U0#40|0 0 | 0 08000|0H000 C  40P& 00 0  `( P4000 , 0 `$0P40{U| 0#80 04000@00 L@ 0 F0P0CD0H000 C  800( 0` 0Pi0, 8 0`$0P_80{U| 0#800%#0<00 < 0 80PD < 00 0  `( P8000 , 0 `$0P80{U| 0#L0$0%# 0800 8 0 L0P8  00 0  `( PjL000 , 0 `$0P^L0{U0#L0400400 4 0 00 D0H040PL0M0( 0` 0PA0H 0, $0`P7H0{U0#H0402400 {4 0 uD04 00PH0 00 0  `( PCH000 , 0 `$0P7H0{U0#H00 J 0 DH0PD |U$0  300S 40$ ,0(0 0 S 0 008 0!00|0P0## TЍ T3@^22^0 1aS0ʓ \00 0 \@(PBPAC55,P@,b  Cb 0 R$  R 0@(0000000 0 R0C,000U 0 | 0 6-1 U0| 0 &UC| 0 =| 0 U 0 @ 0 C-1 U0@ 0 3U@ 0  )@ 0 !U 0 T< 0 NH-1 U0ʖ< 0 8U< 0 .e< 0 _&U 0 #8 0 M-1 U0e8 0 _=Uʰ8 0 348 0 .+U 0 4 0 P-1 U044 0 .@U4 0 y64 0 .U 0 4 0 P-1 U04 0 @UN4 0 H64 0 .U 0  0 P-1 U0 0 @U 0 6 0 .U$0  _6.1U$0  , 1U $0 "| 0 00 .G-S p@P0` !X0 !Y 0 {E  0X 1 !*X0!oX0 `0WQ0 XW00WO-`(P!,p@ს `U 0P !T 1P00S V01@00SZ0  P"0 11PT0!Q 0  PO-@,Pჱp(`0   0 0 T1p3` 0 P  ET% 1`01S W@0 00SZ0  `0 11`T0 1!Q 0  `O-MP8@ᄡ1 00ᄑ1 010C10,0 }1 p 00 A0  0 04-0  0 1"0C !10 0 031 0100 00 0 0#SH 00 00H H0 H !H0HXB150 1P C!10 ᄁ0  1 00 0 0101*H0T# H0P#Wx000S  RB 0 RB 000S 0Q[PH0 0xH0!1C 01H0T19U*H*H0@@1 PL000 0*100C1Ѝ000S EXL0SC P@ 000S 01*H0@@1 PLP@ 000S UUUUO-$M@T0dၰ 0PX0  00H002  T  0P 10C 10 0  0$# 0 0100 0儑00    0P 0S!RB0 0  0  A0 D 0ST  0  P10C1 -0 00 0 030  0 { 0 N 0q2 0 0M0  d2 q0 t1!!!0 N0 0 P"0 00#[0L0 P0 !1001!P@ P0 !1001!P8 0 1 001P0 0S3 0$ЍO 0  PS 0 0UN QA G000S 000S  000S 000S 00@ 000:000S $ЍUUUU98A-Pp`@0 O-p 0,M ` P@201 0!0#2B10#R:0K$0000C0T0 00 0PB T0P 0 0P P0!1P 0PP0B1  0!000#1B10#R:T0 $00 0PB T0P 00P 0!PPB0  0 000D 0 0C 0P0

O-TM`x0|@p00 00H00000P0*1dL0H0S <0 " 02,020 0 0!d ! 1PB G0 00 0!1 (0P 0B1 : /0 $  ""!A 2#Q2:0$000 00C 00 00 0 1C0!PA!0$, 00 ! 1PB  2#2B02#R:0 00l(0C 0 PB 0 0 0](0 0PA E AQ P@ 0 1001 2#3B02#R:0 005 0 PB 0 !!101400<00 000 10C10(0000(0( 0#2B00#R:00D0<00C8008 00800C PA 000C00 60  0< 0( 00C$00$ 0C00!0,00#1B10#R:8 0D, II0I @0PB0  0 0  0<  0p0!0 00#3B10#Ru:8 0D p@0@ 0PC 00C00  0  (0 0808<0L 00! B! 4V 5Q,: L : 0 099 8  ;z 01?3 1 ?# 0 x  0  `$0 01$ 0 000$0  0 0 >0  00 5 8  8  .0 0 t8 W8  t 6  ?  ?0 00  0   0  0 ,01C0!!!0  0N010 01 1100  0  1110 0 `01!00P00#S,0U0j Th, !!0 RB  RB $0 RB 0SC  RB 0 RB  RB 0 RB  RB 00 RB 10SC @,0 RB a RB k 0 RB , ! !R0; , U40  a 00 r/0` 101**0P0 %$0 0$00 1$0Y*$0S0" T $0, !!0T0T0000S $Q05 P/0 a00 (0`0( 00%*P0 0`11_*40S0$ T"4 !!0$0T0T08 08 00S 4 ! !R0: 4 R30 Q 00 (0P0( 00** P0d% !0H 0R!"f* S M QJ  4 !!0T0T00 00 00S 7* S  T  Q & S P 0 0Ta09!0 0!:  R TЍ  T T 0xTЍO Q Q S Q  3-|< ĿwSYUS q5L198p@-`P@0!000p8000S pO-,M`p0T0P00X@Q0D  Q:0 PU0P00,ЍO 000 PE!0P !0S1P00S T 000:000S ,Ѝ11P0S0 P@,ЍO0P1 00UXC! 0 P ! U 100S T; 000: 000S 00U0# C  0[P ! UW 100S X 101: 000S 0  1 1 U 1 1 U0B0U) Cቡ 0 ?P ! U# 1SC W 01! !0#S10$00UpmU4 1 1 U 000S 0p C  0P ! Ue 1SC XZ"0 0   0#SUqmUp[00QPR $0pq0  00C 000*0 p 00WG 00!Q0C0P C0 W 0RB 1 1 Uʡ 000S 0@ 0Y0$ 0p $0ppG 0UpG W01  0#S  000S 0eP 1U pRB 0 q0 Lp01 pp0#Sl  000S e 000S qq0 00P C e0S C _ T  0$0P/LP/P/0S@-@O-Q00$MPH@pC Q.ڈY `$ЍO `F0 !P !YA1`00S T 000:000S $Ѝ11`Y k 0 !0:000S `V100!H! 0 {P ! V 100S T 000: 000S 0 V 00ს 0H0t0P Vk!0RB W`0 01 ! 0#S!X1mV_000  RPS 0q0 X00C 000}*0YpG 0%!a0I0P C0 MWK 0RB D 1 1 Vu!!0Vʛ 000S @Z( pv01  0#S  000S 0 P 1V pRB  uq0 01 0#Su  000S n 000S zq0 0P C 0S C   mV0;P/dP/P/0S@-@8<O-TMAP00x0,0Bx 00S 0x00 00 0C0  0 0 0D0SAZ080 0R0(00 1D001$0 00C0H0 00C@001L0014000D<00@0C00<$000S 03#r$ 0P< 000S000000S 0S C 00 (00C(01  I[X*T0S C 0 (TЍ 0RB RL!H B@DH`FpG 0RB R0S x0 `CpBpF,0`FqX00,1 0P C HpG0QAPT0S C 0 R 0RB F 0@DgoO-,MAPP` D 00SJ!P 0 0 ?00 0F0100I 00I$00I`100I100D00 0 0S0 ?#`,Ѝ0 V J  R 0 @`0@#0 00C 0T!@ ;cPR 0$U \@ @D0l 0pP[ 030#\0S 0W P@p 0wWpG0#p03U`E* $0@D``O-4MpPX0A`BX 0S BX0X0qD0SJ!P 0X0 0 010X00C0(0X00C$0Q01,001000D0X0@0F 00000S 03#r 0   000S00S  <$8 B 0, T J  S X 0`@0`#000C0\!` 5c R0&X \` `F0l 0U 030# [0S 0Y` 0YI0#03X@H* $0`F@ @ Sᑢ" K0`0 T@ 0P0 0:0 `@0p`#000C0 J 0R0X S`b a( p\0 TS 00SO 0 000@0`X`\0#0` 5c R0&X \` `F0l 0U 030# [0S 0Y` 0LYI0#03X@H*0 `F@0~@000 00\ 0%b P C^ Q00Ca  @ U 3#[Q RP0@  4ЍÊO-`\"  $MH28 P0  Q0(0 00,0 DMp8  000@F Q8M000 0 0000040 S0S0  0@  0=Z  0P`VJ80!1R  Z /,KW p,KS 0 000S C  Y 00 DT !  RB Y DT !Ng 0T040 40J,P 7 4 ,0 0 (0 30  KY"xW"O-PÀC`@XMp!J80 000 b 0  < @< 0  0S 0 0000S.T!G80 0@00 : 0< @< 00S 0  zY/ Ѝ<0 080000S C 0  0  0B 00800C0QAX0<0 08000z0S C 0  0 I0QATO- DMP `(&0p @0 6P00(0 00,0 1T0  Sm00M080 P0@CU q1X@ @DU1T Bc0G00 T0\ < 0c!4 H0 00e00SJ!P 0 <0000H 0<0 L 0<RQ2L0 @m\0AP0X @C00 %'40H @D0 40 8040@000T0TpG,P  X$P4 0 (0 30  f,K 8 @@<!b\ tPp^@@D a< p< R  3 #S R <@ X0pUDp 00L0 EXH0#03 GD W0  *L0ETJ @D@D <000D0 00D  T=0 H40 BaU| EY04 40 @8X00H 08 :Zp 00 D 00pW[ 4040S C 0 % 0J 0pG< T00 @040@00 8040@00070QAT01GTG!H40 ?@0 0@00 U/ EX0@ 8  0 40!pC08 0 Z 4 0D0 00000 00S 0S C 0  0J 0000C80 0@0000QAT0 KT"R"O-MpCP@W !<80 0p00 1@`<0  0< 0  xV 0 0o0000S 0!1T480 0@00 P / !|[Ѝ<0 08000|0S C 0  0`F 0  00C0QAW0<0 08000O- DML p\%0 80 P5H 0@0(0 0L0aC TP140 1@0 PP PET JUX XH 1c4 B@000M0<0 @0d0cD0 00SJ!P 00 000 40 040 40RQ+D0 PkH0X Q%KPC@0P`cU<0PE 080aJI00 #3 0 (0 30 g8P4!b\ eP`^PPE a4 `4 R  3 #S R 4P X0`T D` D0 D0T0 0TXH0# 03V FD *T0D HD 4000D0 00U0CPE00 D00 U?`F0` I f T0 `DV`0P <  0 ]@0< I0@004 S E0 640040 40Sa 0S C 0 & 00 0B 00 0400CU 80 0P00 <0 08000;0QAU0<0 @080 00IPE#&4 1A00Z M!@ 800P00 0 HM008000/0 KL"J"O-L2̠Ì3@00@@@@-#p@-@,PrHPPp0 0#t+"[Ip@-P8`@J`Pp 0 0"$+"p[808 0p@-@0P03/0P0p*"Hp@-(@@Pp0P003/*"G-\P \L0p7//o7rzW` ЍW`Q ЍGnW0O(ODDSp3p000 w 1?oX20D0C0W Spp00H0S0 ^ 1ЍG!UUUU33338ğ84 O- 4M0@0(0 0Uo#oFR` 0S f#3 0 (0 30 ϶UPeS QP 0Sϳ U0pPS@³@  O V0 ,0  0`S@᮳@ 0 S  J8 B!4 8 3?BQE?oq00  Wp00M00 Sk p༼0SPE 0 S J< B!@ < 3?B!F?o` YVMpH0 SD S D H0Q BKQ@040 0`0S`1`!UB1E1Q=*P0 40VP< 1@ f132SX0:04 R%  0 @P 0,PB @,K ,K$Kp$KH0D  0  lQ0X004 R  | WQ0 K("|("2O-" 0$M 00 p2@0 0(0 00_"Ï#_EÏHUP @X 0"X <0 R`IJ`0 0-<0PPSPeP"1 0 (0 30t 0R`@, 40 = R@ ZV8  00! @ 80 2/00l!00 0 2/@ VC e 401C<0oS40C@Y 0  008 03/,P V Q M`Z ,K`Z QM  ,K 0 ᇻ K$"$"#"HO- H4MDşpS< 8U P( 0S<0 <0 $4 0 (0 300 R 00H0 <0O"OD R 2o 2)S 40a @D 40 TD @ 0 p S:@ RY b9"@@ @ T0Y i!39 0K#K/o"bP, 30\ 00S `  X00M`Y  (1D14K ` 0 Ⱥ0S@DD Q``b`<  Q< <80 儱80D QR?PWD0% To` Q7M`oT h8 R @P`08 r*Y  0ŹP4P @0S  WPD0 H0S b%80  O8080 4K80`L0   80BQBL0  ᎹL0P8 P` B8  0"01#8  0# 0P`80s   1B1SB803 @ 0 8P00D0`P800C80 0P` K!"!" :c\#3 Jl \0"L 0 00R # 30Cb0 O-M 1C`8@ Up p3p# TpW 0ZpM0:U@0C  @ b 0C 01:U@030#T0S@ 0H! SXV `FV-Ѝ! l  :R.[  P Nl  U  3 # T R Z 0C1 ct0 Y 0R @ l  U 030# T0S 0Z00 p@-  @Tp0Q`CN00000 U @!@-@Q0P@ Q T TM0 !SO-@pbP9FU`f  # 0 0  P0P1  0#S00Y13  8000S ;   000S CU  00  ᯷VP PP@000S 8 P0U C0  :PP޶  V1U C0! 200c11[ C0!3 10C1S000S 0 010 00SWP0QAVP0QA S0 0RB S 0 00SW0O-$M X0$0 40P 0000L@HPX(`D@Xp1 00 ?1P`FV(YG V20P0 #3U^Q V01PP0p`1 000C0VT " Y0  P 0)PE0 P 1X `RB 0V0PE0 P !X0`00S 00 00SX0PeU 0X0QA 0 ỵP !X 1`SC U  HX!  U 000! #w:X 0 00S n 0T!P0T0[0 @D00X  0  P0RT0` pZ H!K0s  KP 8 (0 0 0 30 $Ѝ"RDVD "A-PpAL`HF D /0008000S p@-PA` @@0D   @DA0RCp0S C pO-$MHPQ@10A` Z0!!00!R  BRA   b!P 0  BaQ  !$Ѝ \LU   RU 0䇰`00 !q ! Z0!0 0 _0 qQO-P0p@A` 0 x 0ᗴ0!R BRA  b!P 0  BaQ  ! Ѝ T  \L T   R `Ⴀp p 0 Z 0"0 0 ,0 p01!00S0R/\=O-|M`p0@ 80+0 40;($0紀0t00@0@300@000 7D040P0D00S,` 40 008D080,0,0pVe?m?T<0),00F?o2H00pT0C<0 *  넢 Z RT < Z S‚ H0@ `HT*  Z7pL00  X  \ ` `0P 1d0  0W| 2<070h01l000 StpP 40D 00040@ 80#b0sC'00 0C<0<@02(Gp00St0<  0D0p0 !wI 04 `K Rʂ  M0 1Rʂ  M0 Rʂ͌ M0-; R b11100M0 3K8!!O-@8p0P @0  ;0@Pp\ p `   "@P0Q01o l13<HK$KXS00 0L0 K!X!O-Mp<P@`0@V0E!R`F!R@DTV&00SZX Ѝ!Q 0pPVX)0 8 100S U V 1 1 TkV00SZX800 0 0Q:3a /Q0#03- AQ0#030AR 00c 0 A O-,MP"P0 02XP00$00Pp@QP 0TpW@`~0UXPy`W 8:Wl W*$H%XHX@DTc:U ` /* @0Tk&0)0U:"#` 0TpW@KX ` *P 0_ p@Wk&);# `W5 X*$H%XHXPEU,:T * fP0U㓶+0*0:f"#0UXPX @ 0( PX㖰+*f#  0@ 0 (0 0 $0 30 O,Ѝ!|!G- Pp0  Ἢ0 @ ڪ@ 0ᰪ0` ΪA@TP/0@ 3@ ?o 0c /O-@!O-@X)|ML P 8) t ,0> 009003/ A`,040d00%8pP  ,0 000#(@`0 $P H  L %d0 \ 0 0R BZPjRJDB?m6]MH&@PM<K6 08  @00<0R0 D0P T0\0FT ,0000,0i@6 0,0j@D T#!!ZTV 00 04 3/p P,0 , V 00 04 3/pPSP,0 ,  ,p  B?!?CSQh 0cl08P0CV 00 04 3/p P,08 , ]0@8  `= 4003/v P,0`40 08040@00<0T0Sq0X0mV 00 04 3/p Pw, 0 ,  8 p P0 08030@00<00\0hTH@h@KlTL@l@Gl0l@0CV 00 04 3/pl P,0ZT , L T( F@D T T񏐟#$$&3tTgTh@D T񏐋 zT|PzwPuPs?P0o ,  Rj PR bRe  B!6_ [X0800S0P0tTiTQT& LT NT ,00000T0` 0L00PP000,0 ,  0[S 0cL d0?P00[0000H0L0S0 00C 2"0$0  "$0   0S 04 3/p P 0S 3/p `0003/T 00 0 t0 30 ߚ|Ѝ!!Hr?g!O-|MPp80`6&0 406X00t00 S 4600#?"?C0C2È0S S0 X0 P64?"?C0\0#S0DB(<( 0<0@(0D0-S$ @@(0(  0$0 $0 0S0,00S S yX00 SBX Dȏȱ @CQJ T:ZP Zjr  0 0 0 B W B7 B @RT4  s0R@Dട  s 0 B W B7 B Z   @DT 10@0D00D0D0S20c000 $000 0S 0S00000H?00s 00S 8;0S Sp 6 0S0 Se sf +S 0C00 @D0 0XTH?oT 20* 0H I @DS Y+0-0YiŴ 00 ,0 0 00 0 0 00 0, 0B000,000S#,0S"00 3/p4 h2<0(03/T"42 0 t0 30 0 0,0$0S 0 $3/p Y 0 3/p ,0S00 3/p 0 3/p 0S 00 3/p 0S 0 83/p 0S 00 3/p T  0 3/p 0S 00 3/p 0S 0H 3/p{ ,0Sx00 3/pp oD@|ЍD!@!T)0!DO-P(0p$M@-[`P0[ 00RTP0x:/4 0R % Q Q q h \ Q R 0R   0R R   D / , 0B 0C 0C 0C0C00 00S 0S@0 3/p@@$Ѝ0 0@[ 0 3/p @Y 0 3/p @0S00 3/p @ 0S0 3/p @ 0R  I 3/p 0 @ 0C0 03/p @ P0 3/p 0@S0 3/p @*X@0S 0 /p@-`@T @DPT@! 300000C0pp@-`@T @DPT@! <00000C0pG-p!@ 1T@0 000p `0pP" 0@DT 1 !0C0000T@0@03/p0 `d0P003/0DS @ ,0 0 0 30 ėЍ8! !HP!0/0@-@30@-@P<p@-P@g'9@@p?! ?C00S0Q00c0/O-po0i4`@0 Py[ KPAW 0 P Ѝ P] 1B1SB0[K39P 0Ӝ P0I@`O- TM8 0Px%U@0 p5 0T0 d5\ 00(0 0@0 0D0 @0@0P0 C$UJ>U@ 50H0 5T `0e#0X0 @0X00C20 JR!80S0L0 T 0L0 4003/8 T,\0@80@L0S  S Tp480L03/8 X$@4 0 (0 30 u $u0eP4040 4 P0H0 C000  QJ00M0<0 0Te&@d0*VaT@DD01@D0 p QM0KHP 0qRpHX刂(V,`   0,K T 0D0 @ D 1H1SHP0@D,0T ZD0  G H-D0 C!1 0H !<`@ P<0 0U 0r0s0U0P<0` P@1 @!T < 0D Ri @0 80/0Sd00\0`@00S-0@8 0µ0PD B0K< qP X`B"X P, 00P0 ,0`F` QM0V1D P0 Q0KX0 ,K P 0K`0  {1`0MP0 00@螥P0<0F!R0 X0`w@<H0080 8 K(!$!}TH!e IO-ph! d1MP YiZ0j Y0(0 000+WQ @I,0 @2 Q+0M`0  0FT)P 0SᲒ / 0,2@dBP@ 8p h0 0 (0 30 ,K`0S`ᒒ!R@D Kh!|!O-P0" Mt U@ ( l$Us>U@ TEp#Yu !I ""!/)/Bo`! %"`  L 2Yppp!4 00  2/00@4Y`- i ƴ ,  QHM  0 0 0> P0R:00,P W  F  W 0003/@ 0 0 (0 30# u $u eP ꐠ ꈠ P   p00 ,Km00@ K!ܢ!YTH,!D0p@-SO!P`OD̑0T@0V0c0p$0G-bSqpBP@P`0S0P P0/%/B2# 0S0c020003/@ 60S00S /0 0  6 X  R ,00G0/@!THA-PQ@` 0ppe`SfpUPP 0PS Z``V``O-`"M1PQ @0000 p0 7U#1EAV@DU PEU !1 0 0 30Z !1PE@ 6cR # 3 @V@D @h0 @ U2!EA1V0@PU 0PEo hh:UH 0 FdS0#030@V@D4HPE :K0FdY#3 VI @u 0"Ѝ(!ĝ!0-\@P@ l @dQ 0PA ̃0 ̀20:Wp@-@ooV\V0eA  f&0!3& 00Q#3036 0pC-AAQ`FPQPP 0`>3\030#0LE0 nS0#0300R0C3VA@✇ Pp@-PooF 0fA&0#b1600 B BS0#03003& 00R # 3 0360pO-P@ d) Q03̠ AA5 `➗0A``Q03̠Č4 2cP#3R@0 ЍA1`癅A ➇`哞 0-@1 c`s  R:1`1` R 16|p s`18|p `s R6|p s`6|p4 O-M8ŸO T (`" U@ Iq $P4Y(0 S80_ PPE BQc <7!1 0 3 30W p  0 f>>  !#RI$   D!D D"""ΠT" @D11c0d0$ 0 po0Y(0S 22c0d0 0  +>> !0#DRI$   T@ߍ!!ʚ;d!TO-MPpD@`S`F S5 $ @  ЍOR@[!@C   RJQ 0 0 @ᕡW 0pG 0D!`R0! pP 0 O-ЍO-` @SMqPPp@' F-1  06# 1D?o~`2c@D22bR A0 L0C 0CS0@TJc 00ÌPB!1 0 2 307 &T`P@@  00p 0   020 `ᱜ J  0  w'0pG``BP@ P ߍ萔!p!T!P/@0/?? ?C/o03A-@ 0P00J  PRU^_P!>//o. N 0>"5o`   %WL0 . fP2V<&0R S_  3/ 0# 0C/o03" @- RZ >AT  4@-@ 0 T @$QPÀЁ/O-DMl0`h@0p0|P0t0UT 0x0 ,00 00$010 0qP0100  @T-0 P ,0 P 0 P 0 P$0  ᵕ0 $0宕0[DЍ` 0@ ؖ,0@ Җ 0@ ̖ 0 @1Tp 0Pp0@!0 8 0!0 0 0    0O1 0(00P<00 D010P$0 0 \040T 0  ! 00 P @00  0C000C00,0 <0 T0# 0#<0P0@0  d00800C 00 S0   0P080 T00@0  C(00S 1 000  $ 0R0  00S  0 0T00 0 $0S0  0 @0 0 0@<00 0 0@ UP 0  0  0,᳔ 0 Ut80 00 40 0 0@0 S0c 0  S0] DЍO莔ꍔ(000S0 ᦔ00C00$00  U04$0 oR UP0 0 b ^000i 0 0S0 v 0 00C0d)a0 @c @(0( 000c8 0XDЍOT-A R^ B O-PP!pL1,M `P@0T0$001@!0S\N00 000$0N\0 oN l1 ;3,̠>:P   h H`0  4 (0 0 $0 30 ,Ѝ !@!O- Mp0P$@`!  (  Q , 2M0  0 0T@DݔT 0 P 1U @RB ,P `FU1S L D0 0 (0 30 \,KPE K與!!O-%@5  LM0p0(0 00AP0H!R@!RAQ`8K P0S3^.0C ^0CS0 U40< @0 00D0 @0 SD00 000^@<P $4 0 (0 30 00S@0 0 00080H0 ,0H L0 D0 @0AS0L 0A@ @QS0P0 0VP 0P 0 QM`1TX0 1T0 :@D!0 ҒP !U000S 000: 000S X 0 ൒P !U0@00S 000: 000S @T0 0L00000T0  0@00 000L0PJ@0PP0 ្0P C PT0  0D00000P T0 0H00000wD0P9H0P?0 s0P C ?P P00C!@0C <K`XL0 ES  B!|(@0 ES  B!r(0 RB D0 ES  B!a(H0@ES @D!W(0 RB  W 9 KH!!p@-@`@PT@@DTppO-MS@8`<p  PC  0 P%0< 8ЍO  41 0  . 0  000P 0 ЍO?ЍP/0@!3@ ?o 0c /O-0D0CS, D0 = D00!PA0SC 0< 0 @1,00000<0CX_,0 00!PAR0SC L@B°a 090 "T0 @ 0  0  LȽ0 100@00λ@P00S *0!QA*0SC !Q 00W!LЍPp@-@@@`0P"U0ዽ0 U0V00@TpP@"U0v0 U0T00SO- P0@p`$0 TQ(0T P5Qd'05D 0 A   U0 b p 06 U0 U0  ЍO(@0 @0 I-SM 5 0 0 0 30' @p0`$0  QMP$KdP<T P0 $P h@ 09 KKd!d!O-P!Cp0Wa  G0@G " `RW@A` Ѝ 0  2 ` B@-@᳼T 00@S00O-|"Px2|M `lp0 @0t002TT0VT0,2 0 c0c0B0 @0@@@! 0 @0  B0S R0c0 ᘊR T T!D1 0 t0 30G $; K 0` T0SC A D X0 R00R 0RQA0 XI0!H0S X0c0  GX @|Ѝc!b!a!O-p(P@ `B V0, P`F 0a@#@3@0ޓ/ԕ$0$ 0@-@000_!t@-@f@-00@0P@` 0 @ @6/00S00ЍpP/$0$ 0@-@000_!|@-@6A-p` 0P$@XPP P0P 0p@-P@PpP0 000pA-P@`pPW0 0A/>>A-@P(M(ЍP`0p 0000 00$00 P0  @08/P 0S !  R 0S QUTPu 0 @ @04///$0$ 0@-@000\!$0$ 0@-@000`\!@-@@-@@->4@P@ 00000 0p[!@-4@P@y 00000 0[[!(8p@-@PP0D S S000pP00P 0\ P: 0 Q0 00s#`s#Ts#p@-@PP0S@0300T SB\  @ @0 @pr#0r#@-@@P100r#@-@0P0P |0 @ 0P 0P*@-uq#x@-0Px0Pgx ]40 P  P*@-W(q#-K0GS0NS0US0CS 0CS 0+S0+SP//A-P0`,A GS@0NS0US0CS 0FS 0OS0RSQ0  0|S"\#Q 0B 0x0CQX  @ 003/P 0pp00008/Pp00Ѝ0@0W!@-@  DP 000S00 0S @- R @mP 00C0S00GS0NS0US0CS 0CS 0+S0+SP//$/p@-@P  DPU  0S0c0 00U0C0P$PGp@-a R @P 0S000S00@GsV@-LP@-F/$0$ 0@-@000xT!/ / @-@@-@/@-@v/@-@m//@-L0S!@@-L0S!@0 - 2 00 - 2 R@20PP@-@` 0Pp S+$ !#%$#"\ p0Sp ЍP0 p 0R  R ` @-@R PR/Jp@-@P`0 p@s@-`P@P kJ Q 0 0S000 o00h00 000b000Ѝp@- 000 F ЍO-TM0`$00S@p S S+0 JP TЍ P U0 08@``80 FV 0(P,X` [!JP (, L`@P PEH0SP [ $`  $`(P,0M0XM 0SM 00N480 (0SH ,0S04PX<0UPEH0PX Uu 00+ G00N00U00C00F00O00R00000 0000400 ,QP +LP$ 0S񏐂!0SX0 0$0 D0b@4Q T( $0 NP" ,P   aD0T/o" ?RQ $0PE40Q 0 +P 0PUK 0P1S0 0PUk.[:U L D0@1!R$(` ,#4@04` `E`04P E`04 ~E[2` 0僰 /P@- @l 0A[0D/ BQR[t0S 3/@l0@o/0P/ /0 0/M Ѝ/0S/0C[/R[/0@-S0@ @-@0S/@-[@ CAPQ[t0S 3/!007@-P@0 0 垲 Ѝ0/o/ 04MR   Ѝ/hI!0x/@-@jQ 0GS!0NS"0US#0CS$0CS %0+S &0+S'0Sx00p@-PP@PE[?0/R[ PU2 G0 0N0!0U0"0C0#0$0+0%0&00'0(00(0 000F @-0/$40P0, ( 0[/R[/G!<0 00[/lG!@-@-0/40P0, ( 0[/R[/0G!0 00[/F!@-P@-(0A[/ BPR[0X@S 3/@Bp@-Px@t PplG0X0DN0W0DU0V0DC0U0DDT0D+0S0DR0D 0QPD0P0p4p@-@P`0 00@0(0BF@-0 S  ! GR! NR" UR# CR$ CR % +R& +R' R b  @)Fg/$0$ 0@-@000D!@-@@-0[PP70@0`V|P 0S<0- @v0 0[?S/R[ S  S [? S/R[ S S 0` o ЍD!X<T0P 000S 00/[/P[/1 jodC!P0L 00 0S /[?P[/1RoC!$0$ 0@-@000B!@-@0 0000/PB!@- "@0D^!1@Q Q Q00#&" 0N#<# "0("0$"[0S/ " 0[0/R[/Y#0[/Y#/$0$ 0@-@000 8A!P@-@A-Pl0U`@0p P P  00A/ 0 03/ p@!\$0$ 0@-@000A@@!@-@ A-`pP@X  0 0A/SP O-P(@,0p4`DP U@Z@@ @Ѝu0 0 T  .Pp 04`0,(@0ЍO/A-p@P`P 00A////@-@Q 0*S @-0*So//$0$ 0@-@000=!l@-@O-@0pPR `AVP  0 C$ w C$ 0 0;/PY Ѝ`F@D0@-Q @\0~ 0@/0O-DMtPp 0p 00h0SlP00  |P h0W000h0pp0Spp pYw0 0Wp0$0C00 0 00100S$ 00$0? 0 00 h<A40 , h0004A480\ \ #3\ w  , pl@ 04/408`0S,0000 `0DЍ X R 0 QS0  0 R: S00 000SZS@@t@T @Q& 0# T V2 0/ p0 0l0,@VT$ 0! p0, 0l0`ST@3V`30&SV,0@0000 @@``V0 00 00$000C000C7}O-,Mp@PPO `Fa0 000zPPUP> 0      $J`FX  C$Q C$ 0P05/PP $ 0 R00 S0/o$00"S R00Q0Q 0,Ѝ 00 S 0000S 0 00$QP P<1s@-04! Q(@  ?5P+ P 0*S00P04`0Sܻػ0SA Q003/PdǻXΏ 4(O#6!nXn4Kn n0 S Q 0 0 00000/0000/Q/   0 0/P/0 00/0 0P /000/0 0 / 0 R  \0 Q0 00/0  R  \0 Q 00 0/ 0S 0S/0 R S/0 0R  R / R  R/ R/0G-P 0@P0 00 U 0Sp0S  0S @S Rpp * 0S@0pu R`0S R Qpp 0S@]0pi`@ G-R @Pp- TU 0QS `$ S0   V ` @@ 0 R0  Q0 0   0SJ`@V@0S` 0 R` `0S  0S00 0 0S 0S0S0 0 0 0S `P= 0S 0  0R QS Q0`@0S V 0S 00S 0S0 000 0 0 0 S V0S 0 0R QS Q S 0S0 0000 00 S 0P RS/0/@-@ [20/10 Ѝʚ;@-@ K20/10 Ѝʚ;P/@-@03/T@-h@@0[,P DD8 88 D~ @NE#E#d2!8E#<0@-@TE#p@-$PP"@p@8E#P @   /@-@@- @-@P @2p@-@0P00PXp@YD#D#p@-P`n 00@0 0`0 0p\2T@- Ѝt0P0A- P@ A` Pp &[ P P\+!c@p@-@QP`  p7@- @APKPF Ѝ0 Z (0( 0@-@000X*!P@-@ , , (0 0 00/*!P@@-@(0( 0@-@000)!t@-@ , , (0 0 00/T)!t@@-@<0< 0@-@0 00~ Ѝ(!Pp@-@P0P000p(!p@-@P0P000ph(!p@-@P0P000p4(!$p@-@P0P000p(!x<0< 0@-@0 007Ѝ'!tp@-@P0P000p'!p@-@P0P000pL'!Lp@-@P0P000p'!@-@ y0 00 00/&!@@-@@-@ Ѝ@-@@-@ @-@ 0 0 0 00/,&!@@-@*07@-P 0@3/ 2G Ѝ0A-p`P@A P P@000E0 0 @$ @-(@0$ 0C@ 00 Ѝ%!//s@-`P P@   1Ѝp1!@-p` P@  ` 1 Ѝ1@-@@-@@ @-@s@-`P P@   v1Ѝp1@-p` P@  `| Y1 Ѝ1@-@@ s@-`P P@  l 91Ѝp1u@-p` P@s  S`? m1 Ѝi1X}@-@@ s@-`P P@\  / a1Ѝp]18)@-p` P@C  ` D1 Ѝ@1@@-@@ s@-`P P@,   81Ѝp415@-p` P@  ` 1 Ѝ1@-@@ s@-`P P@   O0ЍpK0A@-p` P@  ` e20 Ѝ.0@-@y@-@@ @-@ms@-`P P@  s >%0Ѝp!0z1@-p` P@  Z`D !0 Ѝ0]@-@@ s@-`P P@  6 /Ѝp/==@-p` P@  ` / Ѝ/ }@-@@ s@-`P P@k   /Ѝp/I@-p` P@R  ` / Ѝ/@@-@@ 0R /0 Q /// @//0 /00 0S/! @- VW A AQ/!@-0 0CQ1!/0S 0Q//R0-0R/R0-0R/ 0S /S/  B B@/ 0 0/`!@0 00 00/D!@ 0 0 0 00/!@ 0 0 0 00/!@/0 /@-@00//0 /@-@00/0 /0 //0/0 o// Q:@-/Q/ 00C/A-`H @p P< @@DT@!T  YQ///G-PS`p Q* ЍQ0eA0Q: @P  P D H 0p@-P@`&0 p@@-@ R*0 AP@ЍA-p @S @D`TP@! P T0D@@ 0p@-P@`0 p@ 0S 0CS 10 B\/r/A-p`P@U 0T * P @@ 0p@-P@`0 p@A-p @TS@ @D`TP@! `P@T* 0p@-P@`0 p@A-Pp`@ T:@ ;P @ 0p@-P@`n0 p@0  P:/ R/A-p @T@ @DPT`@!  P @T* 0p@-P@`>0 p@0 P @P! R/@p//p@- P @T 1 !PEpA-`L @Pp  @@DT@! `V 1 !PDnLG-@tpЂ P `  P @PE@DUP! T @!T 1 !PELA-Pp `@P 1 !PFA-PT @`p  @@DT@!PP 1 !wPDFKA-`L @pP  @@DT@!T 1 !_PDJ 0 0/t!@/p@-@P @P 0 @ 0P   0 p@-@@-@[P/00/00/ 0 00P00 0/!@ /p@-hP@0P@10 ST S0J@D1T@! ℐ@   ZRIT0A-PP0 p @` @ @ @!@ @-@@-@ A-PA` p@  9+p0p 0 P/` 00S  -[?C^S[0S C /!@@-@ @Ѝ7@-@HP @PUP  @$00 00 Ѝ0 @ Ѝ0@Q8!@O-P`CM p@0X pG#0 IT0    0W     @ @ЍO @PW V  ` P0P 0@-@0 @PP 0 0   !@@-@ @P@@-@@-@@-@0 @-@p@-P@p@-@0p@-@ PPEp0p@- Q:P@pKDp@-P8 @` 0 0 BR !Np 0 A0 p@-P@A0>00p R 0p@-P@A000  p/A-@P0pP`0 0 T  C0@-  Ѝ @-@s@-P, `@ `0 Ѝp=C07@-P@A0  00 Ѝ0A-P@ @p `i0 0 BR !AE - B A@-00 ЍA-`p@P0W  hs@-`0@P0 BOP P0 @Ѝp @P0FU A @S  AB@-0@ЍA-`@ @p P0 0 CR !AAp@-P@ p@M0ЍA-@耟p`P 0 P p0 x@Ѝ @s P0F0'`0`S Q: PE  Gu@M AЍG-@`@ p  P0  0LS0!GU?0@- 000 Ѝp@-P`@0 p@X0X 0 P H 00S0000[/R[ /\!@p@-@ 0 P `R lps@-@PQ @P P 0 A` @U`Ѝp0A-@ pW ` P0PU0  8 @ @PA-p ` P0 @@DT@!T P0PU0    @ @P; A-pR@% 0P0 `0`V PE~PP @lP0  @lh: M0Ѝp@-P@ p@M0ЍA-PQ@ x0p 0 `0`V>0  @3 @#P9 0A-@ `pD0 P0nTD A( Ad: p@-@` P0PU 0 `p@ @ @P@-@s@-@ @R *`  @P @NPЍp @PQЍp@@-p@-@PPp@ p@@-@  @Ѝ@-@0 @Ѝs@-@0S P  @` @`Ѝp/@-@P` p0  y Ѝs@-P`@0 i {`Ѝpp@-@PmRp`0Q0A- AP`P @p 9 @ @ @@-@ 04P  P z@-0 /@ 5@A-@P8 p` L0  6@-@ 0A-@T P` p, 00CS@@06A-@X P` p 00CS@@0Ѝ5p@-P@( ` 0pS54P  P @-m0 /d 3@@-@ 0G-@<0p P 0  ` 0`F V `!P 00 ЍGd @cP0P  U* 0  0 J@ ЍP PEPPE0  C6 0@-  ЍG-p @L P` $l0 0 B R  G05 @-P`p@ 0 } Ѝ B Aw0@-  Ѝ@-P`p@i 0  Ѝ-L BAX-L BAOM0 Ѝ-L BA?-L BA6@-@ 0@-@ 0Ѝp@-@QP`  0 p0@o/0@o/ @-@404 0@-@000 Pp@-@P0P000p p@-@P0P000pL p@-@P0P000p $p@-@P0P000p x404 0@-@000D= tp@-@P0P000pl p@-@P0P000p8 Lp@-@P0P000p -pH-|P M@Pr  00M00 `@e 0 0  /(.$0$ 0@-@0004 ,@-@y$G-@S Mp@D`H@0 [ ЍT1 P00SV1Z 0100 !00w[p 40nS &S0 0 [0/Z00U`P`0S @?㓑iY@P0000 00@[p40nS@ # #ɚ;ʚ;G-@S Mp@D`H@0 ([ ЍL1 P00SV1Z 0100 00 [p N40nS &S0 0 3#0 Z00U`P`0S @Y@BT0EU0@0EE0 00Zp40nS # #ɚ;ʚ;1 Z/*0 B@-@0000R P@80(^G*B*O*]*b0@-@000+  @-@a#$0$ 0@-@000$ @-@M#@-P@@0[ P , ,, #H (_!_!     / 404 0@-@0000S   @-@#0 0008 ,p@-@Px0U0 P ` 00S0 C  [?Cς\[S0 03/"p  00@-SM 0  0S, [Q^[0 0 P@S0NЍ00S P  [?QS 6 0#0 Qp@-P0Q@ 00@J z &  pt 0 A T 0C0 0!0C2 2S@R0 J g g&{:0 @+(p@-P @0 S" R  S`01:g Z g PF&  0{Q100p !7&  000@-20@/ s@-`/oV" R \M0F@0SP00 i0 0Ѝpf p@-00P@000P tPOp 00p<P ( *(((((0@-@MPhP 0000C S \ @00 Ѝ0@Ѝ0(>0@-M @P00yЍ00S/@-@Q00000s@-S@ Ѝp@/P` O0PPU`Ѝps10S '0S0/0 Ѝ@-P0 VP0S S 00z RpH-@d0K`@DtMi 7 p  Mh P/  @h* 0h0b 'H-dpM0 p @ P>.f``l` V @DT@ 0d  KޟAA-pP@ R) T*%R sR zR %RP    BQ T uRH` P@P0PD 0s@-00P`  U  R T0S@00 0 0Ѝp&    /@-@0 s@-`   Q  R \0S@Pu00 0 0Ѝpj @-@@-@@-@o0 @-\  @\@ 00 000p@-@PQU  R v0 0 000p P P 0R/+ //////0  /0Co/0@-s@SS*p10Z@"0P/  //00Q/ @-N AAQ/!@-e0CQ1!/0S 0Q//R /R0-0R/0S /S/ yQ7@-@P 00Q  0 0 Ѝ0 B B@/P/0@-@ `PR  R*Pmp0p0U  0 P ЍG-p(`P0@ F C0  R  IU  WV  Y  PyI00Ѝp@-@P  R00U00S 0f0 0C0p   /   /0@-@0cp@-@`P0V000 0`0000pp@-P@0Q  0 0000p00000000@-@@-@Hp@-@0PQU  R 0 0 000p0 P0 P000 // / / 00/ 00/00/00// / 00/00////0 R/07@-@ R0  S a P q0P0 Ѝ0A-`pVP@0U v`SpZHQk `wG`PyA@- 000/o/// Q:@-/ Q:@-///00C/00C/0@-@ p`RP00U000 0 p0P Ѝ@-@@-@T p@-`T @P v0 P pV   BR !A 0 p@-P@Ap0p@-@ PA RP    Bop @-AgA-P0`E@0 p 0P00S:0 R00V00S U  0  ЍP0 T@-0  Ѝ\* A/0  / @-0  Ѝ @-@s@-P, `@ R`0 Ѝp 07@-P@A0   Ѝ0A-P< @p `3 0 BR !At - B Ak7@-@P00PA  Ѝ0O-M@8`p1PF 0 0p W00 SF:pP PBTU00P S  V $0  Ѝ FT 0  0S  T*@0T: T  @D  F`0  5C-`P @P p 0 BR p Ѝj@-0  { Ѝ@-0@ЍM0Ѝ7@-@PR0 a Ѝ0A-P< @p `j 0 BR !AK 0@-00 ЍG-@`D p  PK 0 B R G @-00 ЍM AЍs@-P@`0 Ѝp@-0 ЍG-p @H P$`  0 B R  Gh @-P`p@0  Ѝ B A|@-0 Ѝ@-P`p@0  ЍM0Ѝ-L BAY-L BAP0@-MP@ PA0   Ѝ0-L BA6-L BA-7@-@0P\00U R 0 P Ѝ0 0  A-`< @p Pv0 CR !A! ,0p@-@0P`q p@ M0ЍM0Ѝp@-@P&(0` 0U p@e A-pH ` P9@@DT@!T  SKP/G-p`P@ W8V-Y X    0  0 X  000Ѝ000 `V p00///G-PS`Q* ЍQp0eA0Q: N@P  DP D H p@-P@`{0 p@@-R*@0A *P@ЍA-@S@D`TPp@! P T0D@@ p@-P@`D0 p@0S 0CS 100 BS/r/A-`pP@U 0T *  P @@ p@-P@`0 p@A-@TS@ p@DT`P@! P@T* p@-P@`0 p@A-P`p@T:@  P @ p@-P@`0 p@0 P:/ R/A-@T@ p@DTP`@! dP @T* p@-P@`0 p@0S 0CS1!0 R/@p//p@-P@U 1 !0PEpA-L pP` @@DT@!X 1 !PDG-`xP @Pp$ y uPPEUP!@  @D T @!T 1 !PEfA-Pp`1W@ ! 1PGA-PT `p I@@DT@!PU 1 !PDG-L ` pP .@ @DT@!T 1 !PD2//0p@-`000@0P qp0BSs@-@0P` 00 J0 0Ѝp0@-@000BSs@-@0P` 00 ,0 0Ѝp 0@-@  s@-`/oV" R \0F@0SP00 0 0Ѝp_  0@-@  p@-@Pp0@-@00s@-`/oV" R \0F@0SPJ00 0 0Ѝp^ A-pD P0@0` O 0 B <p@-PQ0@0   0p0@-@00@-0@ 000Ѝ 0@-@00A-pP P00@`   0 BR  A-pP P00@`  0 BR  kp@-P@( ` 0p0@o/0@o//0Q0Co// kRSRKR;R(RRR X0 00/H0TB3< /=<R:987654321<;.-C+*)(<&%$#"83('#"! ! D! D! 0110C1p R8! 8!@ @pp@-@PP1 !3/(1Q0(1p1p@-S@P1 !PQpp@-`P@Tp0S/ /R/ R/0p@-P@ p@p@-@PP1 `00CU& 0 0  $R0 0 Uڄ &P _R.R00$R0S 0NS ,0 400C,0>(p p] p@-@(`P 0 BR (`p0 00 MP0@-,M00 @P0 X,Ѝ0/ Q/P/0/SQ A/ /0P 0  !/A-Pp@Ѐ`T 0S,SS0C83 #S@S  20CS P P 0/S A-@ 0P0pS RUPS0`P`P `0`` 0P PU  &0 0P000008S  0 00 dR0iSXP//0 cR0cCr0CSP//O-PR\M@  R1 S01\Ѝq0P  W1,1, 0QX񏐃;[Zs  #'&%10(*)FTgNhIGFs|~w:~_]\ r  f`0HS ^V ` }1p `00qV W01>!p  10 `LP `W Hp ` `}Ha0q1 HQ21<S < %1>S >qHa 0,100C010C1 1S   Lj P 0/S$S P a01a^~ tld L<4,$   s!Rp`ipW00CQ_X q `W0QS 41 0#SX  K $S 0V,  R8!S04!a0!R `P 0/S$`PW@DP<@0 0 V  E/oS" R0S0p1pp` 1R`0010 01 $0 0S 0W1 0o 1R 0010 01P$001 0S 1 0 0`1Ppq$0^ 000CS  0SV1 0S VpX0@J1@0 2`1`F2 #1 0010 01P$0 0S 0 1S  8 00Q  X1S hunX R 0Sc 1S3` (qao(1WQ1V`FaL `R a{% Z}J p`>00a0CS 00S S`F PiH)H1S !0  ! 0S /H1S01 &H1S011<S < 0 1>S >  `02S' 0DP 0S 0 R )R`09S  PM4S% X( xhpP0/S 0S LRp )p`V(u )nDP5 >P(^ l009S1  }P  i<I0 }Pd0  wPU PO 0 2R  0 R00>S(" 0 0 P. 0Q* )R ! 1 `t 0pP[0 4] 0 2R 0 R00>S ) P  0 0 ;R00<S  P ]P0 p0T ` 0P    0S    V 0 'R 0`VV 00S>X- `FV񏐖`abdfVg (n )g0>S-aV[\ Vt]>,b`NoDi i i h `  0ES B0 S   0LS @-@I0CS@XS u 0 ER0 0@+ 0s@-@ (PER0`00/ 00 Ѝp@e PЍp0/ZP 0` ER0 0(P IAQ / 0G-@ TRGR), ,TQ QPGQ  R   TR AR RReP0 = WQ@QAAQWiq3j.!ghQ- vQ5 cQ{P vP  0 ,  0 G ,  0  0  0 RP y 0HP o 0PPw 0_Ss  ,0 0,00 0 0 0 0 00VR5 rRKPH 0 RD P P0_S`@Bp<0S9 $SDPSU= _U= $U0`FO P P PpRP P% X 0A P P V!0@q 0l 0f R  0nS 0KX 0JR/P.PY 0S$S `F a P P P P`YPP V 0 00SES 0S3 S  P0PS0S P 00NS 0CS P0CSQ)0P V R )R `  Q 0SS 0CS5Co! 0@- UR~ @NR9 SR{  0P0ISNP|1ZR0 0TPP) 0 ER%  sR:0 0|P  0 R )Q   Ѝ@s0 0`PPP+P U0P 0 0 ER0P 0 ЍdRp0 0pP`P w0 00PH  `0G0C0 (P Ѝ@ tR P0 IRS} 0 L0 0 `P0 ,0P0,00"  G-@ P~P$ PP 00FS]P 00CS 0  0PPPЍZQ0/Q0A*QQPONMLKJIHC7]3c'a ArQ6a QP Pq 0(t0P! ,0 0,0 PP` 0_S 00C S 0 0000C S BPPUP 0 _R0 0R0 *P PJPP F0P +# P`0IS"40S MPW 0  , 0p0IS8PPC 0 P ,-P600 C_S RA0CS  0P0IS0 HP 0SsP P 0$ZP P 0"RP P 0#JP P 0%BP P 0&:P P 0P0ISv0 0 !"0 00S 0 00FSu T0Cs "R"S!16EH7ITF@mt 0D}P\ 0 R00U 0ESOd 0L   ,0 0,0|p#dXL@ &,00`000Cs0 S001 PB  0S0 00s0C?o210_SP PPP 0 _RP 0 00 -PP}4{ C   7@-@P00 0ESS  .S ROSRS0ES  P Ѝ00.P PP  R 0'Q 0 S,00C,0 0p@-P JR0 0 Q@ @P 0P  )p@pp@-@PW<0 S0<0 0 FR U<00C<0p   YR0 0) 0 ER0 0p 0A-@ R    0Q+ vR 0`Av0 S"/PCUP006 00300 `PcRvQ004P?o240740 S05464PtH 0N?0RbpW PUP200 `0\l 0A-P 0B Q @ 00BSAaBQ$0@oR nR0 00000@@P+ 02S ,000,0kP0 7CBQY(`V R,  , R CR DR" @ IR0  0  0`1FQR0 0 (pWP@00 00`F000` 0 BRp0 0VP@00000 0 p`zppppLR 0 0R@P@ePdUR lR tR  tR0 0'`PL@PI00 `hPG  lR0 0apP 0 ER}0 0`Pw,@P. G0꿖A-Pp 0`VUV"BV 00F SX@F ?C FR.;1a0FS00TSX@ 0 ER00S P|X@X @0 @SVX 0@ 0 0 LRTRsRA-@ErQ9 8 0R US.BS00C S `T&C0Cs023 080j 0` ER0 0 0P0ISE0 P0 Aa0CSpQ:0 0 0LfRpQ.  TR0` 0 41s`PUPP00 `0B QoR nR80 0>PP 00IS0 tRiRlQtR0 0P3P 0 R 0S E)0 1uR 0 0P0 ?`P 02S p,0 P B0,0P0 7y4S3 3S 0S񏐑 4 pW񏐉/0 6`0mSpS R 0 _R0 0 `P^W0 9 0 _R0E 0p P p;PEP0 90 80fS40"PP P 0 gR0sSsR0rSc 0P0IS#0 lhP TPpP 0 <P0 ;K0 :0fSnS0wSaSPP_0p, 0 ER0 0 pR iR0E 0iR0lSKp7 *M|8p@-00P@0090Pp 0s@-P@0Q` .  Ѝp@ PЍp0.P 0` R0 0O-`R 0@Pp JP`&F[``V P2 W0 P0S  S S Pr[0 0,0 0,00 P 0 pV[,0  0,0K[,0 0,00SP0 00xS,0N0,00 OR, OS0 , h0P EQ PwS,00,0|0P EQ Q O- gM0@ ! _S0ZS`  l`PV _R.R00$R0SM 0ISDS  ` _RIS``VpEF0x1 01 01 0A  SA 1 q  q q q q |q tq ( 㒐cV1 РM - 0F^KS 0 ⤁ _Sc  F 0 뤁Pँ `P1o0娂SXS x1sJxq Р0_S P01 0ZSK01 P0.S0a C_SR00C S 0 a@_P\0.S !  B0 O000C S 000C S 0ZS 01 R Р K1NKp h0 1 `lKd0 ` \ L H X T P D < 8 0 , T08 (  S,0T R ,0 S!F0@ Р  1AР4 DРXoPA-@T0PЍ0Qp0R0`S 000 0PT 00 0PSUT X00WV 0P *P]T 0WHQP @-P/I0GS0NS0US0CS 0CS 0+S0+SP//@-@P P g@-|P'0Sx@$0$ 0@-@0008a @-@ 0- /$0$ 0@-@000` @-@G-P8`p @P1yP 10rP@00jP 0 03/@P 0000 @000V 0QP@ 0`` 00  0 0G/\` LdĢ$0$ 0@-@000 _ 4@-@4A-P@`pP  00A//<0< 0@-@000 @kЍd^ t@-@$0$ 0@-@000] @-@$0$ 0@-@000] L@-@$0$ 0@-@000\] @-@<0< 0@-@000 @{Ѝ ] P@-@$0$ 0@-@000\ @-@$0$ 0@-@000T\ @-@$0$ 0@-@000\ $@-@m$0$ 0@-@000[ x@-@Yh07@-@0\ P0 PE00vPq Ѝ0 `[ Pp@-@P0P000pZ p@-@P0P000pZ p@-@P0P000ptZ $p@-@P0P000p@Z xh07@-@0\ P0 PE00$P Ѝ0 2LEZ tp@-@P0P000pY p@-@P0P000p`Y Lp@-@P0P000p,Y Q*3R34R0C@- C# @c.<$  01p//O-7J8e$ JR `Z !Y0?C0CS 0Rp[p0*PG$4@\0e: @T U!4\0P6@0p$00U 0#SLT$TU T@3@#T ! 0p W0[0* TP@  Q ЍO.Q ЍT pP ЍO)A@oZ Y ?B0CSL3TU R P0A 0.* 1U'0030#Y SU ЍO\ `0+SAP ED2U 0C*#:*:D22I0;"[ { ++[Kp[`+r;r`+tk`Kt[ktKK [[{{ q p[ pK ;r#{!+r rG*R#?N0C>S S P 7@ 4^R ЍO1P +`k K;"kJ`k6 0 {0 !ap { ^6+Cq; qK+a ;;+b NT  A + ЍOK$ 2 A` r;;Z ;+r +rd;^Kpsqqq qa@  10+C ЍOZ 0CpX ?j,A-jVAA3Q+ZQ*:V 1 0+C@ a pQ0 TQTAU > >10 @Q ^Q@^ 0 Q 0?*R:?C0C3S(S@-J R 0! |01tz c PS0^Q^cP^PRƠ S\Q\âp 0+C S 0/*0@-^ ):1QRm 1` 00K a"{+``;`k!;;Kk p  p;;;K;; KK; 60!8C^0@ QR0 / 0@1 `0+S C18@R # SPA2KE$ C:&K : k;`c++ + pKs 0 # 0; ;" 0;k+a ;;[b $ 00000CQ[HQ ? `@000S A j0!p/0OHP @ 0"0!p/00P P 0p/0/O PM"@ @  Ѝ  X pP M"a  0 Ѝ@ @p` /a!@ /" a /"C-@:Ar1PS#3*P ` Ѝ*VR010$> SCZ!_E"PE" * PPEPA @@ uz@@p^ US06L N pn>827. PQL N pn6npERPWU 000 0U000 P 0pG @0S: Pπ6C0  AL l \2, S!QSP@ :S*  . /S@ p /( 50   R  * 0/ 0?C0CA:Q/0p@-@:?b0-Z狸KE pPPC&{?6+Y=`PD?:0@-^ -:!QSl 1` 00+K` [+$;` + ++ [+"K@[+K @+R +`+kbb{p[e p" 0 Kd 50!(B^0@QS0 ?00@/ `0+S C0+!(@S0"0PAB*1KE*$ ;+& k ;Kr 0 " 0  b  ;;[b $ 0000 A0CHJ ?x!1#0@-@P40y JZtPe@ 0!"# 0!6U0Ơ! p6#6 r04W @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rU*\0@TQ#*1?o 0 0C S  b 1 b0@T0@@T @@ d010 @d d001046#!@PE 40 010ʰ#0E208Q00 FV100/0@-K2@P0/0@-K2@Q`B a43!/$/3/0@-MQ /0@-P /0@-QZpK2@!˰Z    ! 0bà01@M ! 02BC< ",#7Šs#07` !ȠȌ Z. G#3 ZPpG p Lq0l X @3#X \@ A Qp :V# 2Z pX@ T 0V 3>510011/Q! G-`APp@O@V PX pD@P*P/@0P0 P P$/ / /: 7@-@ PA0 0S  P 0 0 Ѝ0000C10 P 0HS0 S00P00LSS 0P 0: 0@-@H 000@ /0P//p@-P@@`P r@0 003/P P@O-@ pMP zH Pl`PP@0 H0.  0l0 3/ 2L0 07/PV.  PTY YH  `ߍD/@-<0yM@P@0 p00@%P 0 3/P` YVw yߍ < @ p@- `0V@0  ~0 @P3/P PV@R3 R< @ b/0S//Q/AP3#/RS0  /@- 000  ЍQ/AP3#/RS000/@- 000  Ѝ<0A-P@0M`\ Xp0X0P 5/P 0 3/0@@0ߍ @O-px#$MLPS @  0P 00$ PY08P00s t"80s0(Q0 0SH0``PPtU00S  Z Zb Z YPPD 8P`P " 2YP2 0 s/ sX i0᪶P! 70Z ,0,0$0(`$Ѝ P )U(0V  < 8P[PX  #1  PYQ#P 0US X0 0Z  0 0 0 0OP 0PS`Q Z(0V(P0 "0400ST4 000A-`BM@PQIF>_SB80r  RJ80 Bߍ0r@"S,pU]W'X%p_00jXWs @houXW S"Xrp"HTP0 0P1@8 1BqS  8 t`RS0 01P80  R80zD WXpWpGUWX 0 UH000:W 0 005U)W8T0ڄ1 !AAR 0W XB ! 3!c/BSzU0U80xPO488-! /! / / / / /!1AQaq/!1AQaq///--0 -<@HЍ/--0 -c@HЍ/--0 -v@HЍ/--0 -0J@HЍ/--0 - @HЍ/ 0R R  B      " $ / Br /@- 000 O ЍC-PMp`P@V  @0@ 8@0 P!0  x$ 0@C 0 70SD@ T Ѝ0Bt ^P `S  0 S 0 S 0.0R#0.)>P S7Pl P 0 P0 @@ [ 0@/   LPG&(0 0S  0 'S2P2&(0P( P 00S 0 (P   0&Pm &( 00Sa 0 '@-0L 0   #< 0Ѝ@- H@-L00p@-<0<@0@@D0PDAP@Dtp@ 01@D3/@-JM AP p?$!$! $d0 03/GFP  0CPς\[S 0pp" p2PH-p0\@P2 0 0S,0S20" R 2!00  "10 1౟ ౝ1`1000VH:1!0 000010S 1Y00 10  &E㝥\1 ,L E<100S (a$` 1II Ya` II Ys O R `2/Պ0 3/0 3/ p"(& % u"8{|4u"to"u"%  $ | n"t$ xn"T @-`tMp@#p(0p/00 S" V q+P@t 7#W d+P@D P0: S"SRtЍ' I@-@O-A1@0G! [2 ! " R  @ P!@ T0! 30\aŕ`TPPT0!030 5 0pP . p iTRO~p p>     p p0TLB@DH @D20X"8 $/$\ S% @000040T 4 Ѝl" D:"ŋH7t9"p?0 / 0p0/$ 0@-MP r&P @&T @DT 0p/000Ѝ0h$ C-@SMPp 00\ `Q Y%T R000 V 0 B0C0P9&765")#,0 000000 0 00 0 B0C00 p/00 0 Ѝh0Tp/0X0p/0H0p/080Z 440.Q`,# # " " M p0 0p  /@-4P`p" O- ⌒$MP0 4  `p00 dPT2p/000X 0@0 M P 0    GP1p/000X y 0@0 M p 0   (0K, KpPQ(R@P= ,0T 0 781P`<080 ( R%00 S , 8  |P`(  BR, ` %"0 < 8 P < P4 R``40@ KPh0Tpo0p KH00pp@PU*܉! T(! i   O-pMDr Z@H1* 0-P0U0 2` 02 @ 0p0S X100p'V 0S`2 00S0    7/P0 0X*U&ЍU 0S0H 0004 0  7/P0 S  $ 0Y*0S 0@00ꕅRV y6OA-@`P(p0 P 0 @ A!@-( (  '&P0 ЍP5"p@-@PPpp@00/4"0/4"0p@-S@ 00C0Spd0 P00U P%῞5/~#00p 0Sp0 0-( xQXO-pS 00DM@0 P 0QL0 0D0 `@04KT40 P(D000  0,0 (0 %@PWR M P`0 @@@@@\0<@ `pؗPF 0v$ p`u 40P T 7P  [ ?QSw@ 0D[@ D ?QSbT@OoB*"*"\*")"8)"0A-@0P 0/RQ[ `E<030P  10<0S s@00  00 000 L 0S s@00  R 00X0C Q 10B10R P 0  jk ( "t2O-M0p/ 00P3 LbH2 000 @ T.$R b rP`p0  01 P@ P TA@@]`YP@ 0S1 0Ѝ╽PP(  ]\1`0 S00 .0 0d0000pP 00 000`P᝾0 P@P  0 FP0S  | p 00: S "Mhq "m =kd"HA-pP@`P P ` Vh0E dd0&2    $4 (0,00nnn/O-DMPl0h0t0p@0<0 0 0$00<0PS 500*T Y 4!0&0C0 p~ 0 t0 0p@l0 0hDЍO/0Y00@@S, 0 ( Y` 843"440 Rࠓࠃ[ࠓ^R @ D  D  D  D  !000 000<0000`S K00(00K,000CS0S  0B!S0# 0010S![1p pQp3p# Y 0DЍP0APAPAPAS    000S0W0S KR0}02#,,0KT40* < Y0 000#:/P[ <40Q  (R  \ 0C0B0PL p,0 AR` R00 C1R % <Ͽ Ra[! 0Q3#<0`S 0"0p^ pLp^pLp^pLp^pLRQ 0"0T 00C 0Wz@10S  00pS^rmmq6mFmo"kvkNnijm~iiO-LM@0Pp0t0|0x`(0<000 04000 P00<0S h6 00 " V 0S @6!<<0%0C0C圖(0|00x`t p0LЍO/0 00S0``0$00X@0p(0@pS= 09  R  p53"ll0 RYZR LЍQ L  ` F  F  F  F  000 0 00 0X0880@0<0 0S 7 00 2/R WA Q 0000 R:$  R* 0R $0 S3#0S( 0S\W Q   0P:$\*0 S  S  S  S  00 00 0@ 00( 0I?oR20Sj 0 CR02#0 V*0D0尕(0D  000 0]`\\O-LMpp0@t0`|0xP$0<0,0 00000 P00<0S 6 00 " U 0S 6!0!0C0@d$0|00xPt p0LЍO/0S0PP0 00[@0 $0@S8 0 4 P 53"0 RWXRLЍ R  P E  E  E  E  000 000[0440@0800S0 ; 0^ 0YS Q  W:  ^*W E WE:  QC:L4"HH0_  R8 0R^!Y) Q  W:  ^*W W:  Q:3"05RRRR 00    0@ 000$00S0X0SX GR02#0U(0* D i$0D  000(0<0:TP0T 0L0S7 1"050S#3 SP X0 T000 0,0JP PP0Y 0P0 T0P00P0P 0"0 S 00C 0T `0S  00 USOORO*OQ@O|OQ O,OVPMNNOL5M O`LMN8LMeMIBJ1LHHIKGHO-\MPp00@00 $00,0<080 0<000000 P00<0S ,: 00 " T 0S :! 00C0@?,00$000@0 \ЍO/0 S00(00H0$0SH,0S 00 Q 893"44 0P ST`L040 00V:0f0Q#* A R8!08!00`0P0P00`R@(0[@#*L00PD`P`V\PL0P00@0L0S T .6C Q3#SQ< . R #((R **R ?( P@3: \TT?bP#3 0s00P00P0P0L SL 0C S%6!0.X@00 0 P0 0P0 T00@00P0P@0C 0T0 @@fPTP0T Q P:(RB:@P0T00S 6T2@ P0R5z/00 0FV ʔ5!0Vx5!tt0`D0`0 Y* 4 04 0T \Ѝ0ST)6C Q3#SQ'  >A  ?(\:^TT?a\#30s00P00P0{X@0 T000 0P00P@ PepP0 0P0@ Z@e 00 00 $0H 00$ 0,00S0T0S 0 CR0X3#TT09 Z0L0Y,0L  000$0000 0A  ? T:YT T? a^#30s00P00P0X0 T000 0P0| P P0 P0 0P0 P 1"0 S 00C 0@TGT `0S  00nI2FBFHZEjEGEEGhEtEFCDDlBBD(BBpDBBZB?r?rA6>Z>?<<O-TM@|0x00P 0<0,0 0000(000 P00<0S d: 00 " U Z @:!<< 00C0 pQ 0 00P|0 0xTЍO/0Z$00000400D00S`D` 0S 080 Z t93"pp 0`| L4PL^HH0CR? ÇS!H00s0P4Qp3:H0H0$0 R YH0SIPpCH Wࠓ-\( \# \ \ 00S* \QV (0 0H \00#pH RI23 P1.:0 pX?p^3Q ! B3" 6+C R: 0H0\* P H00L SH7!DD09^ R NHR6z/0#0C$ 0000Pp0080Y@Z 48 B$@BC Qp6!ll0W0Q0 Q0 Q00\ Up E$L  <0TЍ@?@30 (040S]:0 R$0HBP +P & P ! P  P   0Y0 PSV2 8 R/ p000 Y$ 1:0 ^0? P#S @2 6 B P: $(d PY0BpZpXpV 00 00 0D 00 0 0G?oR20S{ 0 I CQ3#0F0X0H0囉 0H  0000 ;;4=2:B:=:89:P88978,7*456~33411O-LMPp0@t0|0x`$0<000 04000 P00<0S 6 00 " V 0S 6!00C0`傈$0|00x`t p0LЍO/0S00(00Z@0 $0@Sm  0i \ 63"0SS 0D00E000cU*PPEPU 5!05!00U`(\`3:pH``pF`V0`` U`V ;s0 S%*X. , 0 000 4!0q0l 0000 0 00 00Z p0`0 880@0<0 0S02U2 U7:( Q5: q Q% p!*X. R, 0`0000U:( P:Q p P% p!*X R 0`000U00S pLЍ``` 00 00 0@ p00$ 0F?oR20S ER02#0Y*0D0u$0D  00006C Q *U $0 P0P00000TS40T00T0P00P00C00T00]00$000X0@PSP00,0H0<0$0S0T0 P0T[D P0R0T0 06T2< P0R7z/00 0HX P7!LL0X47!000@00 Z4 , 0, 0T \Ѝ0$0 [:0\*@0S$:3 SP U@0 T00 0PP@ PP0X 0P0 @6C \0!T%*U X 0P 00 [C:0\:0S%:3 SP  U 0 T00 0PP@ P P0T[UP0X 0P0 @6 C P*U X 0P 000T S40T00T0P00P0@2    00H 00 0(00S0T0S] KR0H4#DD0 @0R(* L 堄(0L 4 00800 000@0Nn~ (9Fi"F)O-\M`0p@0000(0<080 0400$00 0 P0 0<0S ; 00 " T! 0S ;! 00C0@9 h(040080 0@0 \ЍO/0 S00000000H00SPHP(0S 00 Q :3" 0SP TL0,0 00X:0h0[#* K R:!|| 0l:!hh 000P0P00R@000Q@3:L00P@XP[PL0P00<0L0S3:3 SP0I U@$0 $P0 0P0T00<0P0P0D bD P@ P0LSV 0CS#8!0>6C Q *U $0 P0P0000?s00T#40T00T0P00P00C00T00]00$000X0@PSP00,0H0<0$0S0T0 P0T[D P0R0T0 06T2< P0R7z/00 0HX p7!ll0XT7!PP0@00 Z2 , 0, 0T \Ѝ0$0 [:0\*@0S$:3 SP U@0 T00 0PP@ PP0X 0P0@ 6C \*U X 0P 00y?0T[E:0\:0S%:3 SP U 0 T00 0PiP@ P P0T [SP0X 0P0@ 6 C P*U X 0P00?s00T #40T00T0P00P0@.    00H 00 0(00S0T0SY KR0X4#TT0  @0R(* L t(0L 4 00800 000@0@P00 400(0 0,000008000*@P  (0S`V pB ,` VQP0S /}0@ s/RA(4P # ਦP 0 0s00E`0.S0.S0/SB 0 S/RS S.RP0S.SM7c< hrpg`P 0Sd00S `10S@!$2010Y 2!0" !1 0MI4 p1@PD0@&u0 V0'p` 0 l㒃($ 02#X!0XU*050$R01 @PC0cPP0p` 50@D 0U0@b50`Pt50`V ] P0R(U0PZ1 0J81Qa 0 Xh3! ) Q P! !0P1 0 Z H[0S `1S , K "00` S@4 K0`(4!0P10C1 01 401 Z,0K" PU 0 \Q 1S 3^/0 ,KC!0 01`a ,0K2pKr0 1 1c1@ 0\W:U001  0Q *10Z1   10Q:t( p@; WKP52400@D Q\,hl Q\% \XQ\ T$0P!RP1  @01C0  p ȗ!PT(K 0S 1!0v P 0S*p1!ll0i,K0Cp01 010Qf`T6<㍗@P 1ݧ Pᵘ0q_K`p0 @ 1S 1P0 p01P01 S0!0101\ꘌ!!x!$!!!!l!x!X$! 0p/0j@(R PD*p?P /p? R70!#%'  00 R( /      x  p  h  `  X  P  @-q@/8/gLjLigg hhhhefjh!!0p/000T/lil0-0d ,$̌48 p/<^(00 0000Hh|egf@- MdA`(P@p @10 0S=,10U<  PP3 B00FF0 000c00"0p@ 00ޥ00/RP[ 埗 qL00DPP8 d@ ^|!u@-@0P,p` p0 } 0p/00/Tc0p/00 /0c0p/00/ c0p/00 /b0p/00 /b0p/00 /b0p/00 /|b0p/00/Xb0p/00 /4b0p/00 /b0p/00 /a  R/!0p000,0/De  R/!0p000$0/e 0p0/`0p0/`0p0/`@0p00 00 0 $0<0,0<0/dh`0@-  0 Ѝ A-`@0S  X0S S@ @OoBpPWP@ @P@WP pG@ W 43Sd@@EU@#@3U@@U@@U@3@#@EOoB@U@P000a0p@-S0P@SPp兠Pp倠P0@pA-p``@qd0P`0P11:PE⪟P*U@O- DMP0 P0H L SPH0@Tp K0`0VD0 R ᅥ`,40A2<g `00@0 0AT0 0IX0 @0Z1Q D0AS P1Q:P1oP&T0S pX0pD0$HQ0 壀0R103?P `WDppD0XG* 1R0`3?R6o0`@0 P0Sw L0S Y'50 0SkpP 0S  XPP  50Px5 0 l50Y\5p/000X@ 

0@. 0000Q8 00P. Kp@* h P!00/S00R0S0 0@sp 0<0`ȟ(> @V@VPPU$ <0S   00 00C0S0[/QRfЍ`Vp<` ThP 0 V<000@003?S* V2/ V2/   V2/   V 2/  , R  V2/ 4 s04 S4@0  0$0(0240SX $0 V$0< 3?$0S> 03?(0 03?(@ܒ0P0D @<<0 04<4|00,<,\0,0$<$000<pP080(0P(@ V,P4O V5_ 0@P1 ` 00, $0S0(0 00 V011 V3?S 00SS 忐彐<0S  ᵐ 00> PR RR$ IR! X0Bs0Sʟ\à oB| \0A23<0 08S0S0oR dR iRx:0 1uR xRT:01S06S00S0oR dR iR:0uR xR903S02S00S0oR dR iR90uR xR906S04S00S0oRw dRw iRx@90uRv xRw(90LSy0ES00AS00SS00TS0 08S 0S0oR\ dR\ iR]80uR[ xR\80y1S 06S0s 0S0ooRP dRP iRQ<80euRO xRP$80^3S 02S0X 0S0ToRD dRD iRE70JuRC xRD70C6S0@ 04S0< 0S08oR7 dR7 iR8p70.uR6 xR7X70'FSu0AS0!0SS00TS008S 0S0oR  dR  iR!60uR xR 601S 06S0 0S0oR dR iR|60uR xRd603S 02S0 0S0oR dR iR 60uR xR606S0 04S0 0S0oR dR iR50uR xR50MS0AS00XS00S0oR0 dR iR850uR xR 50PS00TS00RS00S0oR0} dR0y 80iR0uuR,0r 00xR0nIRl R 0gx40dp40ah40^`40[X40XP40UH40R@40O840L040I(40F 40C40@40=40:40730430130.30+30(30%30"30303030303030 30 30x30p30h30`30X30P30H30@30830030(30 303030303020202020202020202020202020202020Qqq, Pc QZ  V Qqq7pX p V 8 V2/r (RE*pP @80y80@R00YXj!j!j!i! !i(; }gg}f?#eed%O3c9cbEoS sؗg 7+w x`)3{W? w ĖG;  p92zg-Oð ԕWKI1yw=_yG /\;001@00(0$0V(0B S003?pL0(VP 7Q00@ D00H0|0pV . q2/- H0 08080 CV2/3?R %X \0p8 s 8 -  \ÜX \ޟX 0S00qD0@ H0p(0S00000L0P$ @0SL0}: 00 S0 fH0D 0@0H04 !V,2/!0 S0@P, B3<c `B @,Q&000@0 0S 04 00$0P0(0,000@@8@<@}w"`000 Tp d `Ma\00 0 0$0(0 Ɍ d `  0 $ R : R 0P0 01P020 ,0000L0 R  V R003?0Q 0V1q Q] 0UP p`  P pH400S   %d)0 O- 0oMM P@30 S00d;@P` 0`90p?1 8301 0301 `OP 9V  30v  Km_K KOP 2! 0 0pP S#S~ 0PP Q 00 Qh Q   Q0001  U :䡟Y㉐d vP 10崡Y  ! T!01 101 01 01 1 1S1 ! 0 S 2 NP| Y!0 @5 1010 0`011 1@1P!91!00 P1SOm_K NPH ]P B   U0.&T!|T!DT!!6t!R!@!!,R!|!Q!|10@-@0M0/RQ[ `@10 R4!  ,1@ R; 1000SP0 @ [?QS`Ѝ00:S 0R:RP *Sp00AP0 R Ѐ 0" {   0 0  _P00Uʁ@ Q}P{p00@@(0ZAލЍ@ @ ᒇQi%9a@-pPM`P* B@=PT 0p/0 0pP  0@ P  0S @@*P 00 00000ЍXL\# 0@ R/"" @ :@-S* RQ 0 RBA ` 0SCAA 56+C ЍPC@--@ H@  0f H @ 0"p/0x%@ 00#00.0 <1  @0@ 0   Q@-@ A/o-GM0F/000@S02!!!8  1 1  00>0'PೌGߍ\>!q@  ?\ R 0@S0p/0/#@-@shP0p/0#@?\ 0@S0p/0/`#@-@QqGM`Pp;  000000   30 U  T  0p p@|0@`p/0@@Gߍ0U0P0S 0 0Ә0000R,<"@-sP0p/0"p-%pp p/1Xd0 0@-00S p p@l0@`p/0@@ᰀ@Z0p p@( @`p @@ZD!L!p-pp p/1$d0P /0p/0/ 0Ao?SP AQ40p/0/0-!31 0Ao?SP AQ40p/0/0-!31( 0Ao?QP 40p/0/ 12/10@-@R 0`P08 P^1 S 0q p@$l1@`p/0@@X1p/00&SD1K@0qZ 0 p@1@`p/0@@ 5ZT Ѝ @ S  0p p@0@`p/0@@Ut 0s00pY 0 p@80@`p/0@@ Z8$T@-R /0 ~Ѝ wp p  O-(@pW:`PPᛕ&:/P pP@0P/ׄO-1MMPP000C(0A.0$;,0!-448(<85p/00S$p p/Sp@po @00400"S UP (@P l4`@00p?0P4000S0T0T/S@D0P/S PR/R U Y$.S 0T/S/000,   BR):  ၾ @0 088<(0 B R P.SY0.S0T0DV@  s/R 0 @DP (`0@P000000S㺸02 00S0(S(03R|2(p/0Z 0X 00  0E 00 ;4P X 0Pᔌ ᔖ 0P /R @ T0DV@  T0C/RU$ 0孉P& 0$ 00 /Q Q0 .Q8Q .Q0 /RR,< csPY* 0W0. Y 0p/00S S@@D TّY0 1ݍЍ /R l0 0Y`vYH0$p/0Y(妒p|X T6!4!< 100S /p@-@PQ S$0p 0 R 0B^   x 00 000p  RS 0P0Pp3!1 *H<1!A-pP0) 0`P@0/RQ[ `X0P [/QRڎXd @@ ' !H [?/RSxXF(4 0!@0!0/!00H-r`p Q   d2@0/RQ[ X44 PU 0S00S ᲂ1 0 [?/RS0X0Sc60C02 R" R8 R [0 /τ\R 0X 03/0/RQ[ W 0 [0#/PR0W03/0/RQ  [0,τ\P W 3/0/RQ 03/T:(0@$0PL D@,0!00 @-I80 0G-0@T& 0PS@!  `DR=< p@@T 0 S P0=Sp@@T R@| O-RM P`%pB   000 Sw9IX@0VW" 00 3/ 0P @ P`F0pGR*0 3/P`FpG000VWV B0 CЍO:@0 3/P`FpG VW@0 3/P`FpG000VW@0 3/P  @ `FVW P pG@Ѝ RO-`q  W4MP@&*p0pM@0 p(p 040 T08@ 0 ,0 o1 D0 0DSC:(0 K8Kp;W:@-$ꤡ 0SU㶵p10x  R00C10[P! 0 3S0 00U K1p0100P@0 p  Y D ᇓ 0H 3H0  }H0!Y Dsp0T40  8KT0 0*!*!|*!x h @-X Ѝ0 O-QGM@0 1Q00A#@ 00 b00 0   PC 0 5Pᔕ%03/0P000 3/0P` R0 0 3/0P  R p`0 03/0P p  R `0 03/0PW* RWP VP p`W p` FP CQ%0%H"* X0 ` 0RPp1p!X V0pdD 0`V GߍQ*P`p000 3/P` V P0 3/PPV0PSUV    q@-@h0/RQ[ U<[, ?QS@;UX%!w%!A-P`p0/RQ[ T\0 0@P <@D[?QSUu$!lvt$!p@-P|0/RQ[ TP@4P 8@D@[?QSTp($!u#!@-0l/RQ[ TDG[4 ?QST Ѝ#!.000004@ pC>,01004@PE;0 40{P 0 p @◈PPEXCލ Ѝ0U0 C R 0  10_0D0[ @ s dV ,R 0DD.S GD  b`0 0ASuup@-PR@ 'UT@z0Kp/0@p4A-p@S0 00Pᘀ` p00 B0HR80 3/P1S(,0Kp/0-_s^^8|O-PS-KM`00X!U0p 0"\A  / V  07U" E0 @PKߍ(Y 0S Y , 0 p( P I V( 0 00SX 0X ,  p  P   U E0 Q@0 ^@P VH@O-@-(M M( .K BP0<8 ;88 BK04 0X8 A0p4 s?p000$(0 000Cs0S00#00⃞Kh8 `>K I0Cℨ `8 XX8CK @Z1 zP 44 `8 1 ad8 $0 ! 08 ~hx8Sܞ`x Xh(40 P!*>08 !=K 0C8 08 8 S 0p!`( S"l( "x( S#p( #( ( ( S!(   ( w |( h rd `!R 0 0ʵ b 0x8 0h8 0s `(1?d8 08P w 1S ,100M0 ^ 1 3/p PUPz8=0p/K8V  zPPq<88hh8 406h84( 2(`8 8p08 Q 0s !0s !,Q $ Q(0d10 $0!4pW01d81!|8 0CZS08([l8 l8l(  8 wp0H* W th 0 S:%Q@p< u: P0 4 BPP 00 0  % $0V% `( p`!?/!t8 ? Rȏ(0( d8SS808W00S ` 0 o003` 0l8 f!Q`8ҀQ`(`8X p?ht8 d8SX8W00S 0 `l8 J 0 o003 0l8 08 `? p$0V`(! `18 0p8 8 t8 ppp0d8 |8 X0C?o200i8` R00S 000 `8 W00S  `8d(0IS X 8W00S000F`F0I8 (d8C?d8 x8S0d(h8 C8X00S 637I(t80p(0$ l8I S0 PPt8Sw  0S 2-# 5- 3z:`?pK uI PX <637 0 Sw:0N?p9 u7 0 Sq:|C?p. u, Pd(00 PP(0 0l8 ](R `(ph 僁08 #(R`(僁88xp8 0d8 |8 X0C?o2h8` R00S 000 l`8 W00ST  `N 0l8 p8S  0S 2+# 5+ 3* 8S  0S 2 5 3: v  0   |( t8SM  0S 2-# 5- 3P:>p u h8P0Ch8 8X00S 337 0 SF:0>p u 0 S@:|>p u h8P0Ch8 8Y/ph8pCd(00PP(0PP0 p8S  0S 2+# 5+ 3* 8S  0S 2 5 3:   0   |( $0`(僁X x0p|8 08 08 0t8 Kd8bS`0d8 0|(0#SR00S d8s ᗁp8S 8S̀f 8S$0V`(1/P (RP(RPP8S P`00St  p0 pc0/^wXh8`Cx8S0 SPPN$0`(0 S 2 55:=p u x8PS0  82 (!(!p'!xWkVVVViyJM$ `aVwd8d(s00R0SpP``h8SZ0 vGox8d(0Ph8KPPQCK@vK @s(K`p`x8S0 PP0 PPx8S/ 0 8( C` B$0`p`Y h8pCx8S0 PP0 PPx8S $0`(1L8 $0 0(0 00 0 0 2 0(P-UPz(200 S:%1=p 0 0 S:#%=p `0S 0 S:'=p ` 0@  0S 2+# 5+ 3:=p ` 0  0 Sx:-<p `0Q 0 S 2 55:<p ` 0 0 Sa:I<p `P 0 efp8WU:0s 0 S^:.<p v 0 `Mfp8WR:Q 0 S 2 55:q<p v `U`P  % m  # t`s  ' z  0S 2 5 3 #|* ~  -   I 0 S 2 55:q<p\ vZ `  . 0 S 2 55:\<pG vE `Ul8 S O-KMԏMPpl0?Tp00P\0l0S0l0 s @ ? @@ 0P @xT0ST? 0` l0TKލЍOT% Cyx Pt`>00>D0 P0HLC0S 0/RQ[ oDH0@H 0000t0x 0T Bf@P00S P>00D0SH<>00SJ,>00SD0X0Ep0080>0|0>000 ` 0FZS#= 400| 0S,1 0|0h d H @ < L `0` 0FZSVP= 0D=00 S8=01<|00` 0FZS=00 S<01H|00` 0FZS<00 S<01 4|0@0` 0FZS|<00 Sp<01L|0@0S4000400` 0FZS(<00 S<01|080s p[ 0k400@0 0FZS?:00 S:010. % p d:0K P @0 H00C0S0[/QRjCt0S CKލЍ0`$V 0FZS900 S9010000*S000000C S , , pd90 P 00$S 0?,0 00C S0 ,p 0` 0FZS800 S801t10` 0FZS800 S80110` 0FZS800 Sl801l20 ` 0FZS@800 S4801 20 ` 0FZS800 S701 l2x0 ` 0FZSy700 S701 l2f0 ` 0FZSg700 Sx701 l2T0 ` 0FZS `0J00 0 0S1 l2A0 S:%9p t @`%p0``0p0w @0I@P00S  % Z 00p ?/" Rਯȏ(0`  000,0S`00L00 R00S 0K40 J004 040`0, K> 0CS X L00 R00S000IIK> 0C`0` ,00Cd0?,0@0S]0, 0KL0X00S 050 32K<0H 00 40K S0 @PZ  0S 2-# 5- 3:Q9p t @X 40 32 0 S:0>9pn tl 0 S 2 5`5:09p` t^ @, 00 @PV` 0  Y0ЀXXpᨯh 0kH0< 0 ZD 00p0 H0` <0IH0< H0< H0< 0,0`X0F?oK.2000bd08 R00S D000K.?h00 R00S/ K. ) 040Y HpXp,0S=X;L00 R00S 0K40 00J4 0400L0x<0,00 X0F?oK2%bd08 R00S D000K.h00 R00S K. Z 040H0S  0S 2+# 5+ 3* <0S  0S 2 5 3:   0 !!!WWPD0D8xCVlCpV$C(VBUxB|UATAT@SD?R8 ?R>Q>Q@>DQ=Q=Pl=pP/2h~İZO  0S 2-# 5- 3R:8pC tA @KL0X00S 00 32 0 SI:07p+ t) 0 S 2 5`5:7p t @K`0, `d0`KS00@@P ` 0 M@P0 2H0S  0S 2+# 5+ 3* <0S  0S 2 5 3:   0 pX 0x`d00L0000,0 S 0,0 "SV  R{ ,0su  z`jl0 X0S T#zT0PX0-0Z/p@ Y@X@@L0S \P \0SM\/p\0c 000RZ@0KS0 @P{0p WS 2 55:=7pm tk @@0ST 0 `pZ,0, s00R0S ` [Z0  y@0 , 0 0@@P.AT` @0S0 f@P30 s@P+ & p`! @0KS0 J@P0 l0pp㸰`00,0001L 1< 2@ 2H 3d 3h 5 <<4000C00P@JT:T50p`l0X 0D0T080P0\0000x0 00000X00800D0D0X008040 S$ 0 Hp0|GS 0/RQ[ >H0pH 000p0pGWڨ0嘠 00 B0JRn,0 3/P`0 H00C0S0[/QR>j>ݍ|*80@- 0AH0C0  0 B RP PʞDP 0S/p@-@P`0PEnPp0     `pO-P-p(MM5 ?% p 0/0 5 0 5 B>K 0C44 ;04 5t5 l0S0l0 s 0x5 x(K0 4? 0 Q? 050 $0 5 0TU S505 >0X5 U>K0C5 =0 5HLC0S 0/RQ[ =H0@H 000U>Kpu @u xu 0Cp?u u u u 5 pe0SW@ tp=%054 00 t1 t27-S wV.K BA}PJ `t =%0x5S0x5 0 S 2 5@5:z5p@ p5 p% 0S' t70 H00C0S0[/QR=`=4B>K 0CP 3hx5s;5S`E 5@P) Vp%0p5 `%V? %04 0 t 0<%0x5S0x5 0 S 2 5@5:$5p@ W 54 00 V t60 S 2 5@5 : 5p@x5S0x5 440<4 084 000C S;WKp5 $R| 0p5 3 | 0p5 0*S IS 'S5S〠p0'S*S  IS R00C SWKpXp5 p% zRgR LR aR p5 0|5 h BR  hR0p5 p5 R' W p% `[V 0CSnV 9%0p l90 t~ 0 S 2 5@5:v4p@m 54 00 9t%0p~ tI5%V A`Fv07S7V F 4 J H2#: lR0p5  SQsRX%Tv lRr0p5 mkx7%005 h7%00S@x5S0x5 %V> A`Fv07S7V}W {yS R Q utsrqponmlkihgfdca`_^]7 [3 2 1 USRQP(yLKIGFst 06%0x5S0x5 90 S 2 5@5:3p@ %T< t+5&p6  |5St5 t%  5 5 |50S |5R0C15 5 % 0   0 |5St5 t%  5|5 0Q |%S B!% 5 % 0尐p0||5St5 t%  5 5 |50S |5R0C15 5 % 0 |%Rt5% % t% |%00 R|%S B!% 5 % p `x>|5! N St5 t%  5 5 |50S<|5R0C15 5 % 0| 5 5S  X0;5 d5P $ 5|S 0 SM 0 %5  50 0 t,2%0x5S0x5 b x5 0x5 [St5 t%  5 5 |50S|5R0C15 5 % 05 5SA 0 S 2 5@5:| 2|p@ Q`S!l V 5u%0RX0%0H҈5 eP 505 5ePS 505 嘥HX@0 S 2 5@5:l2p@ 55別 05 0%005 V 55JQ eP5x5p㘥 0x5 u 0FS0 S 2 5@5:;2p@ P0%005 {ܬȨܬĩPd4dD0hPܐ$̎| xp<|5! L St5 t%  5 5 |50S:|5R0C15 5 % 05 5S  X0;5 c5P # 5S 0 SM 0 %5  50 0  t,T1%0x5S0x5 T x5 0x5 MSt5 t%  5 5 |50S|5R0C15 5 % 05 5S3 0 S 2 5@5:1p@ O>K 0C C|% !< 5 S>K0C5 8EKW#5S 55!a5S5%X0H505 d5P505 5dP_ 505 5W``|5 yp P 03T 0 %5  % \3T 0 0 S 2 5@5:91p@ 8EK5HX05 0 S 2 5@5:$1p@ 3%005 W!  55C5AS |dP5x50x5 05 P0x5 p`:|5! J St5 t%  5 5 |50S8|5R0C15 5 % 05 5St db5P % 5S 0 SM 0 %5  50 0  d05 t,p5%0x5S0x5 I x5 0x5 BSt5 t%  5 5 |50S|5R0C15 5 % 05 5S( 0 S 2 5@5:0p@ 5!, % %4   tI2V! ` 55HQ cP5x5p㘅 0x5 V0@5%S % ) 55|5 0R"5 cP.505 5cP  0x5 5|%0e 0`Cx50x5 5|505 XX 0 S 2 5@5:$0p@ 555 05 8%005 `:|5! J St5 t%  5 5 |50S8|5R0C15 5 % 05 5S a5P % 5S 0 SM 0 %5  50 0  d05 t,$9%0x5S0x5 Z x5 0x5 SSt5 t%  5 5 |50S|5R0C15 5 % 05 5S9 0 S 2 5@5:/p@ O>K 0C C|% S>K0C5 5t4 00  I1V(u! ` 55GAS bP5x5u 0x5 05 5Vpp8K |5wp P :T 0 :T 0 0 S 2 5@5:L/p@ t5V05 (! & 5%5q1R5bP)505 5bP  0x5 5e 00`x50x5 505 X0 S 2 5@5: /p@ w505 505 Xvl<%005 p`t<%0x5S0x5 |@ `@`0 S 2 5@5:.p@ +0Dp0<4t8$R <$ CK @0X HS 2 5@5:.p@6 p0X00T0SY <4X8$HR/CK0 @j0 S 2 5@5:.p@$ pX; %t08 1xS5 5XHt>%0`C>K 0C5 D>%005  <$ 0 l>%005 0 S 2 5@5:j.p@ p>%005 Vs V V  ` 5l05 0C5 0P5 ! 55 5l05 S>K0C5 V>K5 =K0C5 50 5 5% !5 v pe05 05 XtR X015 S>K0C5 5 05 ,5p@ 0C)  % <$R9 0 0x5 Q 5Sᨕ%R*0Gt B<$  5t0C5 -@G5S%00C5@<T-ꨕX B<$ |0 S 2 5@5:+p@ 8%005 {`4$S 0CS0+0C" to tIq-j  X00(T0S 5 8p0S 2 5@5:+p@ t01nS tN tO-J(7%005 0 S 2 5@5:+p@ t016%005 0 S 2 5@5:+p@ t016%005 0 S 2 5@5:}+p@ )T<48$SCK0 @/<48$SCK @'<4S5 0 0x5  <$ 0  <$ 4@ VK% 0 A R  M l%44R p@0 S|5{ X( St5 t% 0% x50x5 wO@ R  5 5 |50S |5R0C15 5 %   St5 t% 05 5 |50S |5R0C15 5 %   St5 t% 055 |50S |5X%0C15 5 % St5 t% 05 5 |50S |5R0C15 5 %  X S 5 5 |50S   S 5 5 |50S   S 55 |50S S 5%5 |50S  t2%0X@0 S 2 5@5:~*p@ X tH x5S0x5 2%005 <4+ D k8$tS <$ CK @X 0 S 2 5@5:Q*p@ XpH05 t580!<4nRl8$S <$ CK @X 0 S 2 55:.*p 5p801aS<4X8$HS <$ CK @X 0 S 2 5@5:*p@ 5t801nS<48$S <$ CK @ p0ԋp̈0ȅȃpt(~zpzwK  0C C pG44% `F5`Fooopbi ,0@ !$@vi5 4<40CP.do`V3 3`5 S>Ks0C5 O>K 0C5 0C5  VS 055 2%5 o5pH VW >iPp5 Vl` VC~K pG<4S8< p/00x5 ^0 S 2 5@5:&p@ p<%005 ~i<4P4$0C% S` #l,5Ppp ,0C 004@%R  SR/+ D ,8$tR <$ HX tT=%04$ CQ*t 8!R 8$R-05 5  <$ % eX015 05 0Ie 5 5% R5 5 R Q R0205@5: C&p@ Al>%005 50S>5X S8$0<4qS5 #0 Q  R5`C%0% R00S8 5`C05 S <48$S<48$S <$ Q0 <$ % 5St tI'5@CV%0@0C5`05 St tIm'<4S!< 0 0x5 ^T_'0 S 2 5@5:%p@ XHD<%005 4$0C%R?  <  R99 <$ ;4 p , 5)VK AJW l%44R# |5S t5 t% 0 l%44R W'Q5 5 |50S |5R0C15 5 %  VK A !8Wl%44R |5S 5 5 |50S  ;A:Wl4$Q |%Rt%t  %% |% R |%Q B!% % 0ꨕ p` V:|5! s St5 t%  5 5 |50Sa|5R0C15 5 % 05 5S V5P N 5S 0 SM 0 % 5 50 0  d05 p5CK@ ^R 00p5 0|5 ]P 4,"ap50-S]S4$p50p5 p5 p% Rd ]RvWt 8%0x5S0x5 T x5 0x5 MSt5 t%  5 5 |50S|5R0C15 5 % 05 5S3 V|5! & St5 t%  5 5 |50S|5R0C15 5 % 05 5S d,V5P jx5 0x5  St5 t%  5 5 |50S |5R0C15 5 % 05 5 -R]QQ 0SQ:p% Rs4$0s044kt t6%0x5S0x5 0 S 2 5@5:/$p@ R>K 0Cp C% <:94lkhe@ecbaa``0 00Z0P0 4S  P/00C?//O- Ml0 ^@ K`dz0Kp/0@ A)P TPTPPp ,0K 0K Kjp@ 0 .c@W U@p@M Px^A-0@P`p0 0@0 Hp_0\ES 0/RQ[ F*H0PH 0000 0P H00C0S0[/QRe*Y-0@-  Ѝ Ѝ/-1w@-@P0 0@ 000 Hp_0\ES 0/RQ[ )H0PH 000<` 0<00E0P<` H00C0S0[/QR* Ѝp@ Ѝ/W0@- 0AH0C0  0 B RP PʞDP A-p0P$0 00`0@Pw=800000C SP) 0 $R%p00 0@$00S0%50 00SS 0CSgs t efiPISj 0P P  000 00*SbPP000C SSPO 0 $RKp  @ R %500 0S>P0000 .RQ   *RC000C SdP 0 $R p  @ R %5000S1`P`, 00 0000S 0@0 0 0 00 00 00 000C S,p 0 B R00!p 0 ?08#8 0300S 0  tRgRLR} ZR 0h B RayhklzR 1S WP0  00 "0 R\0 , A0C7S񏐘v`~}|{zyxfViTba`pOnmlkhIdgf]dCba@ hR 0000 00 0   lR00 00 0 00 000,! qW 00( 7/,P$0s,0SP$`0S@ %\Ѝ 0<<; 000(0 001( 0000;0,0 ``PPL 0A- Db@` 0 Hp_0\ES 0/RQ[ H0PH 000P R 'P0 H00C0S0[/QR(d1p \10 B0GR03/l0S-(0Xp/RQ[ '响$呍[ ?QS'0 0 TT 00 T0S>R$0S 0P H00C0S0[/QRگ';O8dk k G-04rrSp wS aS 20p/pP 0+S mS S !p 010PPZR Sj  `+ p` NP@P Z0H009 :! ? Z4 5000-0V8A= 000 000P 00 B0ER0 0@01/qph0p/00SЍH  @  8000004MQ&ʆM<0/0/l0S$00 0\0 / 00<,@-PN`p_O@P 0 H0d0000T0000 P Ѝ@tP Ѝ|  A-@ᄁp_0P Hpo0lFS 0/RQ[H0`H 000l0S0l0 s0` 00 B0FRM%0 3/UP P0 H00C0S0[/QRګ%0P H00C0S0[/QRږ%"|F8G-8 @0p` Hp0HS 0/RQ[ H0H 000 /%0 H00C0S0[/QRX%UP50P H00C0S0[/QR@%̅0s@- PHpO0LDS 0/RQ[ H0@H 000 0{$ @`  qp l0S,0$0C@To H00C0S0[/QR$vt 0p/00S00ЍpV h0Kp/00@ H00C0S0[/QR$ZGFFG-阡 L @0p Hp_0\ES 0/RQ[H0PH 000l0S0l0 sP0P 00 B0ERW$0 3/P0 H00C0S0[/QR{$uU`60P H00C0S0[/QRb$A8QPO-2`p/0 Ѝ@0P Hpo0lFS 0/RQ[H0`H 000p p `0 H00C0S0[/QR$#0S 0S K[ mxLMPp K` DbP1`I0C S0Kp/0 `0Q *Q1NP  `0Y 003pKp0  0P H00C0S0[/QRڹ#EDCO-4Pp`Z@00l0S0l0V 0 B[2pZD$Y00S `F[0! a0P 0 pD`HR` ` Ѝ `F @y`0 00@- ЍC- QM`P! 0Q0 @@@0S*pUUڨ0嘐 00 B0IR0 3/pЍd@@P0嘐 H00 B0IR0 3/pPPE<h8A-M0P 0@\1po0|F0"D 0S 0/RQ[ "10 p10 Rp Rp0Q0  [?/RS"w"wЍ0 8庨Pg: |p_:w,000S h`] ] ] \ D><00C0S/ 0[/QR/ѣ"\ P3O-M0@ 0 0B P R/U3 80s5 $ \P.UL`000p% 0p?tQ0, P"0tV0qtRt2 0 rR wR eR H2p/0@ЍPt 4 t 0 0tP10,0,0!0C R  Q?S[ !! |10   [G`!0 < P!D0 0@ @!H 04  <  P8Q00tY 㗤0P8000 @   B R  [?QS!,|!kUj 0 000~8UuP P09<<$Z Y Y PY Y p@-P`J@P 0H0@000 PPa@Lp蘵G- p $W 7X@P` l0S$ R0嘠 00 B0JR $ p0$G/ \ R W T%W    S BPUoS$0p/0$588@-`0@p Hp_0\ES 0/RQ[H0PH 000$0 0 000 0`P H00C0S0[/QR! Ѝ0P H00C0S0[/QR!ᐁ@-醸G-M`pРP`@P` 0 \0`00t0@D  0 0 Ѝ 000Բ$@-0   Ѝ T1T!0A-`p@0 Hp_0\ES 0/RQ[H0PH 000vP0 S 2 5`5:_ P0 H00C0S0[/QRڈ 0P H00C0S0[/QRs 10\ 0 00AAS/ 0PO-`P\0@( pEGq` 0JCW,d IP< T d_\0 EB!_\0 J\0 (d\00 !$ 0PEEQP00C0 ^CTH  d^\0H 0 EB!^W  0<0\0 ((    /0<0\0( (   /A-P\0@p`P <0ZJ\0U< p`00<0G-`\P@0<QS 0 SR0C0 0S dP `S 0S H0P 0<(0$0\0  \ 0C`PPEEኑ HpP P n^\0J\ 0pP0$P\0p@-@P p%@1/P {Xpi\0P 0CC1PU?D`FPUoP0T rsd 0`P,  BB!0   P 00\000CCPUoH0 3/P>00: S:H00PL0`up10@ AU?Q  0!!@1/0Q0 08 [80   B3/?pP )PX`pP `y @01/qpP` 0P000T 000000\0     l0 0000 \0      P0 0P00/0T 0L @-@ p\0@00/00@-M@ 0 01p/0>\ 0 S*7 XPR0*00\0 R P D0<0\0,4     0 00 .0\ 00 S:40Tp/00 00 pЍ0O-PRX4M@P\0     PU Pe; `0R/ 00 p\ C R0 0 0 ,0p00001  B p  0BSAQE 0S0R0SU `R  Bp p4Ѝ p@-@ @2 0p/Pz\0 P 4 Q'/\0   0S000\0       ul0S p@ B$ Q  Q     \0p@   BB!M\0 R lQ%  B pP\0  P Eo lQ  B pPp  BB!  BB!d\0@-@ R\0U l0S  B P Ѝ BB!X`APPEEQ\ ,00CC1 009 0000CP@0 0?@1/qp \0  000p/00SG-@R@ \p`P 0 , R0CC1 BBTB1!2 Q  BB!0S JU:T!1Z 0@  PV TX \0 R  BB!z @DU Q@-`MPPPlpW=U8 U5\@ <0X000 00,0C\040ClY0S 0P 0 0S 0Q ||00<0\0` Lp, 0PPHPT pptPlx 0lPЍPȗb~@-M$`p40@P(080 ,00<S 000P%0 0(0  005/00 ( <0 P Ѝ@-M`p40@P080 00S 000P%0 00  005/00  <0 P Ѝ04 R($0S//I-M$ @pP`00M0  S  L000`&n0 K 00 $ K006/$@K0p@- @Hp_0\ES 0/RQ[ H0PH 00000   pH00C0Sp0[/QRpp@<0p@-PUR+  @Hp_0\EU 0/RQ[ YH0PH 0000SR H00C0S0[/QR}pA!AA<0p@-PR+  @Hp_0\EU 0/RQ[ H0PH 0000R H00C0S0[/QRCp0  8P/0 p/0/ <0A-`@pp 0P S 2 55<:Ap 0 Hp_0\ES 0/RQ[H0PH 0000P S 2 5`5:M P0 H00C0S0[/QR0P H00C0S0[/QR^v0@- @`pHp_0\ES 0/RQ[ H0PH 000p00 ? nP0uPP PeH00C0S0[/QRړ Ѝ0P H00C0S0[/QR} v<0p@-@0 S 2 5P58:p@ 0 Hp_0\ES 0/RQ[H0PH 0000 S 2 5P5:  P0 H00C0S0[/QR6p0P H00C0S0[/QR!u<0A-`@pp 0P S 2 55<:A[ 0 Hp_0\ES 0/RQ[H0PH 0000P S 2 5`5:8 P0 H00C0S0[/QR0P H00C0S0[/QRڽIu07@- @Hp_0\ES 0/RQ[ H0PH 000 0[00   %H00C0S0[/QR Ѝ0@0P H00C0S0[/QRnt Ѝ0*0WG-@8Md` p=PP! 0P0P0 B 0d 00 0K0 000000000<PP$>Ѝ ` 0`F0C$pX:,? g=P  .Q>0 S$000 <d00A-PS@p  `00 P P`PPG-MQ``PP`@@p0 @@ H0 J000`1 $0S0`Ѝ@- Ѝ@-`0@p Hp_0\ES 0/RQ[H0PH 0000 0 000jP0uPP PeH00C0S0[/QRڏ Ѝ0P H00C0S0[/QRyt0s@- @Hp_0\ES 0/RQ[ H0PH 000 0 P`  qp l0S,0$0CPUo H00C0S0[/QR2vu 0p/00Sp00Ѝp0P H00C0S0[/QRs-O- M@` p0$0 PUHZC 01CР0A @D  p Q0 p p rPN H! 0 bP00 "0,pp P@O0 T0000/RP[ K& 0 %R sR %!G 0R%U sR$0P $ L0M @ppP CP KO Ѝ/| P@-@P r 0 00S/@- ΂P/@-P Q`@ R@` 0 B p 0000 0P@ 0  40p/00 S@00000 Ѝx404 00@-@ 0 B0@R8s@-@P`0 00@1/QġЍp8@-@ P0000 000p@-@0:#: S`l0S>  B`<0 P>D03/Pl0S\0 0S 0 y\0     0 ,0 00000080UP0080 p\0   BB! $G-@8Mp prP wP; aP= p3p/0`pPmPCaP1P +PjPR0 1` pP JHP `,@@J5PP22p/0Pd2p/0P` ͠`͠b@ P xPP<<<<nj@ H1E04<0 RQa /?  0S M`P! P$6:R_R,BrP!/RQ   010S6 0S 0A!0s R 0B!0\0,0, C\040C\0<XL`<\` P ,H Tp`t lx00l Ѝ iP<egff9gff80@-s@ l0S  B0@D03/@B\0   BB!0p@-@ 0 01p/0p  P R.0 000R 0  H`FM 00BS0f0c0 000 S 00 0 0 00lQ0 up@ B= 0S 0  P    B.pl R C$p\0   BB!X 0E?o24up7@-@ R(PCU j0 0?@1/qp00d0p/00S  l0S BP Ѝ0\0   BB!0@-00S  H00C0S0[/QRk D00C0S 0[/QR@Y H404 00@-@ 0 B0@R8@-0m 0 P0@1po0lF0  0V 0/RQ[ x10 `p10 @  0 H0V 0/RQ[ H0`H 0000S 4 T 40,0   H00C0S0[/QR 0000C0S  0[/QR n Ѝp404 R T4 J@-0 g 00 P1@po0lF01 t 0S 0/RQ[ e 810 `010 @  0 H0S 0/RQ[ K H0`H 00000 @04  H00C0S0[/QRk h0000C0S  0[/QRX ЍpH 0A00S/ 0PO-Pp @$ A, K`AR'd r2`P Td 0d0 1F0 ,F3$` `,`d`$000(0 0pGP Ѝ`FT  d@F< $ GFR 00C00, <00 ,0 $0$ 00/0 $<0,0, 0 $ 0/ 0@-@R 0 (  Q05+000 k 03/p0@- @ $(30$0,0(0l0p@-S0@l0PN 0p@/l0@-S0@l0 s 0 0 S*p0  0 S:00S 5P0@/$0S l0@-S0@l0 s 0 0 S*  up0  S0 S:00S P0@/$0S wA-@p`PP 02 Up00 `00S/0@-@ l0SH G0@403/p/@-@03/p0  A-R* p@`PP *PEUP!U @D`FV 03/p `FU 0@ T00 Hp@-@P`i 0 p@/A-`PpQ *@DT@!T D0P00pGW pHT 0E QP p@-@P`5003/p@ VU00 0HGF000000 0p s@-@P`0 0000$1/Ѝp@-@ 0P 0*<00 R/  $000S/< < 40t?t0H 000S03<00R0 0 00000040$0(0,0004000/@-0@l0\00`0p@-`@l`V0P\0\@000000 000 0$0(0000`0p/p@-@P PP]1 PP0P0U$P S1$Pp@0P/0 p@-@SPSq P0C0 n03/pp000p0 @-@S C SY03/p000\ 0/S-s ^LLO-M0 0`1p_0\E0 0S 0/RQ[ <10 P!p㜑 0 001@Tt00C0S  @[?/RSVЍ@V 0 H0S ?S/R[ H0PH 000l0S\0  0 0R 03/ppV 0 H00C0S0[/QR4@00 d$ ;G- l0p0p2po0lF0x\ 0V 0/RQ[  20 `" 0002@T10  B R  @[?/RSbЍPPRl0SO H0S  VR /RQ[E ]vH0SP  VA /RQ[P4 PKv0S 0000@`00d06,0 3/l0S0 U HP 00C0S0[/QRn0l04@H0`P   $p9C-M0 `01p_0\E0 0S 0/RQ[ t10 Pl!hq d0p 00P1@TD00C0S  @[?/RSЍ0@ H0S ?S/R[ H0PH 0000? S 03/0 H00C0S0[/QR4@00,p0 60p@- P@     0C00000Pp00 00S/S00/ 00@/ R    0C@//0Sp@-@P0U<S 000pS0/00S000$0S/G-P @0 Q<S0QSA $0S -P S$0S-P $,(0 0q0 C PCu H -`P pJ p WA . ` `p`(p//////0/2/4//h@-pO 0LDS 0/RQ[  00 @  000<00C0S/ 0[/QR/t0 0  /(0 R0  Q;00 00 S5#/O-`0 i +@ R;00000pv 0 H 0CR0 20Xჰ ,PP W  @ . Ky7 0n 0P0C0 000C0000C0000C00 00v0  `0 S0vO-p`M 8 BR0^@00 Ѝ d ,PP V q@- 0' Z0  0C000@0C B0 0 P0 I W?00 0$ B   @ B0C 0  0P GZ  6  6VF8F=F0 01/@-@P 0x-@ A-PR`p6@0 PW P0P00pp@@00@U@#/@-@/0000 0 R` `0/O-M@<p8PY  !S  0 (  0 Y 0K? ЍK U` U`` 0`Ff!W?0 B 1p/0 0?R0`Z?! ` `  U U PP0PEe!W?0 B?R0PZ?   0  0P 0 0  0P ꀽ0 @-}P`$a0S S/ , A-|1po0@T t\1 X0 Ѝ Q 0S (1P0P, pPR0S `` ࣕ0 ጴP00  00 ``00 0S pl `0 jH0 0 8|`XrW@]rL1A-P0Mpop@T t10p0 0pP0U@T pW00p ,ЍX 0Ds*0@P S l0 0 X00@0p00 0000S02 ȶ0 @- <=1 S   08@PXT0000D0000800000 Ѝ<>Up  @-  kPЍ@-  ^PЍ0@-MD00< P0 KP@ @Ѝ0,@-@  - l0@-pO00Ss  R R 800Z+,0 0  U P+꘲hTp?\2#1 CR8#S3#/p 42S/@- 0\ϒ\^[ S ;00 S024ϒ\^[TJ/@-p4< PQ[0Q 0S　 0p p p p $;p/4 04 B@-^OT[0\0000/p/ 0Q44//B@-ϑ\^[ 0 P90 S024ϑ\^[I0S@-  0p p p p ( ?QS[D:0S@- . 0p p p p ( ?QS[9@- 0p@-! 0pO-p_2US7 `ؐ߿EE @T , pP 0Q0S  3/ @pR BX2US `VGE,@3OEoEpP -*pT02E Ѝ(O-M$P1 S`@uP 0 %\   0p p p p 0 /RP[S 0/R^[S\ᠠ!100S (0^W[0%0p! p0 0 #1000 Í? 0 100 00C S 0(0 Pσ\[[00/RQ[%p[X0x[0p0[ [S01 "[ϔ\^ P!Q0?0 0?   0C  !φ\ "[   00S  0 Pϊ\[00[ 0 QP[0S % 0p p0 \ (% !0p p0Ѝ 00 P^[0 0p p p p0d7@-$$ 0QP[က0p p p p $ [83O-M$`1 c@v` 0 &\   0p p p p /RP[S 0/R^[S\᠌P0P qWv  ᓌ?00% 0 00 0) 0CS 10(0 01 Pσ\[[00/RQ[&pU P[B[ p0[ [S01 "[ϔ\^ P!Q0?0 0?  C 1  !P "[P0 00\ !(01ϓ\^[0  B [ 0 QP[0S & 0p p09\ (& 0p p0+Ѝ 00 P^[0 0p p p p0d2@-0Cϐ\^[S　0ϐ\^["0!p p　0　@. $@-$0C^W[#1S　!!0p p　0　- @-[ 0^W[0S　! 0p p　0　dL-G- @$` P ( P00   0p p; p9 p7 C ? SQ[\ / RW[\ P*V0 : , V 0:S P0C0UG2 GSP,@-@Pp` P.  /0P( !0 p0 : Ѝ@ 4+O-TM@ 㵊[0壀`0像ᣰ$0$P QP[ So0PuP0 P ` 0K TЍ(0 ! 0q1[ l" $  SCR00 Qπ\[0[   M 0SyX:0($8 80 0@@<0 0HPD0 AP 0 A  A0 KSnS P 0` 00[0Qχ\[S 008X*  0RQ a0$YZ0 % 0p p0 8/RP[V `x'O-\3\M Rp@$00$0؉[0壐`0僟00$P0/RQ[S0PuP 0 0 P`n. \Ѝ(0(0![01 0p20,00RBS 0 0 Qπ\[p[p  p 0 S✉0Y:00,@ @0 0H@D00PPL0B@$ 0P@ >@0 KSnS 0 P` 0 0[ Qψ\[R0 [ p/0Y* 0 SR(0a HWZ % 0p p0 D5 ?SQ[V `Xɚ;$@-/0 ЍO-\M  T3R 0S@[0壐`0僟00$0$P QP[S0PuP 0 0 P`F \Ѝ(0(0![01$0p20,00RBS$0$0 Qπ\[p[p  0 Sⴈ0Y:00,@ @0 0H@D00PPL0Z? 0P? V?0 KSnS 0 P`$0 0[ Qψ\[R0 s p/0Y* 0 SR(0a `WZ % 0p p0 DM ?SQ[V `Xɚ;d @-@ 0Ѝ4H-0IM,1 2( S(1!N0p4(!0p/ 3(10*(!\04. 4/RQ[(1 RU(!02 [?QS U0p=w(1  qN3 p(1 RqlIK (!00 _0 /Qr[  p p00 \(!I?Kp|0K 0(1(!(2,3/(12,!0S@B)(1 2S 2(00    (!@"R( 8" <(@P^[T>(10(! Pσ\[! 0CPς\[S8 (!0p4K04 0(1M0/RQ["(!04 [?QS(1 2S(1Bbp K`AV 0 0ोy Q AU(10@0p(1(!2S!;?  p p pH(!@ꌕܕ? 8 A-PQXM@p` 0S 0S`6```20 2S !0/RQ[ $P` 0  BP! (p  h0 !0p0, 00<4 <     80娇p0p/0XЍ00t0U V 0S05!00ph  p`0 0SP0A!LL0h".$p p|=DOdqO-M\40P0 0S(  |<@L@ 0DD0!`F2$22 2$ `" @ 0 @0$"0  0 0 "0`0`S @p0$@00 "p0 00800S00@80 Pσ\[`:< ;0p0S R 0$K>0414: 2V;S w0p00 0:0P 0"PP}:0S`7/070@,00k 00$0h7M!dd0 0 gppS$0P#P3* 0;000[:6`0/RQ[ ,A0@00060ST+ [?QSR W00 h6 妀p|P60p/ R D[` C T@ ” P@10@2 S0`2 +<5 6<5 00C0 [?QS뤢00x0 2@244=⠒0C5 U1: !) W  ᑀPr 0/RQ[ `;[ ?QS f  i400P ? 0 Yd4v!``0 0WPK 0PPLE  $PP $p? 0 R  <# 0 P!ꠒ01 㤲0r 5"P03pO00 S 3!0  x30PU)(0(2/RQ[ 33`~;[ ?QSb,0 0R00S PP   U P0S D=| MA J Q Mr 2Sh2)#dd0C0CP/L Q/ P*p0xP/1/̢0@-00  ЍMp/0,BPσ\[Ѝ/O-h0MS@2PS@Ѝp`p//SSpK 0CSp 00401SY04h Yi ?S/R[S W　 倀 0X6 0S#PIY5!0b@0CS0pS R8 R0s00; : R 0/RP[RH  0?S^[R8`q`40041S 00S#S0s00 ЍR ?S^[R  0p p p pp0 0 s [?QSڀ040040$0`00oPQ2!0gP @0 P 50W1 S: d2s/``0OS 0!QP[40@DsW 0 s  0p p p&p #p np  530 W00 $0 0404XPYPy   PM? S/R[\#  ?SQ[p Q\ 0p p p p? SQ[\0S00O D0_"@@0 11\d(0`0 0 P 00S 0S00/0/Rπ\[/Xk 0!p@-|`  p@HR@ 0Sv 1^ 0PUp? 4R0s00 `f0SP[ 1 0U@ ?SQ[ TP002S0PU0/RQ[ 0PEU  100S$ 0 0 R/RP[ p?U4 t0 pp0 R#`p?40000p:(jI 1G-0@p_Sd SJSH 0S0.0s0 CS?S #SS0CSB00CS 00401S R04S RS S0 !S /RQ[H  /RQ[0/RQ[`0000 /Rτ\[S  1 400401S 00S#S0s0 0P?S[ P 140 sV00 [/QRڀ04400`000?S/R[SD 1 Q82G/440 0p p00 p0S$c00 s3  0p p p"&p #p np 0!QP[40DjQ0`0000I 530 $0 04040pSQZ Q ĐPhYPx P 0 WQ[S RPd ,0!((0v4pFA-  03SP`SU 9S: T @CT1S !Sp? 4Rv  B Rz Q 0p0C00S$R !0p p p&p #p npMN0CS0p/?o$2^0S0s P@ CRA0CS񏐧p? 01S.r,00C0S$Qp@D40T0 4 &PQ00C00[/QR p  p0  ^00C0S 0 T``0004p?$01S |00C0S!e \w  B Rp04 40^04 Q ^@@00J0pOQ?oD2U0S   r  0 530 P[/ROTSG 01p? 4R500C0S0Q000C00[Q/R 0R37S  0!p p0eA Jp? 4R0S0SZ  p@- PaA`|P@ p@T0 ^   B ! RP[/σ\R p T [σ\Qڀ R pP  B RR T H0b DD0m~p/$Q RP]0@-!0p p　0　$@-@T$MP[0=   QP[\ R \ p p p p P0` 00 F 0]05/_00[0!0p p0$Ѝ 0@SK03/ A00S/0@-@3/000[/Q0P0 C C0000S00/@-p/0$S  @0R 0QP[S&T /RP[S00 R!00S0300 j0KPnP ЍC/RP[Se 0#/RP[S0/Q[ !pQ! p 0 R P`0Q U0[0P  R0 #  0KPnP0[00SPφ\[S C/Rτ\[S 0# pp/@-@$@T0@RCI 00_/R[0PS'0[Q  # "QP 0R1# 0/Q[ $!p p0 8j 0S [QWS0U$ -㰀0C![_U/RS$  [?Q[ $!0p p0. $!0p p00dG-p0$S1 @0 QP[``" PU& / Pτ\[S "U 0@^_U[Q0` `m 40R ϒ\^[ 0U  R Bϐ\Z[ R 0 P 0S Pψ\[S0R0300 .KPnPU  0SCP_U[SS Ѝ00/RP[R00 0! `P PU0P SP.KPnP 0 Xv0[QP[S 0S( 0S% /^[[oVX0V % 0p p0 !V 0 1 π\[ #[ ϔ\^ 0\ % 0p p0nm%!0p p0 [00#W@p @/Ps@-+p 42PQ@@ SЍp00POToV[@@S; \4Pς\[1A-@ M"P"@ p@0C  "G`P P*`00a BAx3SQ  0P x31 4qpQ@-`MP @T0 A 0 $ @   0p p`Ѝ@-@OX@SXG-ppOᴢP XP`uvP`FP P0E0y U00 V0S82S 440Szw U00V0S2V 0yY 0I1 r P Y  ` `wO V/~D0PЍ/RQ[ |4` P .DWPP@1|40 0P|4|4@ Wp1|40@0P|4U2S0 S [?QS` WP00P Pw ` 0G1  B R G/oY" R`G U R`FcpOO4Op@-pO|4`0`SB- /^D0/RQ[ |4 `.DQW`P`|4 0|4|4@WWp|4@0|4 @ [?QSpv B40B.  000R800P 000400/0@ 0 @̋00P/᤿0 0  , /ဿ0 0$  , /`0 0  , /@ 0 0 /00 0  , / 0 0 / 0 0 /о0S/0  @0 0$ S0Ã0 0C10<0/᰾0S 5 0D05/h 0 0H /P0PS/ S00 0Ã0/4P P/// @-VA-P 0@0S1R0B~ p`4  @ R00S0P$00000 00 0000C0000000x00Pl00 00 000$ @P #6,` @h0 0Q/!ꔈ  p@-  0 0 0L@0 0 C 0  0 BOT_U[X 000 BOT_U[p@ p bhE|'"0 @- ` /xP@-uPt(00/P 4uغP/L4S(0$ $0 @-,0CL4/f@-QP0S\`` @?P b70 0#c4# 04140p/x !  d! _! Z  U  P  K  F  A  <  7   2p  -`000S P0 0 Ѝpx(CX4,L0L 0 ?o2\0S/(00 0B0 b LoꐸA|G-1@0 R)QP :QP !*@Ѝ T0H0ph p"P `00 ` 0n`p@ 0E o`0 0` 0np @E0e@@`T nE n nP h00B 0 np@ 0E n}p p$؃T0p@-@0PD` `R40 9p@ |0zPph`?|A-p05P,0po0S> 0/RQ[ 40@T H$ L4S 4$0 0L4 [?QST 0/RQ[ <40@,D@ 0S40 LR  0S*q0P0Ӄ0 0C#@ L L0ASQ^[SxnPPi@PPl# LL0CP^[S @@$0d40G.a $l4h400CL 0020p@000/RQ[ (20D$$\$ [DD[?QSSh0/RQ[ [, ?QS80/RQ[_ \(0S10(01!0 (@?SP[ DD(0TU0DD/RQ[ P1P0P0/RQ[ !H 0S LQ 0 0 TH L40L4[?QS0D$0@00( 0?k\ >ȴ <D~L~H~:}}a8} :| 0@- P  [σ\Qښp@0@/RQ[ P@[σ\Qڂ@d꘰`s@-@@a@PU*00`"0 lpPI 0 1!0 M00 0 0^_U[ ( (Sڟ^_U[ 0 00^_U[X  44 S ^OT[ЍpB0Ȯ\@-` $pP@`  PUP1U@00 "0Vlp@ 5  000P ЍD@-0 S 0 P P  Q08 RP P P\ P  0 0000 {TO-`M p4000O/RT[B  (@! !WP (6(+0@DP\   4 P   P <  U0<@ @%% P0[0pSЍPPP4@O-Mt4 MpD`0PP0`4@0 PLPHPp0_ S Z 0   /p0TPC PPT  bPP 0I0i 0B Z`1`!`0  P0Z-  ^0TJ 40P4 0P4 0D @S    M 0 0 Z0 00 p/0l$|<wiKh@$Ѻ({ðXI"O-dM@ Ph< p/ 0 dЍT  104<00Z{10Sx   !  Q!&"  "P"   RZ 0/RP[R Ql d+ Jp R7@< R0{@p PD U* R  `P`V`&V%P`P%V%& _UoV[U  P PP`*f&`倠  U   ZN*04,0QP_ P |  *  T   p/ P PJ!<`VD`  ^* Q R  pPPPPTPPPPpp PP'V%Pp*S' Z8P2:T* Z[P2 :*V ZnP2:W ZwP2:*YUP#|P0S ( `Jp?0apWp 80<0S 000*300440*6807<0*9S0#|0@07w0D0*6n0H04[0L0*380P00080080\004H000S0(00D0,070 0T00 000X00 01$0@ X 00SPP*PQ#pP\ ^^ 8,ZX8^X^* 0C  S<#@8%%T 0  }xZ@\0T0000S 0,0S*T0 $)!$ 倐 000 S%*#1 0L21440 000 S f (0 R0#02S^ ! |D#' S82:* S[2 :# Sn2: Sw2:#Q#| N\9 0 4$0 Y00   4$0 \ 0000Sl 0 0S H  00 07 R 0S ZK:0 0!1BSD  QA:PZ 0 S 0 Q `E VP00030T000&0`)6#000C0< 0 X0  V <0 0 # % %#  T !    ` Q 4P1"C44o R\ Q40P  QH*xw1S T ,P UP044 P 2 " 0 =PPZ2"0 2 `E VP00010< 0 X>  Z <0 0805 V # % %! Q p T B4  T0S  ZP5':00&SPP#40SLP80 SHP< D0@PRP :P o8"`4pld_Զl] h[DN]f h7+ߦT  3(ɵhLA-`p00S00@T0 0/RQ[ "?oTP20S @PT [?QSBU`-PA  @pG-P RPP 1!0 @`0QPU*4 Q0Q*t 0C0X!   4 0p;  pV P 0EX S !'PP000FpP 0 GY 0PV0 0 0 # 00C!  0`0` 0000JJ/4OG-`PP1 p/0pP3c@S6 @G0g@@@D0DS0@D H 0 00   V 100000001 00U3痓iY 0 0 J@00 R*T 0C  V 1 000000gЃ{(0S/$0p@-/RQ[ D@`@P?S/R[ DDTpN000S/p@-`l@@P[?/RSDDT4 [$?QSpp@M M00 R/-t0p/0 R0L4X00L00RLH0D4 S 0 0$ `M4MD MPLT2A-`0HR0PSp@P 2 0  r @D0A0S*10<0Sp R Q 1@ ~A$ 100S |QP@PP 0D U H1H!H0 `410PU7 0/RQ[ ?oU@20S P~@U [?QS>T 0DU `0` `0 P@{L  p,&4֫יpުߘ2PA-p0APP.P1p/0P @` ``P!00S A @IPP 0E~T H1H!H0 `,1p/0@T9 0/RQ[  !?oTP20S  @PT [?QSU 0E;T L0L L0 @` }˥0P/0p@-`@0pOP0  ,Q SSQ0000@00Pp4000S X {pH1 A-po0P U @}  P#@T0 0@ T0/RQ[ L4S0 0  0 6#00CL4S\00 @H$L [?QSApF+̦xFE3O-`0ḣ0 S_oVRPU @] ЍV ЍO!0pF H#p?00S]hP0iS: @P2 p/0j 2P0 0GC  L   0c   ZA 0 dp< 0p H2H"H0 0U (2("(0 0K0 K0000^/R[ 0C0C! 0 44Sϑ\^[@u0IS@!q*@Pm  IbgT100S0 0 @PZ 0WDUS 1!0 /RQ[ 0 [@ ?QSTY@P, 0 # 00C! 4EpRH|ϣc7wdw|x,0p@-@0P0Sp@A80p@-@0,P0PS00p@PA<|d0p@-@0XP0PSD000@@*`p@ 0 p/0pA|4G-aRPPpOVP 2 0 @200Slp200S!\20S:L20PU 0/RQ[ F240pUp 0`0 00CWp1WPPp@P 0DU 1!0 MtQP0S?oU20S Py@U [?QS9T  000 S  G SW0DHoᨂ#X  B R0 0 'RR0000f 0R0b0#R00 0\|H@pte\s>{02O-M0$0 S 2b0 02`00 ?SQ[ %10P UA1:%C' U8@2:D* U[@2 :%F Un@2:G Uw@2:%IT@#|@0E40 0PeXT p4X 0V   [?QSDd0V Ѝ P:0 0 @ A\*0 "]0 p W Q P*<0< <0 [=lqqq|j;É0P  B/0B//0C-`0,M0SPP @ D   Pp?S/R[ #[?/RS"DTU,Ѝ:n@-(M@ 000000 0 000000000 0 0$0$0(Ѝ1O-0A0p1@0-04MS1Q@`P0P< < 0/RQ[  b0 0[$  T0 [p?QS0DT0UP妫 P7x 2h( -X4 (0<4Ѝ|mtx9m˗lxl./MRp1p@-@0P0SrZA-P@` P p!P 0 H0S00 S*0\SpGP000 A-`@PP p7P 0H R  P*\^pGRWTpp p@-@R PT@#*@U@pQ@M 0P @Ѝ/RG-@0R~0 SPA `Up%11Y# Y Y DL0 P"  DL0PP 0S   PP @ 0CPYq g) Y Y NL0 8P 0S   9QL0 8P 8P 0C 8P 0Py O-AMpMP`0@ W20 W> @R0@!! p0 SG 0sA H 0P0fG0d0 0ID 00A.014S1 \S01K\B0:S0 0 @0Z@S0 0 0 A!40C T0! 01  Z<pY 00 S^pCppRY \ 0S*AލЍ0GSDpI010d A !$R  Z  [ 0   BR RQ [ PG-pSM@ W ܍G[WPAWP0 (08U3#RQR@D @܍8 W܍G , `G V* 0 R1C,s0SaC FU:0 T1C,s01SUS# V@DV  VP PP YI G @01Cs0!C P R @- R):Q.7 R- :Q`R Q:@Q`QQQ1 RQ * l  01@1P1`1p111 0 @ P ` p   /0q@q%Q%0`@`%@%\0q@qq0`@` R`: \0* S R:-Q`R Q:@Q`QQ1 Rx1, Ġ*̌ ('t&|d%lT$\D#LU * 01\#  R:-Q`R Q:@Q`QQ1 Rx1, Ƞ*Ȍ ('x&xh%hX$XH#HU * 01\#  R:-Q`R Q:@Q`QQ1 Rx1, ̠*Č ('|&tl%d\$TL#DU * 01\# i0R: B R( R"( R"( R"(*  R$ R"$ R"$ R"$*/ 0q0cR/ 0SRR/ @@ "0#/l?l0 R@ @2//o/Q @0p/-0080@ !P^/PP 80@- !P^/p@-@Pdp q00cRR(  0SRRRR - @@Ol`"_lp#oll@P` T@@ @4O?o0C2#qr R/q0ā0@- Ȍ@P,  "@@$  r  SRR0 SRR0 RR/ SRR0 SRR0~pGx x*(BmE@go ODr2n !O#g bfcbFgfF#gLlLP#QgLL%CМ-$'g#EpG$$&g"EpG<(P+Q;L]P,QD0CP0Q `00 `SLa `^V `SJ ^J:`Y `S`F@N<0YS@0000S@0C00(00 0S000D000c00  ^` Z000@,0d08P>D0C@0PP0pPSSh P\]P SQ \Q: P X pPSPE ąL<0 pX#S44 `p4 p `0S00P.:PWQp 000c  \PY000A `pW*GG0 P*@@T00d0@pT0T0,/0(000, 0S2KP.x0H0SL0 PP H0 S3#(( P Pd @LP\@^00SS N l0 W|{{3{zz 00c 0S RR @@-qq@Og_gT U0 AA R \@ /" BOg_gTA "$ "$ "$U$#l Og_gTd",`A A "$Og_gTA "$ "$ U(#h Og_gTh"(`A A "$ "$Og_gTA "$ U,#d Og_gTl"$`A A "$ "$ "$@-M@Q 0S2@܍P @0 B     C0       C0$ & ( * , .  C4 6 8 : < > 00P00S00S00S00S0 CQ@ @p@-PT@Pp p@k 0p/0(0G-0`pOphPP88 Y` l 0 xp8P8PL00p`, YPVkf &mE o  @IOo#@LLK#LL#LL{# LL+*0FEpG#O@ bcbFORQ L0@-p0 080@@ PTQ/ A-`p@Pg0 0R0@-8@@0P^SS\ C00P^SS\0P^SS\0^ SS^ C0P  P 0 SS^ 0A-p`PU@ E5 Alp@-P @0Pp   p@^ Q/#0@-@ Q *0 SP SP 0\ bbP\ bb/SP0 SP0  00@-@R0S0q  RCR/-@ @oll@$P%Ol_lV TC WUC 0@`0CpF`&@ R/o b/A-@P  AvXpoP<5DPPd `fXp DPwp0<0<( $UX eeRO-AMp MP 0@ X;0 XG @R0@!! 0 S0H0sJ  `P H`Y1 D0d0Z pZ O A0Z14Sx `\B0: S0 0 @ 0`V@S0 0 0 A!40C0A. 0S14S V S050`0S 00pSV ! 1 R4* ^   QCR\0V:`V Aލ Ѝ 0< 00D0 0H00d00S*Z`y00 0 0C S SPZ `OG-@PMU p@P@܍P 0S   R48<SQ S@D 8 PRP@D  $>XP P  X0 ܍GPE,P `HH V0 0 R1C,s0SaC FTPT0 T1C,s01STS V@DV  P P YI H @01Cs0!C A-@Pp`@PU  0PS@P ^0@S@00@A-pPW U@"`EV`! U0@R*8040c !  !  !  !  !  !  !  00/0 0 /-0 S@  x.B0D0D0 0 @R: X2* @X       @@*? 8040c            000 0 /;K [0k@{ +  XU:;;  ++;H;  ++KK  ++KXK  ++ [ [" " $$&+&+([h[* * ,,.+.+kk  ++kHk  ++{{  ++{X{  ++X*;;  ++;  ++KK  ++K  ++ [ [" " $$&+&+([* * ,,.+.+kk  ++k  ++{{  ++{` +@ x.B0D0D0 0 @ R4: ! B!@ R: !B B!@ R* B ? /* :j;BѠpG@#OL;L;  !=" P(PHV!VA+K++ 'h-!=" :P(PH"T(S CнV!VA+K++ x@! DpGOpGp@-@Ppp@-P@ p@=0 Q/Q/Q/ 0Q/ RR 0S/R 0S R 0S /0S/0S/0S/ 0S / B!:!4@-A 40p SX*0p@-@@MQ P1p/00P0SSP0`0S 100`&0Vt@0C?o20S {0@Ѝp@/,0000  (080@`400  @0 $`S t000@$[0 000 00  04/0@PS00@Ѝp/H4Po/0R00 C-PPDM`P , S @0 ( 1040T VDЍlAP`@ P0$0T1p00p0S`@:t`1T 0 0p0S 000p'0 000   007/0 0@S0\ 0ISP 0S P 400S P0h LL0@Pm8LAUyTTT)TTO-TMpR0<00@0P80! 1UP `D 0p0`400@0S[0@0S 8100@$00S0   04/ 000 0 0@S0` 0R00f0 000 004/P 0@U@D TXW TЍ(0T @0 hTSSR`0S@- 00p  ЍO-SM@S 4  8 `0 T20<0L2p/0 0P0S0p0PS 200P%[H(- @<0`a 0<0R?,0(0 000 0 5/(0P C@  >0SS: T1] PP0ER @W,@0(100   5/(0 @C SR S0y 0<00S0 0z 0@D0@PSx0 tt0PSX0@T 0 Sߍ\DQTQ\Q QPPPPCPPTPoOp@- @P0PC@Apt0p/000P00!0\ Q  0,! R 0P//ᠮ@-@@`0 &PP Qh' P ЍpK-`P0SO@PG 0XSKPqp` 0PC0CH0 00M1 0< 0Q8R R/0V0  0` ` P  0S@ P 'L000D0K4pp/P ețBH,0p@-@0p/0P0S00/RQ[ PU 000PcPs 0S 000Pc@ [?QSUpLp@- P`@P`4P -P&pp@ @-@ 0SS&0&Z00@O-SMP<0 p1p4  8 @0 0S00`S 200`&@U0@<0p( 0@<0HPR?,0(P/0 000  0 06/(0P CBA  Z0SV 1] 0PH@(PH@( 1,0H0[H0 0(00CCA=P0S9T)T1 PP00 0 00  0 06/PPH0( S0SS ,KK<00S0 0 0@D0@PS|0 xx0P0S0 P0@p/T0Sߍ00KJJJjJJIIHIzIG@-0M@ } 0Ѝ0@- /0 Ѝ0 0@- /0 Ѝ 0 00@- /0 Ѝ@-@ )TЍ@-@Q 0Kp/0T蜦@-Q@ A  P0/`/`0 ЍЀ@-@ P 0 R000 0Kp/0Ѝ800 <Q bT  P (00/qG-$ 0S7Q0b A{AmB1L{?C<#d<L 0CΠ2 B06 R R* R , `00`!;\L2 dl\l\ `0 0So 0o0` dbR.lo @ L. d PR.0 ` pT8(bA   B♇i2Y  J!  BpL$qg Rp BL Wp  BnjX@@DY>p Q^0G-0`aXPpW -@P p0` U0p@L  X@@@T:@ @P Ppp@-`P @ 0 0A0CSDQ0<S p@0 A BR+ Cr R<">0SD0Q0S@P (000@p@-@QP$M`0 S9 + C 00C S:p+ C-SPpp01 100   P 00nPژ (0 $"1;Q;#S0#<1#;Q0;000PP$ЍT,00@  0><0B\H A-`0 MP,0C?o20JS 0 C R'"(JS 0%"00000C S )k m1P00R0S  2(05#QP' ЍMS( a!0 p0 00  mP00C S00CS0S00S/S,SP/SCpW (-0G?o   20010 00  km (0< -W%"1@Π0#000( 05# Sd\ T0T00<0( 05# , p$@@  h@-@f@{7@-L $AP@= 10(00P3 P. 00S, P 0 R ,R0S@@<0 (Jl000S \0\0 Ѝ0P 0(00<0TX`1 0` RP/@ A-` _b@P 0S :S@ A@10\pW1 T3 P`P`P(Pk\ 000S0S Px@L @`00(00  A.T@@@8@@AT|=3=`(`<<U<I<A-`PpP@v (X@ W0D 00W` ^ 4 00( 0!(   ##0$00@-d/RQ[ D[d000ST T0 0(  < [d?QS@el<@-ph@M`Pd0/RQ[ (UDo! 1 R @ 00 0 [d?QS-T@Ѝ0BP@ 0 \00 0UT0 P0(0$P$0  A(P 0 00<s9@;O-M0@P 0(; 0 P B 0S6 +  R /S  &P  P! P0/S a P 0S* |0 Qkp @UXຒ@P2DJ @$"00'$J@* `r8P:h0l Q\ `dQ\0 RP9 0 Ѝ>``8PPMxit4` `90PLi `0900 ,P. 0P0'LHP $0S0090 0 D 0 E / @ 800 H / !$04 00@ R P ` 0DPPe@0p00 P  $Ѝ R T P  @dl,lO-R㬵`0p 5 @ PU x5 P0SP`0SP$8 Q00>P10S4 0$000Q 0S\& $0 840D @0Q b⅑Q R$ R \4"XX0GP 2E!V0j<P40 PI 408 0010{ 4 R00 10!R r40 P 4 0"82P$0S L3"HH0GN8PG 000 030(,0"@Q 2V @@P\^@P  \2 Ë ЍPE? U6E0@! V  S"@ V @$@00C V v U! V  V0d 00! V  Q:W8h1Sf 0S00D1040P804 S000 0 !A 08P 0/0_404 (@ 0$0c P@ TU 0C\ @P00 nh@,dd*))(n((t&%/&@-p ' Ѝ䄂\ /-|<\bO-?|M@0,000 00$0(0 0$0 S 0C$0S 0$0p?000?040x?08000S TR0%S   BRpT0000 0 0S #S` -S 00C SP.P U007S00C5%000C S0EY OY0000zP{ma1NcwvutsrtRXlica;H\>-z``P^S00L _STQc< 0 00000 0 E0PCR00U(0 T` R`0X 0 ` 00000 0(0p0S V@ 0Y0C Eo`V*T R0X v0 @00Y0V000S0   E`0R0C ST R0X O 0R S 0T0 @ p`S 0 lY0V000S% 80s00; E`0R0C SyT R0X   0R S80TL S8040V0EY0{ 0OY1 S% 80s00 E`0R0C S>T R0X  0R S80tl S80T S% 80s00 E`0R0C S Th R0X  0R S80lO S80nUEY 0V0OY001 S% 8o0s00 E`0R0C ST- R0X c 0R S8o01 S8o03 S$ 80s00a E`0R0C ST R0X 1 0R S80s0  S80s0OY EY00SO0L괕 I`g0 <010rEY% AP  E`0RPP0CUR*T R0X 0 S  0= @0d Uv> 06coFVOY0P<`v0P(0<0J <0PF E0R``0CV*T R0X  @0S) 0 ( @pcOY* EY0ؐ0S0ĐYԓ EY `UEY `U0X-X_( V0fL 11b0  i R0V0Z*S Tp-00T  @0Zp YВ EY `UwEY $`UpEY `UEY $`UEY `U`ZEY `USEY `U0 Eo0C`SxTo R0X  @ 00V 000 S'0&00 E`0RPP0CSST R0X 0Y  S'0&00!0R@ps8 a R  S0'&   S'0&00 ~):FE$ F @@?>>>>>=J=>="=^<R<6<;;^;0̐0S80EY `U LL 40 1bP0 bQ0  iP-0I00-X L` `F`JV _X BV*T  @ ZUpPEP0L` `F E0CR ST RP0X @@0S 0 z@OY EY0䐓0Sm0Ȑj0 Eo0C`ST} R0X  @ 0`0U`1c`FEY 0U``F0`/EY  0N_?vn0!b0C0N0'Z `0 d ccS.0cc?o2[? 00C_!bA0C0GP) UgP(d cc066f `  dbbR bb/o"[/  NB_nA B vnR0Q `RU `EY* 0 `U0a0C`F`EY `UEY P`Uvn `0X$00OY0`A S%R E0RPP0CST R0X Z0S 0 uEY P  0`0C RU0 b&o`d0Ubf`2bfd0V00 0S 0S 0S00S 00 0S40&, 1 0 00 S0 0 + E0RPP0CSiT, R0X V  0 0 0S 0  0s8b Q @   0S$` E0¯V0CZ4*T R(@00X(0 (@-00 p`f<0U62d0cvZ*T R(@00X(0 (@+00 p00C0,  p|Ѝ@- PЍ0 0@- R 2/P 00p/` P@00S 3/P 0S /00 0ЍⰀd00qP &p@00 qP0 00ej ihi@i@-@ P 0 R000 0p/K0ЍhA-`V& `PV`V`P `0S 耕@XT 0[0L 0[S 0X 4/@T@@p40H(0 PS0 R0 %  Q  Q+S0000 P4@PPPpGp Tp+S00 A-@0P P `4p @T  U V Q UVQUV Q U V Q @-@DP4 04 A-P@T@P @0S`00V  P p@c_`rW`cPp@-@0`@T P4@P @TA7p}d}cPA-@1P@T p@T @P@@|0Sa00V ~P @c_`X`0S A }|O-10SP% `@{z@P Z @Pp P  YPP@pdW,u000 @P@|{@-@T00b `^@[A-pQ`@ 0P UY3UV# @P W 1 1P@`0( 00000@-@PtM P+P * R 80p/010 tЍ0b\ @-$ 1@0p/ 0/H aQ @-$1@0p/0/H ha0P @-@@d10p/0/ ap@-0@P/RQ[ ) H-000 00[/QRpp@S/1G-@0`p0/RQ[   0R: P  000S|00P  P100000 0 [?QSx``_0@-tM P@*PtЍ0 * R \0p/01p 0S$0p/00$_^C-p4M0/RQ[ A@0S0 0 @`@` R"0 0 [?QSڲ Ѝ PP d0 p/0T00P 000 "P 0S\ԝ]O-"`  30S V 3p 000000 " 00000=<;:98765432*)p&?+:h!x9v78k]p_n ".@D$4 !!  Tv!}@D$4sF  @DT,ЍC,ЍC-,ЍCs(,ЍC[( c10P81 440 P ,ЍC-,ЍC-,ЍC-,ЍC-     265*eg`@ iE&A-P-@M$A`DPp *  0 ~p@ @T  0pp@  P h0@p/ 0Ѝ@T 80 4401 0 K/M C&CA-Pq@ap0S[S!0S9G0P  0 0!S ^0C?o2?0 0 ]R0 @0]R R! CR 6"  (R0@S)S@tt BsA-P q@ap R[R!0SF0P  0 0!S ^0C?o2?0 0 ]R0 @0]R R!0Bs0S 63 0(S0@S)R@rr@rO-TMP x@0(000,0 0$@5p00500 R4 [R40 RhF`%P  !R 0^ B/o"/   0]S  ]Qt` 0)Sb 4*$0 1Q@!BQ43(Q@ |R)RT:? ERH@B0P0  HB! (q $ Q'0` $$P, Q@T ,P U,`@HM0$1( r |Rp )R@D0$,1+U| !U *U L3$HH0?U} @U|0@pPP|0 @pp0 0 T2P0 0 |00 0PM@,P$`aV,00P TЍU:A,0 0  0 pP @ T$P$0U0:@ T 0 0/S0 00C?o2   tP T 0 /S 0pC0o0r0bP|0P 00C01 @0|00 00 0 |00 0FPx 0 ;P @$0, T:*, 0 +P P$U T 0 $0U @_0/S0 00C?o2 P_e`qxqn?0q>?Q=z=O-P?p/M04Mp0, 0d040=0000S/00D0=00080=8 000H0=000#0X000Z  Y =00I /P=000 0 ,3?Z4 +Z !Z *Zt Y_0/Z=000S Y& 0/S#PB[Z? \ZA @Z=00  0(S=0 0P0 0p =00  Y0(S=0 0P0 0p ݍ4Ѝ0/S0SP.SPPUp=0000Z 0S} 2 Y 2 Y 0S P=00 / 0(S,=0 0P0 0p Y .R00S@`*T?T  $ T=0S =00 K/ B!P=00S =00p=00=00P0X(0C?o20S ?T Yj 0/S0SdV` @l( KDB!ePp p[T X% ! DR":320(SN`F @Y?*H0 @ 00P l8S lx>W. PP/T0SA Y!*0/S0 0=0 00=00S1P =80R0\T=00@ 0S 1@ᆮ`F Y * 0S 1T0 fP P8 I@0S CP000 Y 00.S<U0!S (^0C?o 2 ? 0$0 0S 1 0K@C10C(0X00000\T00 0S @T 0S 1@00-S0]SS0T P0^0/S0S@[T0:SA 0 `P :R% ]R.1  h0$\S @L  ^T @@T Rb R 1PZ 1P ` aB\ 0 SK0 P00]S$0SB PZ=Sq6, 00Q0 =P ]PR`0SDpL HPP0 <0ޣ@P  0$# 0@TS 11T 41 0ƣ P0#  0RpA@p(pWp!@p@0\: Qr 10p00pS0p00pS@0\J*(0 S10cT 0S .S4, 00 0 P.PV]PU `-Qp ppWp\MR@W0SR P0-S[p]W `4rp 0S4i@[W0.S3, 00  0.PY]PXS `X T0\p@0X0 00 LP@S]Rl0p `0FPe  T@LX\0<PTLT<Q P@Q d0T` \rP\ @@0 PA0 0 0S 0@P& ` R!ptT S94pp3T P0 Q L<Q\0PT .T P\0W 000\W00S`pW 0S 0 /pwT@1W:Q 0\Q \ 0S 0`s[Q:Q S :Q]Q0aAQ0F=Q 0S 0=S0]S0.QQ .Q]Q 0 `@<0 q0v#8eJ3d$8(1 ^ 0A\Q} AA<0!R BP000 Y 0 0.SBU0!S 0*^0C?o 2 ?p p0400S 9 00 1 0` `8 0 K B( 8 \S  $ R" 0S  R )   1`  -R ]RR R[ @  0/S0S0`[S :R0$ tPp:\]Q>h0 08B,P 0"0 23 p BaL^  Rs0@00]S40Sj @~=R@(    Q$ =P]PRp0S$0(#00PB0PS 000cS 000A00P 0Q| B0@000Q0*( PD@^,!XX T>:Sx (\ @@\  @ S9> @ \7*0 00 B0( @, ^P1P!R :S<   000c  ,,D D ^ DDT T ^@P^ ,@P U, P @  S@D$ B00Q A<@ S $0,0 R0 0@% 0S@ ^ S 0R $   1.R4 000  A@.PU]Pp-QQ,\IRa, 0R R @ -R ]R <p 0,$Q<00[R0.S3 00  G$p B.PZ]P$0\pV T0`@0X000\00DT@VZR $0 pEPTTX\0D000X\TSDQ X0PPPQ@ l0\h d Pd 0@0@ P00PP0$  R- D"s0   1&PR 0,S<00, R 1SL*@0U0Q DPPPR T\ X0X0P\ e `80\R00Sp R 0S H1 00!Q 8\Q \ 0S 0pW[Q:Q\ :Q]Q0aAQ0G=Q 0Su 0=Sr0]So0.QQg .Q]Q0  h L T@ORNl,0 p, Q  rx,0SO$ P$ PI B 0]Q4Q00C Yi*1O-`0Mp/MP00T0S) pB00G; 04@PI @P @V1!`@ P :pP 500  00V1`@ލЍO-p `P@T00U0S0F00 `D NY  D 1AT@ 0!S P O- ,}0@-MXPX@P@(@ $ 00 0$000Ѝ0Ti7@-0000Ѝ@-00000Ѝ@-Ѝ@- P`Ѝ@-PЍ@- KЍp-pp p/1p-pp p/1 p-pp p/1p-pp p/1p-pp p/1p-pp p/1 1/0 P/ 0R:// 0R//P/@-@卹T X00@-$M R  0 00@    \@A P "U  R $Ѝ0 R@ 0!30@-S@ LJ  O-PX1Mp`0`/ D0@Pp` @ 5PPЍT8  >p@000"S 0PTUPP@ >p`000"S 00SVͷP P @000`000T00@pO-$M@Hp`P  0 00'P 0S "P{P $Ѝ    0 00 0O-0`pQUW 0S@p@PT-P2 0H?o2 000 0UBㇲ P0 X  R  0  PZ P0 00 0 0@ 0E 0O-4M`d PX\ppO000b0 00 01 00010000006/`0p000s 000"S P 4Ѝ0S000s  d S0C0?o20P0 ZP P @T/P@X0 S0S  0 0S" R  0S0S0S/ S/ /S@00 0 0S////.O-4M0p`00 0,0@  P0!00 !0R SS 4Ѝ00 0  0 S"$     P0S $$ X (0( (0sr, L "RS  t o  B/oS" R0 0S0R0S"" "\  R$ $ YHoQXYX \Rsr(0,0,0( x00,,(^x #"$Z(z Z p29&ll0(0y #"$ Z(z Z 2?&0(S: 0 S69!0Se 00` R]R2 R 1]&0 R 1^&00 0 #00 0c# 0 0 #00 0c#Q( R& R 0|&0 R 0}&00@ P0 ` PpVQ0 S* 0&0,3>]Xۋ׊ӊPP O-M@@@@ @$@@ePP9 uH P cK0(p,90@8po0 0ZyPC (9c0S Y00P`P* Y P Eb# C RBg 0 0$80T5$0S Z0$0$ӴPP]70Vj hTQ ,(P(#'P(000   KQ000 SD^0 07000 @\00 0Q   S{ 06000 $\00 0Q B\00 BRZ*;VU>0  000 ຿P:000 0+P0(nਿP( ࢿ5P  0   `PP5/ 0"P8 00 00 1PC 8<0@0s0P7 4:p400"S 400S`0J S 4:p400"S 400SX0P @`Z jp@D 9 `Z ꀠD k1P 0P6 4:p300"S 400 YS 4:p300"S 40XZ`⠳P` @`Y0ip@D080`Y0 P{000 0$ ?0j, b`Z P H(R# C R0B 0 0 0P203Wl [ pRP 20V } 200Ux vu 0  S, QPP[00G  SC.T2t1 03`10`T10P FD10P8100P <$1010N?P 21 0$  Ѝ虎# 0  @관N@ P@^00SVR x,`3 X$@4 t\ppH@܁p@-@TpP@O-P--8gM M6 0d6 0Pt6 @ 0*S0S00t6 U 0*S0SPt6t&?o 28KTO@WO Q00 SQ006 `6 \6 f6Ke6K6 e>K 0C C C C+0S[ff[e6[Vp6 S0p6 p6S bKV NN@N0 006 0p6 UCK I 0SP HV I 9D4D 0S 0 0D6 2]KPED ;@4 ]>K0C x6 㵼 0 D. _/ `V P `VS ` SU CSf6[ Se6[p6 S`R,nU4   `DC>K 0CP dVX h*`:,WP_ R{/^r (0 QP QP xxV0   %  05 05Kt&c>KPK 0C A6 R0A@6  t R  RR  0 6 ,<\KPE06^  ,P| 0K@v`0CW\ `VpI$ 0I 0x6P `] 0S S 0S  Sx6 p2P` 0S5[Sv9@ tKAW)pP0gDU|6 @vW P:6.LL 0tV|   -P* 0 % S``` @f |6S86[S @.<,  (*  00h @`P@f K06  0=K0C00P 30 K`XP0 S0 76[S=K 0C Ce>K06  0=K0C00P0SXPZ P6S)0T" <6S@80LV `P !1Kp/A000P10 =K 0C,6/PLV "PU < 0P6 @zP <s:z7@fV3 0|6 P,iw= gp Z7[Q Q QQq x t p Q7`p)D~}4xzx̽ |Hhvcx8Tr8r dmkl|$k"ij4;i<пTgt6 V6Pj 0 Z0600尢00 0 00<600<6  0(0 $  Q0800 $YVj80@< (06  T00P0S 0Pt6 化 ` a(~M0t6 06 t&,0*#|6 p6Se>K 0C C C C&`P 1 \0e.t6pv `v (0Cp6 S>K 0C6 0C6 pF0&YP0|6(P!,0p6 $ 0 R ֵP p0H00I00J00K0 0L00S &R 2)00I0J0K00VL0 W0 SJ p `06 06 0D5 p?6 vl3&00aSQ 0H0P6  C& P&pP`0H00I0\ 0SW>40 45 2?< 48 S0% (405 ,4 \&000)P 0J00K00L00S W40S80S<0s 4)0 6 WSv   p`400 p2@0000H0]&6  6P06 U1v  Tt65 0Х SU ,0/RQ[ 6S E@ 0S KAP 0$RP 0$R x6 | 060,[  ,?QSڍ|6,t&0 0d&  S00606St`'d6S&0(&x6 | 060},|t00@&X  <6SP < 0SV XP6T&0`06c`V `Foo0obT6 `P=K6 MV 'p? ' u-P6s:7p/00s X6YS sy/PXUUfL _kL0 0QD 00$  R piVֽ00G- 0BY 0p p@|0@`p/0@@p` 0p p@(0@`p/0@@ XL00G- 0BY 0p p@|0@`p/0@@p`ρ 0p p@(0@`p/0@@ ꐹܽp@-P@PPP pL @-Gp@-P@`0Sެp0 R R @Ѭp@-@P<P  0R 0 0P0pP p pp@-@P`P pP  0R 0  0`0pP p@-@T0S.@-ٵ/ @- 0/@-ЍO-yMP2!p0C @pY1 00A0cL@@10 00!1  ' p`d1p/0PyߍW2U40P.Ⴕ2 $0 2(pp,02000 PP @nA,``0# h@0%8 pP4PU I ?oX 20S p0p(0p/0PD|"P,fO-KM@圐 P `p- %0F 2"1  00 @%J?0 1 0FS! 3%0S`AV00 RB=p 0 #P,3p/00S 0(0%0  B/0 P0 p  p20p/`Pp  pd20PX   (% 0 3/P Y0S/S 0 *`0Sښ p0S135H  p Q b R0P0S0 2pq 0 +piE0S c_d0 m p ` hPP 0 QSp `0pt4@-  0 VЍD(| @-H@- P Ѝ 0cE0@-tM P@PtЍ0P $:10 p/0/ukPH0 p/0/0@-tM P@PtЍ0\ <c 0@-tM P@PutЍ0O- -GMP+@7q`P6 '1(p000 00p 0`0۝˝",吐@0匳000p0 0ۅ 00$00000 ˅H0Xh@;&v1 0Gq`P*< 4e! ' (00,00000400#"$"P000%#`0/@0d0D H0h0/P0l0T X0p0/`0d t0h0 v0p/`f0`Gߍ ذ0@-tM P@ uPtЍ0p- =1D100 P    1D0p  Rf  @  Q @DT Q 0 000pQ@p W@p@     @   @pW@  @0 X  @p@ T@@@0Tpp@@@0 Qt-PQ/ PQ/P/O-Pp`0 K @%P0U, [* ߥ 00C00p H@PP Ѝ  B0H0SPPEQpHP0S PP@0Pl0g hh0P   P  ٰ 000SR+**A-AMMA>0 00pp1 A>`0 00@Pp# p` z"0PS -R @ n"0S UPGPp@0S ,R @S1AލЍp0 SC-AMMA>0 0TpP xp@P G000C SPA> G003`P  jP AލЍ_)p@-P@0TSSp0@0@-M p0Pڍ s@-PP@-ZP@(@-QP@(-DM ^4DЍ-DM U4DЍ0 00Pd/uP/ 6p :0/$ q0 & > 0 !/ -?S^[0\0[[[0[0[ Q1B/p@-@QpPUp/\0PP0P  p$p-pp/-@-"(@p p 0`p/0 Ѝ@Ѝ/xO-Mp8@`0<T0  @ P 00S  0Oq p@x0@`p/0@@ЍRp 0Oq p@(0@`p/0@@ gpswwA-`M@ pP%p1p_0 0B RS000#4@ۍp,100 S@t P pP p @+Tp P*  Q R P@@0A.S@0 000C SP00U0S @$,wv@$00@-M@(P 0@8@ @8Ѝ00-@-p0@@ p 0`p/0Ѝ@Ѝ/(up-tpp p/1yp-pp p/1yw@-ppЍp@ `P7U0 S  R 00@W"p@-MvpЍp @ P`VP٤P <ӤP $̤P"R"""!O-@P AM M`@@pp@( P !  PA> 04@ %P 00 Cr S QE@T  AލЍ  Ὺ0P 0 0CPß S$$pp Ȱ + <0S#0 P 0 U  Ⱁ.R  P 0P P  0 Br QT@ xV!U,#B0ESBU000  @ p00lP R  0 0 0 Ѝ?U #  p 00LpoLoA- \ #q p@0@`p/0@@p`P@n 0#q p@(0@`p/0@@ +njnn00A- 00S )q p@x0@`p/0@@`P@m0 )q p@( @`p @@mi4nmp@-@Q``0PV?0S UpA- \ !q p@0@`p/0@@p`P@m 0!q p@(0@`p/0@@ mh,ml00A- 00S J p@x0@`p/0@@`P@rm0 J p@( @`p @@mhhllC-`(&q @ p `p_ \pX@\>\% ЍB0LSY0 R B\0    0@ pX00` D00 K ?\ #  p00k(kkjp-pp p/1vp-~p p/1v00S00/ O- MD_K @pP!A@P)3K/p0_ FC K300S `፧M@g#0  !Ap@Р H3 Kp3  Ks ` KKKc p #cK 0SoK 3  37 $ A B2 s p$ " 夃 S   Ks02K 0 K R0 @2 <040#13 $2 03 3 S R  p 03K=K0C3 03 03 2 2 2 2 2 1 1 1 100S.h 0 1S% ,   A  p  R A  @ p 00S p#  \:R p0Rp $K  $K ej3gmonXf|p`\@-P@@ RP0 40 0000 0(,1 A-@0@$@@D,   0 #Qpp2 (@pd Q2& 0PP崘`P `00P0TPP08` PzgzJz'jzzfz:$ A 0Gc@H,0 @-0@ Tq 00@x\@-$000S b0@0嘖8D\0 0C 02#88 S*0   /A-@P0QMP \D  PЍ @ ЍA\`p"0P0P0A20 @0``00P0 0p0  00㹺 㴺P P 꼨 @@B0 00/] 0p 0  /   d r  !33\P/ 3P/0!0// ^|a 0p 0   /   d  r  !33\P/ 3P/0!0//L]` 0p 0  /   d  r  !33\P/ 3P/0!0/\_ 0p 0  /   d r  !33\P/ 3P/0!0//[@_ 00@ P/ p  d  r  !33\P/ 3P/0!0//^ 0p 0   /   d  r  !33\P/ 3P/0!0//\Z] 0p 0   /   d  r  !33\P/ 3P/0!0//Y ] 0p 0   /   d  r  !33\P/ 3P/0!0//XL\ 0p 0  /   d r  !33\P/ 3P/0!0//X[ 0p 0   /   d  r  !33\P/ 3P/0!0//\WZ 0p 0   /   & !33\P/ 3P/0!0//V Z 0p 0   /   d  r  !33\P/ 3P/0!0//UTYx0p/00 h00s0010!0\/ Q/ 0,!Q/ 10/Xp0p/00 6010!0\/ Q/ 0,!Q/ 10/8XG-@"l0p/00pH`YP kP PP@d0@@WQ0 3 3\ P/ 3,!P/ "00//h0A-p0@p/0`LPP᜝P @ӢPh0@@VQ/ 020\/0!R/ 00<1 R/000/S*@-FͥS*@-AěS*@-<뇜0@-R6 0@B^ 0CR \p@-P`@ᇢP: p@蟥S*@-Q0-@-R 0  0|GЍЍ/@-G-`@pBP 1p/00 SSYЍ0p 90000 UPC 0  CP< Y0P S3 0-S.  L 0S'   Q"WV#Q  rQ 0-SV030#W0SV@ @D *W@DP@@ET ?T @^@ TR@- R*@- @-@Pq1S A4 U@?0@ @$]p-Pp M P 0  BS Ѝp .M0O@@ 0#@@$Р=~T20H200Sd0 P 0 `00$0.@PgT Pm1 @0 04040,  ; [S@0S6`60P011 0 040^40dpS   s2[0T Gp4;t4p$800 00C0 0t4儼P40S0 .P+ d0P$0S d 80s4p/00"SޔP [?QSګd[X ɔP tp߷Pp. P ᅞ80 0p?$0 0 p00 0t4 0C2P*40S .ƘP3<<0p? 00  000t40p40 0P40S .㪘PT#0[ 080s03$ 00"SᐔP80s2 00"SePuPP& 0P.S00@!000p400p V':50S ᖎ8hP(SR 0 RJ S@t )P@m40 P2 P X ᩞ0 P?<`F8#8S 0S 00SG 1P h!%0 8P{VؒDFD`Dnqyw w һp@- M@mP0p/0 Ѝp P Ƿ@P 3P <0p_0`JV&  00 B(A@@p@-@PP0Sp@轍P⻍PO-M H P@P@p@Tm`P01ip/0Ѝ R@ \P U\ \00A Q0SS\ U/pW1@qp  Q Q R R ≱ 0C!S Q Q RAsP 000JPZ0S S Re0C?@-$M`P@P$Ѝ` p :`V 40p/00S 00  ==P/ ^P@-@~P0!80p@-pO0 PP00Pp`݌=<O- LM`@ PaP UPᖋpP000M0pX0 @K0Tp PP S ɴ@00 0@0 3 K K3K0cK `40 00K2K-0KL0Kp_\0 08 4K\0 00`Hp 100S X0S ኌPp?`0 \00 @0 0<0 T0K80 040 , ( tp`x1` 00S VHP( \ R00R0S P0 d0 PP   d0 AR P PSP X0S 7 K PUPU^ ^ p#R @0@0 00 b   LP ;0;99@-p0@- @MP P0   0ᡵP 00 P00Ѝ0O-P-P0LMH@Kp PPFP @HPK0K@00@0 P<0DpP0 @0T%P 0l0 ၍pP !00MX 0T0 `@ P0SEl0T 0R(82.$$0Q@N`^ PPX0C0  L\ RRP P ^:P P ` B PPP00d0 P0PU d0Sd 0S S RP00P0 D Q$P  Q R Rh `CX  0@ %p% @T0p$000\0 V0SS0d 00 BPd C@P&-$Y 0 1(ⓝ0' 0120 0000`F$Y0 6p0oh016d000CS\0 0o0 0T0 T0 0h0 eh0T0 R0Ch0 `0@X ` 0p 0Xp x$0@0`00`0 0t0 d0\0 h0S0Sh S00S  0X @po 0p 00 0Sy RRu R@00 D0 R0H0$Sg @T@!!Փ a!!Z C BR= 0S0\0 0   R R $X X  0h 00 B`h X \ ?,("(R  R  R  0x0 0S d00\000,0800 001S S $X X0 0X$ 0\ 0 ?<8#8S 0S00S0400S \0t00\0006S S $X fzX0h0{Xyl 0\ 0 ?<8#8S 0Se00Sa0|0^0CSt0 0?00Rc`0Sp0@pP0 z!G S X| 0 @|@-@ p 耉00@-P?< M@8#8S 0S 000CSsP Ѝ0000C S H0 000 { 00SQ 0p/0.@-@Hc@DA- @P bPP@6hphp bX` bPV$c,0P00`& `~,0[S  /s7@-P@KP P Ѝ0 P @ 0 0#3/P00 dp hs@-`P@PP Ѝp@ 0 0#3/P00 dp hHC-M@` p&PP E 0zP p p X0p/00TS SЍ @\R` Rp#W+O--(M0 00 P 00 /RQ[ ]F@0S %P @0P 0 Pσ\[P P_ @t`K@ P   WKP9 @ TP X50P@L [?QSڷ]T= 0U @0 0T00 00@ 0S  0CPς\[S (K K 4`Pxp0\pKK0 HK P`  H0M T0 0L`KdKI`Kh`KVKp_0 |0 :x0 @0`  ᐱp 300S @@ӇPP` 00 @` 0p/ h KHPKH D | K@  < 8 4 0 0  0pH#  R 0  Y0  p0 Y R RX R T  0 R %0   00 0?dPU Q T Q  Rk QA   Ip^ ^PL\Q QUPRQ᐀ QQQ QSS `0 0 0⾇0@ ` TS C.$R  0008C 00$0` 00P U0R @@0 Pσ\[0 `0k@ 00 0`q(q`pHp(0(؜@-@P D 0CPς\[Sh/RQ[ \ 0SD⻆, [?QS@;\j\jO-p-( lMx  @0 MPP  t  FK hK?P @T ጆ(Kt KPd0HKP |0 0\0 3C8CX0 匮H0 T0 FKLK廔KIK [@P@ Z@T 2`P@ l \Kp` p 0  p 100S 0 @0M`Pp?0 8 h0KH0 0D0 HK4 p0K@0 0<0 0 2p1 00S LX0  T0d0 X0XS#ࠃࠓR Z |\ PPx@P^ ^x ^pxp^ 00HP "("-M0 0P೸ݡЍ@-PQM@4,1p0PP`! U  U 0 P032 X ER00PЍ P P 0@ HU`PT 0@ z4 0 @p *L 41O-M0po @pP 1  0  000C S6  p0   "R) .R TS"0P0R x    P X @D !R :W3? 00(00Ѝh8P@-@ P 00S00Ѝ@- Ѝ@- P Ѝp@-M0@\`0P000  P:,0p/0Ѝp$ TPO-\M P P2ap/0b \ЍOP0  C  X R PP@ \r  r tQ\@P Pr tUPP@U@t0( `TtP PT:`Vt% BZ,*0p/0\ЍVp TV:  U U R G. b VP ۓ @T:00! J  გS'h@- 0@ `P:\00 p0PG UpW^W ЍUPS\0.W0.\0S0@PG-` P 1ap/0  ЍGP p Q  GЍ0:S0Q :PP Q^J @U)4!0%%,*00@Ct Z0Ba@CTW0C>A@CT70C::S^X  Q 0U:)  .S@U:jPX U  DPEC E 0`Sp@U^ Y*p@-P`@ 0p@i,0p/000  /D0p/0 0S/#S,S00!6/`C-`@Mp@P@U }00 0 f P k. ?@Ѝ0Q0c 0@,S :0CS0@#SS` \M0 8 P4 0S#S\L, 2, @-p@M` PᮒP  ,00,0Ѝ Px  ,00d `@0 P4 - тh[Ř ,[6+ P30O-IM C   PPRPD2`P 0p9020 0200200 @ EP2/tB@o P 0PB@e P 0,B@[ P  B@R P 101 [0 Iߍ pl00@#TT@@ @ P ɑ[ @T  s0 ] P c-7S 0' 0 SP~ 0p/0 0Sv @J#Sp | x>0 ( PbL Z V*N W<#\Y@Y '0lDWO-MXrp,0a `P]82@[TE(2 p000PPN40/RQ[ W1@T ⓰[b qpP@@0D嬁1 0 [p10@h [4?QS$WT (1`P R p0..00 ЍQ 00P@ 0 QP\0!XX0 @ 0\ Wl\V(\G-pX`幐P` X ᰐU@E @ЊPxT<000S/p@-@P0PPp T0@-pO00S000S000 =0 0SC@0004S (00000@肳 \ @ , @- ᵨ0 ` pЍp@-P@P P00 00p/0@p<@0p@-@0p_ `(00 дỀ00`p X 1p@-p/0@T 0S1 0000S;1 01`0@P, P - &0S# R  Q$ Qd!(0 R1`P: 0V 0S᭯ჵP u`pp0S 0n 0V 0S000S00 =04SVѲPk@jdqƿ0Q Yqo@-BP0 0P/0p/@-00S p0 ll00SP0 LL0{ R@30C0S `[Z>40p/0P/@-@TP/A-`@PpVP00S 0S   SSA-p0@`PS 00 S\1S\2S\ 00S  RB0 0P0U0P0S 0S0  O-pM0@P@D`S/~pQ00ЍP h00 JT0 0 ` 0 7/"PV 0s 0SO-MpD@P@`T @P0p/0Ѝ 0:/P000P V<0080V  Y 03/0 0 320S 0 > [08 0XG-p4P@0`U PP0p/0Ѝ 04/@P000T X 03/ 0R000 0@O-,MpP\`@P`Vp |`P 00l0`L20p/,Ѝ R! 05/ P000P 0p0R gl0U uX 0s 10r  0S 0  0 0T000kXX! T1 0 P 0h d5/pP X 0s100"S U00S3S/ P00 0 0 S0T0R$0 K P X0$S ,XX0$03/ ?oRP20S XX 0 S HO-P M@00B8p SHL` 3p000S6:R0S XbW<0Z+D 0V"0002p/0Ѝ0 S* [~0P0X"0pO P}0V00020P00@ 00 000000C Q7Q.\.Q/ X nP  ȋ 00  V0  0WD0@0P  PW000D 0A.Q \p  0:6 0P:S( X0X0S.S  P ~0 0000:X.X0:## ]hhDO-M`pP@ԤPP Y00T@0000ЍL0 @0@000@A-@pP`pP 00S<0< 880j0 A E|_hA-@pP`pP 00S<0< 880F0 AxEϰذA-@pP`pP 00S<0< 880"0 AD?HA-@pP `pbP 00S<0< 8800 AHD p@-@P0/RQ[ Q0[05/h00 S " 010[04 [?QSQpC`CtO-CEM@{PPEߍO<oP, $2  00BPP+ U`|V&0/RQ[ [Q0[SP S S [ Px [?QSڀQEߍDP@ <1 00 0 PU U {  "!P@U0/RQ[ Q0[S 0,Ta0[0h [?QS7QPU1|lBBŭLA@A-pP0/RQ[ P00@TCNz@P `  aP|0 a0a@h [?QSP C<P0 1S Ad@8@??0[S S //0@-@0PpopP00p Ѝ0@ 0pt`t0`0008PT0]!PP0@0@80A00 lP2Īͪk(0@-/RQ[ RPT0 00S @[/QR@~PQ 1H>>>@- 8@80@000P@0Ѝy8m۶@-y@P 0D  '0x00t00" $ O-PtOMYp[ p`10Oߍd`0P0@0`/RQ[ Oᙢ`P p 10[?QS)PHq00S P ( SR0HL RP 0[t0 000[?QSO`P%($) [?QSO ⧃001)P.3p/00S S(1䰍#S 1(1$1S 1$10S00d300QAQ񏐴 0CSc#230l 09000000p?0 qғPF=Pv[ʨ2#!0i2 000   0R : R .PC R :RQ0P 0 9P 0N/1Py[y1p0&10V ᦡP. 0/RQ[ Nt0[S &00 0[?Q  0P0 0p/00 S 0 0wX Y4ϡX` Zm Ph&D,"DcBv6&ƨ(0[S +/7p@-P@ p@hs@-`:@PЍpPᕰP [ 0t0  050p@-@[T`P0|0!xx0s/RQ[ ?N ` A[?QSpNp@6CV0p@-`@[TP0x@p/RQ[ N _[ ?QSpp@FN5h  0[xP S@-@0"<<0 = S/42"002 002< 002"0 02 002@ 002"002 00t2D 0 0h2h"0$0`2 0(0T20,0L2000D20400$4"80 P (" T " X " \ " ` " d " h ! l ! p ! t ! x ! | ! ! ! (! ! ! ! ! ! *! ! x! p! h! `! X! P! ,H100@10081000100(100 100100100100100000000/8;-,%0p%D"41d&,(A %<Pph1;l1 0T0 00PX ܀00Q?pIpQ;5Ap:4@8p400h!0K$0K0 0`l1lpp$0s0"SZxP 00h>P @sX\0P ;s0P 6sWލЍI FP[<|pP@IL0Y* 0HSZ 82 440|pP QZ 1 0u pHPJ"0000(@0 0SG(}P 4p0 K( 臒40ST0s 0s>$@ 0000P pK܀ 0O 0IPZp( ! XP !Kppf  CP4 pK  D40S040S2"0p000E,3GPW`㤫C-MpP8`\  JP@ 00 0z@1ЍĎO-MP00`pؤP@$p ^P@  0S0 yP ЍO-$M<@H0d  Y``p `C0P^P @ $Ѝ{P$ 00CQP0 0L0 00P JX00S0Z0S0X 00{0P@00,0 P0  0L0P00G@- $ 0 Ѝ@- ($ ЍO-P 00@ "00ЍP +C@0 00v+S|P400P @0"P \{{A-p P `P   "P@  0 @ ЍZ{G-`(pᯣPPh0p/00 S@@Ѝ vP 0 xP@ XzO-`0pᇣPPl0p/00 S@@ Ѝ  sP 0 NP@ .VzlO-PU0-pM0`p@ 0 ᅣP 00@ "00ЍP +C@0 00ʖ+SãP400P @0"Pܼ( ࣥx ¥A-p P `P   iP@  0 @ RЍxG-p`(PPx0p/00 S@@Ѝ0+0C vP 0 tP@ x,d0p/00 0 0S 00  000S/Ķ@-@0l0000O-M0S @|࣢P l2p/00 S` `Ѝ0 00{0p0p?0$/`P  cPP `k@V W20 0{P*!0 00 0   g0 R``F0alP0`k0`E `F\~00`0U00 S R 0S\S V  00C0cPPV 0000V U 0 0C 0 "lP        ~000v(O-`PB !Pp   (R 0 R   [$ R 00@ @,R p@,R @)R JZ00"  Ro ЍRR I pGp}I ` GF0 @d@-00  ЍO-M@`pP`P@F@V 0 0.0P R D0" ЍpU D    0(0K{0P  $   0  0R:RR R P ER[  StP P 0 *P yP@ -0P0V jPF   - PPF   z j0SPQ z P00t   @ P,PP T 00@AP`F`FP@p^PPPPqWVLy@@F  M-@P@@ 0S4LzP<100 @00 0@ S,SbX S @ y0P0X PH0S 0`F`FP000S ǃp P p00 00  ᦂ`F@D00 0<000T~$TpHtm <mTlϢmA-ph `P ᖢP@  0 P@ |ЍfmG-`P(0@p/0ЍtpPP0 0P0p/00 S@@0 vP@ lO-PU0-pM0`p@ 0 P 00@ "00ЍP +C@0 00I+SXP400P @0"P0| 8Ck WA-p P `P   P@  0 @ ЍkG-p`(ዟPPx0p/00 S@@Ѝ0+0C 3sP 0 tP@ 0jG-@`pV00R0SP QxPPp@yP001@0 0@S 00  0010 000   O0 S( T! 0 0  0000 @UYT P!*xPPPP 0V *(0" Q Ѝ0S 000@ @Q   S: 0UPS*00S (h<O-PU0-pM0`p@ 0 P 00@ "00ЍP +C@0 00B+S5P400P @0"Pꤪdf4A-p P `P   ۠P@  0 @ ĠЍfO-p`0hPP0p/00 S@@ ЍrP HQ  0 sP@ rP$fG-(`p6PP `0p/00 S@@Ѝ0S 0 HP@ \e,O-EMM`p |@P 2p/000 SPPEލЍP 0H +L 0x$J$0P(0 00J0 <~ JX_P*PBp1p/000 SPPHP0P Ug$Sg 0U0SP$$8ep HlP 0P0 ~P@0 SD00C P 0hq0P 0SXSP00gPP x4P000@ !000 00S0[dO-#LM @pp 0 P00p? 0u $0 0 0 . `P $ 0 0Q0w<`(0x x02 0 v 9X^400080 0,0D  <  @    B\pB:tRD2" 0Q  R 2 0x0@0"y0  0RS0 00SS0 00SS 0 00SS000SS 0 0RD!  00 0S* 07 0CPς\[SXx P$0 0 0 p`c0 0 uLЍ 0CPς\[S0000S x%'b L@-@PM P`pu(0 00`Ѝp@- M@P`0 0]\00 A 00` ЍpO-FMM%P`0d X0;\0,0  0f0@00 0t   00 0 P `@0 0`,P T4~ PP0 @4 0 tX`0P eFލЍap00D0$x03 0 w XTHL0 10^*3"0p/V0N4 0 0P0 0#Q$ $ R  XFkP LT08 H X 0140< 0 $00$0Sw 0T 1Q 00Q*V 0 ,0R0 4RV 0 ,0RV R*   P# 10 w0 00SS0L 00SST 0 ,0Rf !  RR0Qʐ4PX8!p 0R0, 0S" ,0/ 0CPς\[Sx @0 0@0Wpp 00 ` 0CPς\[S 00 0S xѳ z]5]@]T<@-MP`p@t(0 00`Ѝp@- M@P`0 0Z00 A 00` ЍpO-F M@ 0 S|2P000d60 R @ _H&h0KD   900x0 S000 0 00 0|0 00c00 000 y:  00 0p@P1 dK\P0Xp h0L`Rq80P0 pP  0 0Mvp x0PqS P0SPr@00 0R#*@4@ 0 y KT0\ 0 `L0`f` Xt   P 0"@0\4p/0@t`  ` S*Q>tD Q@ L@ M p KxP 1$KA00 t0  DK6t0S# @a`P\ 1$K A M0 @$0K1 0v0 vX0@Q!000 0R*U 0 h0R @up a!0`@ 0VUn 0 h0RhU T  T 0@T u0\ 00SSXQ p!  RR0H0@ 0p1p/04@0h 0S3 h0 @ 0CPς\[S t  00d0Kp p00 Ppp p `@ 0t0 0 x K 0CPς\[S |00|0 S tOXd-V@-MP`p@(r,0  0(0`008Ѝ@-M QP`pp@r00` 0,00(000!ЍRQ0@- A RQ  0 A 0@ 10Q /@- M0ϓ\OT[\  RЍЀ0 Ra! K0Q 0 *d `  lp@ 0800 @T t0 0 X!N,O-DMC @ 0SP000300Sڐ3p 0 DЍ qh#d$0 Pu(@- 0 0 0>`P$  $ 0Q0`,pW04p80   P*x 2r 0I0 0 0 fp`d2 0 p@0 ` @P0#0ppx  u 0$ 0SW $0d 0CPς\[Sw PVSppppV p   R 0p@wa0 tW 0p0WS 0 $0Rppcaw0 0 @<0 p00p/0p@ 0CPς\[S/P,Z w 0  3a0[OXMON3N'K,0| 0 @\ l Q*W+ 0 P0R@@gd r1 0@  SW 0 P0R@PW T0' JP @@ `r04 00SS 00 00SS,Q !  RR0d!p 0@@0P 0S P0 $ 0CPς\[St `@ 0CPς\[Sh00h0 S t Yn_ 00<0KX`p p0l0 Pdp cIDtH!HGH @-MP`p@n,0  0(0`00Ѝ@-$M@P`p00 U<0 D 080`00$ЍG-M p0 0@cp)0p00S#`_߆05 0z*. IpH000S Ɇ@0zJNC$@JЍ؅@BtO- pxM` @PS\00KM0 9K mn K PP1p/00sS:`0 ` ppYq9 p000S Y$ p000 SKv X0 `p#@ 0:KK߹P@ F0W#"@ KBL(@BG-`ppP ፵p@h000S X000 S?PTP@GPU`D0O-pP`p M p@@\100S L1p/00 S8@0 S5T0* 1J!Р pp?P(0  R) B  Ệp@! (0  R (0  RPTP K0@D`FPP @ РY:ꔂ|܁ā 0@-S 40 000Z@@]?>>O- PM `pHm2p@0 00 00MPP`!Pp 0K0 00 0K  CР 0K  C 0K0 00 0K0 00 尐K0 00 wP`ᬶ,2 0 0`P 0Cϒ\^[S K! }p0!  R  R R RWᴐ @T ` t0  gP0W K ŲP&KxR-K0 3p@ 0S b0xS(0S 0S aKF K0P0:(0,1 00xppR 0 :[`P  0@0@0 0ꘀXG-0s @Ѝ0S   P^[P@t T p@@P0 0 R 0, 0R000 0 Pσ\[00aԄ K0P0:O-M (p0`(7<` 800@q PЍPQQP YcP P \  \QT pW:[ P@T@k QA-`0p_ 0 pf@P&PL00p@  Wp$000S XzzpzA-MM`_,@P9@ >l0/RQ[ g1 Db@P0p/0@T@[ ?QSڋ1T p ,p3l0PS@0"@p/0@܍Ѝ n@yp4yO-pMMヷp+ `Pp зp@X100S 9 TT00-E@ 04DV0`S 0Sp 0@p/0@@ݍЍ@8PEI;<0#P H"P@ P 0S Pk R\0"@p/0@8 P [ .aP @n@6x$xwp@-@PPpp@1`0@-/RQ[ 0[( ?QS@0p@-@pP0/RQ[ 0o[@ (?QSڹ0pl(@-@h0/RQ[ j0[@ (?QSڙ0`0@-/RQ[ K0[( ?QS@{0l4/C-`OMp̊0 @ 00P@@0AQ 㽊P  B  pnP0p0o筊 ;U ᥊00OߍtdtP-$M 0 B  0K$Ѝ0@-cMh@P@ T0-) P  R .m0 = 0 cߍ0t R0%@-L0^ Co Br RL\00S (0S (00 l` p$pA-pP`PPPP@P0pW-l8`G-pP`PP@P0}P@P0p0h0p/000CS &i@P,0- kxdnA-PaPPЍ201SL2fcP 2_cPB@°P tBt2@QcPᶰP LDB@᭰P,嬴p@ 2APkB2@.cPᓰP1X1 0!A@pPMPzP+00 0[0-p=cA$T00 0MQ01$! 0=S0P P 0p0mR@-ᨴ0P S W 0y00p/0Pt0-@0J c,U,,,T++ m+q+p,04kh@-@@Pӳ00A-p@PfP óP+ 0د-0P`0 U0 P`! 0įQ -; PP  0PlᕳЍA-P0/RQ[ ^-ppFb@P ``?b@PW`p [?QS}-g@P@ P W00@@긲,'80p@-S@T0Sp 0p@0/0``0PPPV 053/p@-P@@ aQ` :Q S 0< 0$ Pp0TL P0@D000Pp1 R x    `000 S P00p @Q $00 pc(&&\TO- @DM! `  B!R 10SP Q P0:00@   KX0   @ T P0 X 000 100M08 S 00S d: `` 0ि$" 81 08 !3Q" $B  Q Pj "RP U $q Q0Qt:9  0QQ\[Q0 0S:/o00P"8#4P 0,0 9DP 0(P d0 00UU(0S' < 0 0}40S  800S$ 8Pp`040 3=80D0 .=#KS0:D@V l8 00\&$| \0\:48 000f~$P0@wQ0Av0@80A0 S 7!0C!02S1S x7!tt01 600 H 0ST0S d .1011 40040 ,0S0!,0 0(0 PaSl1S`0 b0V  0Q1[ol10p!!p]<  BL  RWZ .\ <  R S R1H0 T P 6 0q.R T \ 5.0 rp0.0H0 ]τL0L S0<0!\ S *"DpPpH0Dp 1|1S $2s0|1,0S0!,0 S ~ V``0Vlqpq BR 0101400S0 0 AQ0R0D04 R0s0ST4@0S 0S #@T 0S 0C01U, 80A! 1Q 3/0?HQ- Q S2XP#3 0 T2 RHWP"Pp U0P W DP  Pp U*Pp(``0S T;00S TK?F,Y 2"04 R Q Q8A8 0 Rl2"hh0@ 0@S 0A `Tp T T\100@  &T00 RH0 TH0ST>P T1 `Tp Tp Td10 R  T,00,0 010 Rp4>0S 1 00CY< 0 0[00 RX[ XKbl@% &$$%#6$$q$/"~"#!H"#[!""!!! |8\T8wAh 4h0h 0p@-@P:Q p@w>aVr>$0 0,V>/X 0P  LX@Q/([ X00/ V 0 0 x00\ P`00XH00P8[ X  /ᤤUl[`P!00S 0!0-0@sX000P0!S0Cc&qJ PAdp [4iO-$M`!1Hp0010 0dk@PA$Ѝ R2 L@P ZP@ Z 0J/Q! 00S/S/0 0\1 0000PUW Z00!JPP  1  0#0 S  RP P1U PQ` 2K ]0 0 0 Z/ R0 W  0 0 ]000P3< C-pl1@`0X! \ H!00SH0 S S:SS00 ЍQ 0S 0S ZP I 00:S0S:S0SIPP Jl00 0#X 0@ " J@TPJ0b  -!R 4  00| \//O-P삟 r M p`IIP20 "@P=IP 200 0Pxt   /P 82"440²S( 00^(002 0 0010@10S1#00S 4   0 1 00201\ 02R 400  81 001U2 0S/ uY0 0M\p @0PÙHPx 0@ PH0SI000 0 K:PEU0\0 0 ".~Zv } EGH 20S/G-p@0ؠ@ d 0S(`PV$0S!  lPPU x@P Q U8R 00@0ESS01`P`PP@ O- CM0 > 00  0 20  0S L>#HH0ϱP0K C 000 h @LI ᾤTK ᴞP*]@P=zp/000  ᬤT P ARp ,I0S'I1 `"I II0 !> @  X0@T 11QR1\P mH` K\P\P\P @< 00 0@ t   00 000 K3@P 0Z/0d1010 030 R 2S0000 Z?Z p02?5M0(P21 ;00 00 ;0 0 0 0 0C0 0 c0Sn:0S 00 P0 ?o20 R00S0SR 0S0@S# 0 C R0S:0 08 Jāx 0 H010S1`010 01`1S0 0Q  ƒ B R0 0C `1% 0X^`M (00 0  0pPk YPP P @P# UTɟ P   Pj 0sP   `P` NO   `开`` `` ``NR 1 ^.\^ ,P,^ P HLP@ P@„DP P7$0H`d0  S` 0`10"0ypp 0Hh08 kpWP011P ᓧ0 0`C0cV  0R#0Qd:A P|VP `010!0#đ!! 0R#V]:0S 00 R  V fv0S0S8 ! 50 R, R4 R8 R R| R R\!R<Q  R  d R Q00p0Sx 0SSt 4u 0 Q0A08 ĦpTP[ 0 pAappWp!S*    GP 0R  aXH20 ᗦpvSP.0  Φ0PHSPzd _SPSPSPSP%SLQ0H Sq50aN Q0GE Q0F! D<0S D00 S (3{ $$0d0S l00S 2 00S 00S 2 00S  "`0x000S 02 !  @ XQ Lj 2000S0\0 2/## -  QP{`1S 0`1 0SRDP  X1`01 10 00@2Z_`a尀Stq 0@2V cP0S`1] 41{%000 ! 0000P0 PP4 08S *'h.To8|YQtd@bQsOD9ooDo8o%pR~b&i-{StdK&4P \0d!0@ d! 0 000` 0!p     0`0S [? R !t1 B@0!x1M1]/ 2  0 0@0K΄1 00S X0S 40 1 00`1 PX0 R#0SX0S 40 1 00aOPX0 R%@H2S 10S 00S B0 0S 0 0S 42%880HRPZPRP{O-M儂 rX( 07'0\700X:7'07@P00X0 `V0T0002,0t7 T0 $00#3 2S L0 R87000S(70   0/G0vNP^T$00  T 0S?0`006040G080[0q#00 V$ q00 V 10S 0LL0 6 0P G0T 0T00``H00  0 q50q TG 0 00  0T00H00t500 q00 P5l 0P0H0 500S500Si`P T0002  Դ  JP JPDT  X0 R 2 d40q  T  G H 0 (w1!S1"3 P1 X0S 40 1 00 NP -1 01ߍ `x40< <P 80 @ 0T00H000 p0[00|10S 2 0P T000T00G H00 0 @G0 0T00H00 0 q> $00 4,0S@qY 0SA yRP) SC1  0T0G XpH`>T lHP T0G Gp.H2C2S@NR( 0`P 41i/01010900LXG0S 0 00p0 2S`0T 00`L0L0 0(00pH0`1%4c [   3xxoF G-pRd00@000Pp01 00S($` 0 "P  |aV0S00`V 10SU 0 0P  0 `|0 0P 2 H00W  0 10Ѝ p@-`xM@.PP@ϗP@НxЍp0Q P 09@p@-@PLP@p~LP @[Tp<00xQ/A/L! !R02 !@O-M0` S S -S` +S`00 C R@X`p<0S 00XS`  0 000@0p?P/UU0PE RaEQWPEAEQ7PEſ  0rT0 :X@D!@pXY@tpЍA-@Pp0P`>(0X0 R@  R @X 7#   40 0h20lA0+  O-`h PQp dC@P{ @'>t1?0  T0|2X tX 000140110|Q0 024000110 RU U[/!  0|QURN [/P IX[?1> P/Xp@PP&P00Pp倀APP 0 A৚P000"S  (AP0 P/R/   S0 p/RU00Q ЍU0 0 R!! [?1D  , }G-X`P1p@I&00p!RX I"C P,*0 0l!!  ! R0 0A  p000  ` p 0A[ 0 -PC-`M0@` p ' P *P  0S 0 |0 0 P0$0P 0  {D000@ 1 (ЍCЍ\0  0@-0O-P ppQ 1X`g!000:l0  0* R 0#3[@T $?>0P !0R0X g& @0L000S ЍO@S@S Ѝ( G-`pP0Xp0S@  @TP 1S1S1 0S @0 <<0YP @4 h/C-| 6"0B4l!z1R01 d& @  Llf 1 VWp `W01 6 000 *xp1 SMpM pJ50  (5p00S0B w p0QWBB:[?0p1[G: pp1Z:   0X  `V[p1V: P40Vl1 1p!RX0S  40 1 00vHP2 010  l1 q10S0A R  R1 SPP>S\00  0<0P p3 l0 e ! 0P0䡇S 7 01l1 H2S p<k1S 0@    姡娱 `ll110S!B  S 0S0^౐[P2S!LL0 [1 0  :`DW QX 0#v00$Ѝpap㥡p1W:1 00l11 H2S  0Sp1S`pX契0p1V*l1qi?00 SH2S 131 0S0!0`W 0@ 1S |V01 1 = 0S x0E"tt0_   7hu$`@-ML1MH `0*UpP   p R( [R% /R@ 0- 0g@T 0D /R;PPPڍЍT/00 @D pO00x 0`V FL@;PP  ^OP0  p/R >2O-p #K`P 0M@ D2 0S@K p KX-WppP37  0D"00 0%3 P 0I 03 @ 3E:90?Vڴ2@ 0$0K1` ! 0@S%S /o" S R 0?VD2M @@0 D$KR`%S!g0Z@@ 0*S@0082 82 0.S0*S@  0ZSlS@0sS. '%S9 dS>dSM /<" xS H" 0 0282H"s 80BS<2S-00@$0K1@ B!`@_uS xS`$0K↡8"  tK8"r  R!  $0K 1`B!0 0T S T $0K1`B!@0F$ K1! !Qy1mH-@-0, , 0  ЍЍ/L-@-0, , 0 ЍЍ/L-@- 00Ѝ Ѝ/-@- 00 ЍЍ/-@- 00 ЍЍ/-@- 00 mG-`@L1$ RR0: P!p Y00 "0 @p00 0S 0A/0໣00 pR #L % %4 SSD000\4 00ЍA|0-AT2s 1 0L"00R*0p@-@PR0N0 b0C00PH"P PU:Q xPBQ:AT20P1 0! ! 0p0/0D8T2@-s@$0 0@P`"l00d @-@0d"00cPA P$ 0p0|41@`P-$M PH40T"@0 0 00 F$O--o0M0 0p0 1`x 0@S0S00p0 x?00  0S?00QDp0S*4/ 0x0d0 S `QZ0d0 `12U:|p 1Q  R , 0 00Q  (" @R7 .  >0P Px>0@p>0T|0 (P!T0Kd0  S Ap0S 0S|0R(0 T0S0P ^pAP \PT0 0PP  p0D @ 80 4h0 T0Kl0 40K0 =00 =00 l0l 0P` l 8 R| UT 0t0 0S=00 <00 <00 0` S `0)4)$y0 Yt0`0 pX 00 0D Y 0#2 000CS0" 0IZ S T,  $Io 4R<2X0  S0, 0 I/o"0 0t  4 42  X Kx0 yX08<282X R P  Q h P Q R +0  8/0Yo IR񏐳e* 0S, ):Mp00cC00  AR100  @P 4:00 p{:0d0dp 0 P)  0S  1 00 0R*0  PPP 0|0S R0T0 h00P0 0S0L0 `0p0sQ(2S000`00`0 0` Sl00l0 l 0S!T0KP<0  KS K 0S R0T0 @00P0 0S0L0 p0S 0S|0R(0 T0S0P ^pAP \PT0 0PP  D @ T0Kp0 40K0 700 700 p p0P 05%p   t 8 !    l | T0SD700 <700 4700 t0Sp'4'$wp0 Wl00X `0 00 0U W? 0#2 000CS02 GZ R06004Go04S<2X0   R0000 G/o "0l 42 4   X Kx0 wX08<282X R P  Q h P Q R %0  8/0W GRHEDCBA@?>=<;:98 Ql#80 1 00R  !^"X .U N^P0P4^<2X0  0R440 0S   0 x0X K#wX08<28X R  P00 Q hPoQ  03/X0S0 `  "$ T2 0St }t T20000    ` Rp 1 0000 300 300 200 0` Sy`0 )40 0)$yt0Y`0 pX 00 10 Y ""y   BRt0 IZ RHIo4Q<2X0 & R I/o\"0t 44 !   2  R00 x0X KyvX08<282X R Q   R h Q/o" R @!0  8/0Y IRt x 4_^0Y GͪWpPW|Ͻ׽9y*Rd9`9ն-&٪ˮX0S$  0R0QR*40 1 000|  Qt " X0 0R !H`00`0 |0T ?R0  0HC000X R0  `!T" R0 A0T2 000 0 S01SX2 0X R0  0X R T" R0 0X  T2  00h R" 3/00pYE 00h Rf\" 3/0`X0S$  0RQR*40 1 000" Qt " +X0 0R !FH`00`0 |0T ?R0  0HC000X R0  `!T" R0 0T2 000 0 S01SX2 0X R0  0X R T" R0 0X  T2  0  U 1 0000 400 t0S#p00p0 p 0S0Sm (0Sj p  R  17P^ 500Q48 p '40 0l0'$wpW0X `0 00 10 W ""x   BRs0" GZ Q %  $Go 4R<2X0 %  Q\ 0 G/o"l 44 !   2  R00 x0X KktX08<282X R P  Q h P Q R &0  8/0W GRJD @CH100WR 9X0S$  0RQR*40 1 000'  Ql " X0 0R !F P00` 00 SX2X0S0 0X R T" R0 d0X  T2  00h R( 3/002W 00h R18) 3/0+X0S$  0RhQR*40 1 000)  Ql " tX0 0R !F P00` 00 vSX2X0S0 0X R T" R0 0X  T2 1z01d0Sd2S 0Kd0Pd0 d0 0d0 0 p@-00S 3p`@PU j2P@P3p 1R!0S 0C013|\1S  1@- 00 !0L  0$ ||0ߛ10 B 1 111100S/1 00 0111/1A-B`0P1@2pSW 2S ` 0 C @1 `2Q 211 `FV@- ,@ @ 0 00S00Ѝ,O- 4M80 3@#P00`Vw PAH Uq  A00M pI<1P0 0L0 0D0 000s0@0 @ 0 80S 0Y$2s P0E<0 V: UE E "<-<03<0 2S 0C R80S 2S HY0H!T0 =;<0 ED0T0QL D刀 -;@00 `R  B Y2S 0C R QH K0pA <0 0S1` ,K M  , - K8 R- KV, X 1 0ך!0CD0 @ 8 ,D0X @ `F8-`[V  DY 0< R" Р BR0(PK(0 W (0T 0 !0 (0T pG`1<!QUP0!LL0:<00ؤ/ ˣG-Q1P@0/RQ[ 9p1pN\T1`\- [?QSG]`0L^ \0S \`L?S/R[ 0p p p p \0S `0L^ \0S \PL?S/R[ 0p p p p\0S `V804 0p@-@00PS3PPpT@- p`PpP@ K0T@# dR*D8 @ 0(  D 2#00 Ѝ%H10A-P @Q 4  000R*Q00& 0 0 `V 0W *0 0p`C\:Q R:X200T8\ʡW\0 0 Rx 0/l 0 R/0 \  -0^\ R0 T8$0$ 0  000/40 0p@- `p 0 /PP@ L%@@4 D :U"@P0pO-`P‒M  p2@00\2p0 0W*D2P0T-R/@P! C EP@!9@100orᇱ0 Q0 R]:Z 1j"0D0@P0RH: PUB L R81?"440඘X1X"T\(R 0I"0D2H"R*0J"0 Q R @ 0BHD"0 Af9pЍ`T28CK4ל[ܝ5O%P@-@AZG-@PpT`0S <000U E/WG/`/TX P /p?-p000\ 0P*P00 0^01\:p0C 8G-pؐ0 Xb0@0S#`F0S V 0$0@~M.PPt0 p 0>0.H8[P@XA00 p0000H8< A-@`0`P0/RQ[ 0pW0p`V [?QSATD"@JAD2H" B8pTD"@JAD2H" Bz8`D`404 0  $    000/4@-|P PpO JD 0 0S 0 00SUa 0Q 1 00010S:  0 0  Q`U €  Q  RP 0S <`P0S100Q "@ P-0S- 0000  R P€PP 00S0S $0S 0S 1 40P1PL 0 00SdЍ0S0SP  0 0 R UP1 RU P~.Pi0S0000Q @ ` Iܾ %eM`ՓBA-@`pPT1@ PP @p@-0 @^`p0N0 @|`rP V U 00PA U 0PN UP @p 0@"0 B UP Np0ppO-$MapH`@ P0 00010` 0E 00VF0P_P 0Q*LPE J` V0FX2 F$0 0 ) V 0Q*L0P)PP^ *YZ  P ` @Q $ЍL0] JP0`0E`0p2"0K-Mp`0 RP0S$ *p@ P0U>X `2P: 00E3 S4:0S 0S @㝋20@@10|o p` `000 0>0@_ P_ :0 0M0=u:PU:d 2P3 0 E 2R-:00000U@:  2P 0 0 0S 0S 000B0S0!040 0 0 D APK蠳Í zًʋa d@-$@@0@s00C-0Y0H0+ Y8@<RpS@`DP  0Y \11V 101 R11 101 X8R8HLp8<$0P0\V 0 R XR 0@-@00S d0  Ѝ-p Ģ@4O-0M0S $!p p 4 0+400300 0S `VxЍ s d@S :S@@' 0 D0B:SS 0 0h @  L R  R ^ R 0pS00S@p "T R U@: f P P\= ^  p P#T0S] p@WW oWQ  R BP  R620OP R=R/Ry FP 00@ T? ?o2T0S 1`10W0 SR R P@^ /o"^ R pp0PJP=^{ R00 w=T Q=QV  R =R0@SkpP* 0@V)0`S t0P0 0@0=S:S SH000S00pꌮKlHT`&̫ܟlA-P@`pЀ@`p00SH0S00S p@08 HPp@UH@08 H@08 HHw )\ p00- ,0\  #D@tp00P0R00S H0/< #H00( 0/,0A/p`/O-M CP @`20 0N0P@;    R!" 8 4 \ Q H W !p  WQ0Q R   P00 0@ ЍQ  @ADABྐYP P U:Y YQ  U : pYUR [X 0 R     P @$AQ AQ@T @TQ pU:T @T @@U: TUR WX UUHZ? 0A0S*/-`P A\40S*0@-@00S Pp "0@Pp pPᰀ-pPUU@-p0@ AM0P00`V``T@@0SpPd   0T  p78+-$  0quTU`E`5DE ,E @0@-p00S   |@-@DSpP400U  0@(~0@-kM@p_ @000P001/00@kߍ00 00000`@P 0 3/@00p/0  0p/0@ȢL$@-`P@ 0 0 0 0C?o20ЍpO-pP4M0P` 00T00304Ѝ000 0`10Z?01|0 ,0 0 0S 0X2 S$ (0 4, ( 7/0P @@ ]넡 @-@H0H 000080000,00000 ЍxXD@-M 0  @P0S @0S Ѝh0 @- M0@0006 ;?00 00 000001gddtqszse=cceccebcBcOq(PqWqv t3qiQD q9Qp Qp,pp\@QtdRtd8o/@-0@ 0 0 00 1bЍA-`B8MPp@0PP0TP101 0X p0 0P(1b0P RS  00 0   Rd! 3/8ЍpP D$``(pp,PP4 t[j[OE @?/RS 0p0S 0  )q"0P0Q0 0+0S1S1S 0|!R z?$p 0(pz?ꀑ `n@- 00\ 0S ƒ0S ƒ0S ƒ0S ƒ  0000NЍ ƒ,<0,0S0@-00> Ѝ7@-P@個0 @0PP0s6000 00t00000C3#Sb0000C0<00  Ѝ0 S*9t, |17@-@0  1 !0Q8d PP05 00 ST0000  H   !     t  h  h!\  d!P  ! Ѝ0c :l#ijC(t5llxЌXPx`p@-`8 @40P 0$ 0`O p@؅ `p  /0P- p/ d s100P P0xPldPXPPD<P0  (P  P   P$  P(  P,  Q048<0000^伏,$| \xH0̊l``H܊\P40p/00/p01 1\ P/ 1,!P 1// 121\0!R  01<10S  //: -SS00: :S6Q P 2 :`1+SAN 0P P'Q ! :` +Sb Q  :+C5q6 : 0+C PCYnYnu<7~u<7<<0H@@ 0#@@$Р 7.0@ @0 00  /- KЋM?0/00/ @00p/ PQ B //00A- 00S } p@x0@`p/0@@`P@0 } p@( @`p @@<< 0p00zꈉ0p/00 spO-@0`P48< U]Ÿ U0 2V 0"p/`  Ѝ(0A5S)S000;(0  ,R ~ $"" ` p R  ;x(p P> /P? PY =뼁SH"R R (000  00  U <1"p/V0A B P 4 p   ЍOV WP    " %  P 0}060;E 0 V HsU,0P O-p2Q8@00@Bl2{!hh0‡ \*R@0# 0/0 00"*@@0 rS2c/0000S R@A000@00 C RY R 0 40` x`P R R`0X 0@D@0000S* lX%010 R@00$ 0 @@"*0 0rS t0q/pp0x 1000S R0 Ѝ8LJ J+LIIʚ;LJGGO-pRM 0 (p00Cs0S$000Spp 0(0 .0P$04U"0 0`C0 4 00:-X0` +X`0F(0C  0R00C S00X8 _01xS[p`0SV 0X0iR 00H SC@801iSt0  >P30S L0 = P00000 S` ߍnS0 =P0@(S ) 2 )R@0S@0S@ 0S0  0 0X 0Hx0 Q+1a@CTYPK@@  P!P0Q0C^QY[@@$000C P1a0Cs0S P@00H SY 1a0Cs0S@PeSr0S 0Q0CP P0 WU+ 0lUp# V [ 00S_ 0 B RW @`0S 0pZP VU (00S ( + oo Eb`f0S$ " Q )IFGpNr ! $"Cx@AB@@s@nB?.@0XvX`00 H R Y8 !a BR0801YpS  Y eS R -Xp0 +X0pp 000H S 0YXS> 02Q 0M@D,#,0 P0a, 00H^\Ï0 R4  V ..00H S 0Sp@DZqJ0 Ps0Q Tg1/0_T  tV 29.0Qv!   S Z#3T5 PV t2;.xx02v v 00 S` 000C S0Spy 0"p/S 3 0 0S`  t3 0 0S|p0JZ?o20S D@ Q(Y uY040:#S6S0X 0@D ZϠ \@ D00H S00\0S$0Y@ D01"#1P0*42C.000JY01&0R@0DY04p0 00   0R 00B S0801!W0C P1K$0@P ``2L0D0S`!`V B/`  .^B! * 1^$0g T@"!  0$Z^H > $@P0E P8_aW@\SLL{{r@=v>??=L>B?<=Lwl^0YSPJ Q H@0T HD @R0tS0@Q51 0SS@D 00p/" 0 S0ZQQq 3"p/0  0S`  1TP 0P  0$00@00<0@0SD00<L3p㇟`008300@0D   ! DP0#< PE@00U0P0  h<0PP0 `PElu978^85u78l5t7785\774"7(8883413/(-/"/x,.-(+- ,W?0Ӡ3Z@`D0Q Qq *0M%0U T0 S R60e+0Y%0T 0R 1_%$$0v  0!J64$P00Sp1t%tt0xZP/Pq0/0 Q !@J0 0p p!D` 0?0(  V  * B(`!j,0Zp≐PpS!^,0F 0 $0 A0@00<0[? 1́oX 0  < 0 P <0 < /1< V?@PD0o V ?F@0F0?1F1́0? P<0 < /1 #<@T@FUrV@0D 0S/p@0D <0P!Sl P!"?@1PV !sA0(0(00f01  $  F10 0?105UdP V1S @ D0 R0V j@ `,0{ P,0 B` `F0YrP@T0#03R0S'wH5%02Bd 8P 0#3!PQ0 B B0C66c HQ @0#030#Q00S@`F`F@DUh@ ?oD RLPPc@ DH` P5U@ D0 R0@` j9UH0H`L05u5P 0  H0 E62H0R PpT@ W@#*U U0$P@p(`HWUH0L00H0 P5u H 0  TO0@: 0C p0U@`. UH0H`L045u5P1  0  H0 E62H0&Y 00I i`SRP R0@`F :pP@UV P _o@0D 0SPe @00D L0H` P5U@ D0 Rp0pp3x Cd 'H\ @C#3 \P@0C0 @Dw6FdHR @F3#RP@`F `h@D&p5W TH0L0 9& 05eZ0  HL: 0H0Z H 0 0 0C B /F@! 0P09& 0_W@4 2?x 1rg3#ȠxP pB3#P \p B pGs04tg8Q 0D#3 QP0@D @H 0C$Q P:Pp,0  ?13S ,0  P:& 0 0@D*RA2 B@D( ? 1 s?1$s 0UP0 @ ?oD RD@ PcD P"UH0H@L05u5P H 0  H0 E42H0`F  b`B \@ D0SYp0S0[0Sy  0  0S V Y00S  . 0 0@-M@ P 00AA0C ^S00_Q Q  TPЍ0H    0S(0  0S+C S 0p00Kd0p/00 DdO-0`P@@ ~r At0 2V{z"z 0p/g ' Ѝ }00C*S00 ~ J 8*0  ~@ Xz"l!zg pz~@ 8z% pR R R6 T 1"p/V08z8 R z-zzwz  ЍO V  W   R   @0 v 0500D 0 V st}@d\dcO-p2Q8@00@Bl2{!hh0~ \*R@0# 02 0 00"*@@0 S2c/0000S R@A000@00 C RY R 0 40` x`P R R`0X 0@D@0000S* lX%010 R@00$  0 @@"*0 0S t0q/pp0x 1000S R0 ЍD^(&&7(%%ʚ;L&# $O-pRM,0 (p00Cs0S$000Spp 0(0 %0P$04U"0~,0`C0 4 00:-Y0` +Y`0F(00C 0 0R00C S00Y8 _01xS[p`0SV 0Y0iR 00I SC@80 1iSp0  5P30S H0 5 P00000 zSg ЍnS0 4P0@(S ) w0 )R@0S@0S@ 0S0,   0Y 0Iy0 Q+1aPCUZ@KP P @!P0Q0C^"QZ[PP$000C P1a0Cs0S @P00I SZ  1a0Cs0SP@eS0S 0Q0C@ P0 WT+ 0nT# V [ 0`0S 0 B R`XPp0S 0V Wg (00S ( = o Drpg 0 S$ 2 Q `9&###LVN ),<<7WtW6 XX|S0YwYp0`0 I R Z8 !a BR080 1ZpS  Z eS R -Y0 +Y0 000I S 0ZWS= 0Q 0D@D,#,0 P0a, 00I^\ß0 R4 V ..00I S 0Sp@DVqF0`@ s0R Uh 2/$$0MU uW L29.PP0?w  S =#3U 'uW 2;.0!w ''w 0 z_Sg 000C S0Sg 0"p/S D3z_0 0Sg ' h3z_0 0S|0FV?o20S D@ PZ tZ040:#S6S0Y 0PE `VϠ \@ D00I S00\0S$0Z@ D01"#1P0*4C.0`FZ01'0R@0DZ040 00  00S 0C Q 8 05WA0\D5K$HH0uD0l@@lX< p! pW B/p ?00 #1?SB! *5^$0TPUp0L1%?Q P? P0$VU< ' $ p0H \8WLTD `@DPUd<@<`Fp<Ġ<W 0Q D @R0uS0PQ 'u0P0@D 870p/"z0 S0VQ-q 3"p/0z 0Sg ' ;U@ 0H@  0$00@0080@0SD007($3吐 00@0D   ! Dp0#8 pG@00W0p0  w80Pp0 @pG8p@0D 刀08 0T!H$8 0B 1@OoBdT020NjTH* D2 0C< \B0 b< R P D1V 0000?<VR\ iP0YZ1[  U 0S PQ0S PQ0 Q A "2P 0P Q SQ0P SP0 S 0C P"T5340"T 0U^ S^0  S 0 S 0C  " 34@0X"HT0 DP0  @D[ 圢,v ,WrpvQ0 F 1 bR! 0 F0 0F0 1  `$ЍQ0 F #2  fV0 #2  ` 0D02 \0PQ SQ0  S 0 S 0C  " 34@0% A  B>"a` CQT 00<# Q0B00 A 002.a` CQP000@@_ pl]@-@0 DS:PAЍ@-(M@0 ( 0 D(S:PA(ЍH00C0S/0[/QR/ѣ-b^@@0 :0s@-S@ 0 `SAB 0 BQ0fS0S C P0ЍpS$0000 N0 0CP00S !C!R  0 P 0CP00O-@-CM MP8pGt`.0_t,[t0V  np C>.0000 04@apC>,01004@PE;0p 40w P 0 p @PPEX0P rCލ Ѝ0U0 C R 0  100D0[ @ s dV ,R 0DD.S D  Ӧ& 0 Br R/ S/0C\/\0C3/O- M` @ H&`  Q\ H d      ( l P  R  , l `  P Ri Q  (0  Br R^d R Q QI  0 | |d Q  R|  d R  Rd Q  | 0 @ >z:$p1\0 `0 0 00 tȤp `0`\0SP `F`F P%VåR d0 S PP G | Q  $ ,  d | | 儠 a ڐ:#p1\0 `0 0 00 `sģp XK\0K@ KpN@0Pb/#S/B4`F8  0p "!  MM< M,  4 9S0 $80 8 < 0H0 @00c@0 20h0 20p0 0@ Ra 8< B^0h0p   1,u8 P000C0C(0 (P,0EPEa@0ooRf0PSV0 P0  f 02L0 @0 R R.(, AL\:% P Q *0C ,S`FP@0 0y^ ( V<  U0f>o^0(0 8 < @0Y SH@p (\0S' d0S \0S  R25-03[:-pPPd0S PEp g 0S 2-# 5- 3M:`0 0@+ d0S \0S  R25+03/:+ p! [> L@D(p  0S 2 5+ 3:+ d0S \0S  R25 03: 00 S #*  \0 S  R:ႻpQ Z`0 02 d0 S RPq0 S 2 55:p ZN Rpp0rz/E0!p8p @0<p0aS ` P"/!] 20h0 0@ 00CR0 ,Rf h0( !8 (0Rk( ,0 4!{004 CQ_oRe0APExH`Fx0 @p R4P<a0SqWO BqoW_U K`0p00 `0 D30 010 `0P0eSD UP00 `P 1t0 ` r 0bR @00S  P80280  8 < x01A4 P0000C0C(0 ,<PP01 000CS`00 800CS80 01pSqP(p(p ^pp Y8D=J .J0 p , O- P-M 85k 440vh$5`p000 ,0 00SQ4t 00@p00UQH/z$0 0 0 :各 :X10 pSP 00C00 p'CY00çr0, U %  P p# Ѝ a  #0 0 0  ģă 긣布 ꬣ嬃 깱0S U \0S  R25-03>:-ᬵpP7  0S 2-# 5- 3:F 0@ U \0S  R25+03:+ 0S 2+# 5+ 3*  U \0S  R25 03: 0pUpG<  0S 2 5 3: \0S  R:UpQlX 0"f U  & P] [q0 S 2 55:pJ X"0 [ A0C?o200G0p  A0C?o200|0 0 S[0l0 ^ #1 30c 030( *0?"801[d ##b W \$?<HH(3[Kk@>0wp0>  B  30R 0w 0C S1W   RAB|\7 BaB|\W B0 BAA\7AaA\WA0A^ࠣ࠳Q 00\e \g \ 0p \0 9 hP0$03璓a$, $ Q0S 0P 90W0C,00 C 0 U I 0 p0ZYU c ) P _0Sk U^ \0S  R25-03:-0pP G R& 0Q 0 S  0G00( !CQ3001eS0sև[# 0@S`1 R 0 B9Qp e\000dC1^p\ۯ 0S 2-# 5- 3:~ 0@ U \0S  R25+03:+ 0S 2+# 5+ 3*  U \0S  R25 03: u0U+ \0S  R:0ᚳpP  0S 2 5 3: 000Ut \0S  R:zp0 S:0  0 qP 0 0Y00C?o20S U 0N 5Yl UJ \0S  R255:?pPWW 0{ UE \0S8,pPCWk 00CSGpUp0p HTW{ZZ 0 R0 S 2 55:q0 S 2 55: Q00s 2 0 0Z 0  00S 2 55:p (0(0\0S  R,:ɲpQWZ 0 PU0 \0S  R$:᫲pQ[+< U-9--q P255x: 070p pq0 S:q&p [+ [  +-0 S 2 55: \0S  R255:Zpu U9p,0pp$ 0S#   0R25 05:p] $0\ R$0  P:2pQJ[ E 0QYAU  Y 9 7q0A-SP0 X1p/0@Rp R$00CS01p/0/RQ[ ``0S pG|@P@ [?QS,qP``` 01 000020G! 0A@ DxCC0C 0 C-  `P^ P@pX T @GT `T TB0 G-@ p0 0P^000`PY ?o2Y0S U0HCWCQp BPA-0@p/0@`P0/RQ[ [pp0S  x0P@0 ;0\000aP000Q@@ [?QSt@AAA@A@p@-P0/RQ[ @@0S 00@ T 0p/0P@ #1DL  Q@ [?QS3p\@,Ao@?-tM OP  @otЍ-tM #Pp/P 8000KS(0000PtЍtP-PC-PSp 0S  P`1`#(0S7 2A@PY*@@P0p/0 ЍP`PP`PP  R0B/Q 00Sl0p/0 P @Y 40P`iiYi0O- 0@D*x0000 0S03/PD0 0 <ЍȎ D.'-S ۘ*0@- @0QD0C 0 B R0PPʔEP \ G-@P` 0 U0,q  瘀0 B0HRo PE\EQ  03/ @r\ q  E \ 00C0\0S  R25`5:Gm`8G-P@  Er R@Ip ` @\ <PU0D  W*\ 0DPU L@CU`PV@0P/O-@ M MpKe`. e,e00 ; K0P P { 0p/0  @U@@0@PE$AP @3@ۍ Ѝ00C ^ 01V ,^.S 000!k0 0ASp@-PR@ UT@z0Kp/0@pA-p@S0 0a0Pᘀ` p00 B0HR0 3/P1S(,0Kp/0Dj7jGj8@O-PS-KM`00X!U0p 0"\A  / V  0U" E0 @PKߍ(Y 0S ?Y @ 0 p( P I V( 0 00SX 0?X @  p  P   U E0 Q@0 ^@P VH@O--(M M( .K B@0<8 ;88 BK04 0p8 A0`4 s?p0000(0 000Cs0S00#0僎K08 P H㜨 >Kx8 pWp8CK @Z1 P 44 !x8 1 Q|8 $008 ?h08 8S莟pxh W(40 @!*>08 >08 >08 8 S 0!( ( S"( "( S#( #( (  |(  P!(  (  Ӏ(  Sa  r x!R 0 0ʵ b 08 08 0s x(1?8 08S=P 818 81S , 100M0 \8 0 3/p PT+@1z,=0p/K8U P@<88X8 40584p( 2'x8 8`08 F 0s0s,Q $ Q(0|10 $0!p4`P801|81!8 0CZScl* 0(\0S  R:% ᘬpF tD @0 4 BB!@PU 00 0%00|8S$0$ x( `x!?/!|8 ? Rȏ(0( 8SQ808V00SP 0 _003 08 e!Ux8ҀXx(x8X `?h|8 (0RX8V00S 0P8 J 0 _003 08 08 @ `|$0x(Q! x18 08 8 |8 ```08 8 X0C?o200>8P R00S 000 P8 V00S  P80G(CR X 8V00S000PEpGG18 8G1C8 ?8 8S8(p8pC8X00S 636pG(|80(0 8pG S0  @Pp|8S \0S  R25-03:- ᣫpQ tO @X D636 \0S  R:0 Ꭻp< t: \0S  R: ါp. t, @(00  @P?(0 7 08 SUx(x(Xチx|88 8  ( (XR < V V5 VP:P S1! % ( P22l % \08 R00S 000 P8 V00S5  P/P S#2! %22`%V08S \0S  R25+03:+W8S[ \0S  R25 03: H0J000Z80c|8SZ \0S  R25-03n:- Ҫp t~ 8@0C8 8X00S# 236 \0S  RT:0 ᶪpd tb \0S  RK: ᨪpV tT 8@0C8 8GaGq8pC8Sڀ(00 @P]0  @PV0  N8S \0S  R25+03:+8S \0S  R25 03: 000080$0x(僁X x0`8 08 08 0|8 8`QSP08 8`&SS``V 8( 0@8@PCK@K @(K8S$ 8Sa 8SHbt4T4Ԅ2b b=bTb8X 8$0x(1|(R/@ dU@aX@@]8S LPP`0S|  `0 `c0/V_8PC8S0  @P$0x(\0S  RW: Ἡpj th 8@S 0 ($0x(QUg8(s00R0S`QP8pSZ0 (8s  `}Q`P8S0  @PM0  @PF8S 8PC8S0  @P6$0x(q$0x(1l8 $0 0(0 00 0 0.K B 2 0dPT@z20\0S  R:% 9p 0 \0S  R:# *p P0S \0S  R:' p P 0@ \0S  R25+03:+ p P 0  \0S  R:- p P0Q\0S  R255:0 p P 0 \0S  Ru:I Ԩp P0S nK  `F22`& P0~K pGVa:0s \0S  Rj:. ᱨp_ 0nKP `F 22`& P0~K pGVX:Q \0S  Rc: ᑨp? u= PTVP@)%00J#00TPS'00]o \0S  R25 03: ^0`-00kI00\0S  R: Rp Pq.00\0S  R: :p u PqqT8 Si O-KM⸏MPl0`?p/\0T 0`0咯P @KލЍ0 0 0L?0T \0S0? 0vP@p l0 \KލЍO\%㐐Vx `tp>000 t@T0HC0S ?S/R[ H0H 0000t0x0\ \ C0B!@P00S~ > R=00S- RL 0<0=p 00=X 000p 0GZS!-㔝  0 1 h 0 , d H @ D P H-|0 | 0p 0GZSW6= 0 D <01|00p 0GZS H <01|00p 0GZS @ 8 x<01|00p 0GZSL P <<01|0@0S8000800p 0GZS;01|0<0s;T 0000 (0X <0?oAq2Q0S<00<00p 0GZSp d `;01|0v0p 0GZSw4 h $;01|0e0p00G Sp:0TK  @P 00$S 0P00S0c000@0 080 0GZSF|t:01060pP:0K T 0p$Wh 0GZS, :010000*S000000C S p90 P 00$SD 0?4000C S04p 0p 0GZS`X901t10p 0GZS,)  90110p 0GZS(  801l20p 0GZS80120p 0GZS,p801l20p 0GZSD,4801l20p 0GZS,701l20p 0GZS 0,{| ,0 1l2s\0S  R:%p@%00t @p%p0pp0p0>0@@!@P00S',0S 0 0P?ʿ+,0?[ʯ*040S 0P0Y00S 0K80 J004 080 4 K>0CCR Z P0Y00S000HK>CK1h040K1Cd0?40@0Sh04 00 CP0Z00S 539KD ,00H 0V 80K S0 y@P(,0S \0S  R25-03b:-Iph tf @Z 539 \0S  RO:04pS tQ \0S  RF:&pE tC @4 00 8@Ph 0EX0РZZP?j,0 VH0D , RB 00P0H0D0,0FH0DH0DH0D040X0GK.?o 20 0V7d0< R00S X000K.ch0 Y00S+ K.% 080X P,0H0D0ZP4 0R+Z)P0Y00S 0K80 00J40P0 080 ,0z 4 XW 0" Y Y5 YK:KS1( 8 ! K 11l ( \0d0< R00S X000K.h0 Y00S K.KS#2(11`(Y0H0SE \0S  R25+03J:+pTlDlPlPhkp$k(jjDji`ihDL40s@- @PHpo0lFS 0/RQ[ H0`H 000 00?cٽqp 1p/00S00Pl0SP0 H00C0S0[/QRЍpXԦP\0ű,0ñ0P H00C0S0[/QRҽ^뀫h0p@-SP0  B0 "!AP  0ĝppA-Pl0@p`Sp$0S h0h 嘀00CHS! 0 0000$1/Ѝ\0 0S Þh8@-`0@p Hp_0\ES 0/RQ[ H0PH 000 0 00(0`P H00C0S0[/QRP Ѝ0P H00C0S0[/QR90A- 㘁@`PHp0|GS 0/RQ[H0pH 0000VpP<01 10 B0GR,0 3/Ǽꆪl0S 0 H00C0S0[/QRA\0S 0 ,03/0P H00C0S0[/QRμZt8pp@-P6 <0@pPp@0 Hpo0lFS 0/RQ[H0`H 000˵0P H00C0S0[/QRڎpN0P H00C0S0[/QRwC- QDM`P" 0Q0 @@@@@0S*pUUڨ0嘐 00 B0IRש0 3/pDЍd@@P0嘐 H00 B0IR0 3/pPPEp8@0s@- PHpO0LDS 0/RQ[ H0@H 000 0kλ @`  qp l0S,0$0C@To H00C0S0[/QRvt 0p/00S00ЍpV h0Kp/00@ H00C0S0[/QRھJТ/ R:E/p@- `P ۳T@4pS S0 ,0@-@00C S %0 000^ 0 0 @ @0 X"X2S 0 0`!Z0 0 0}@-0  Ѝ@- 0R0 x0 0!@PXT 000@0000400000 ǥ Ѝț|WlX@-$ SPЍ8@-$ EPЍ @-@0@-MD <0P0+P@@wЍ0萚0@-MD0@0< P0P@@_Ѝ00Pp?$ / Qp?$/0///A-`S$@p 0SkRkTX 0\%PP%- 0 R% T 10@T  0@Pq@ ¹ 0Pq@ ߹&t'J@: 0 0 T% 00@T  0@Pp@ ꘹ 0Pp@ ᵹTt nt Kt P˧ 040 32 dЍnꈙ"D@-z Ѝ@-r ЍRQ@-0,R, \ q&p Pp np #p H0 0 p$0 32 `Ѝ !L,0, 00[  [ /᜖P<0< 00 [   [[ /`PG-`p0p@P T0S@PL0D"J00C0OD@RDP 0S Hp@-P`0`@0/RQ[ d` 2St0l0 200X S [?QSpp@胹 l`Ht< <0 80000 0 00C)3# /ᔔ|@- @0 Pς\[ 0P 2@@- 0S s '0? S^[0 Ѝ@-0@ЍⰀP@Ch!  p 00000 00 0Qς\[ 00 @/@-0@　@ϒ\^[ "0p p　0　kh2@-s0/rQ[ 0p p p p L2s 020 @0   p" p　0@P^[!P/@-@ PxUO0sL4100 p1 p`Ip-@4@Q^[S " 0p p0 0 00000 00 0 P^[  R @0p0 p0ЍⰀT,HO-@R2P`0/RQ[ 1p0K@00001p W41PU500pP W5pW: R?Up WHpWK p pp81pP`0P[ ?QS Ѝ`GY p`EY P`GY Pp`GY Pp0p p p p LM`GY p`GY p`|@-,MpP@00000S Q0S I`P`00 `P ,Ѝ0S @-@/QRA-` @PT @0PPpP+@P0 U gP @ 0!0 ip@-PQ`@TP@p+@P` V00 P/p@-@ P Up0spp 42 SppPOT[S 4ϒ\^[0h0S/A-@dQMP R P1 00A20 Z00$Q pP`0 S; ; Q(0pPX[Sp/BT! =Bϓ\^[{0 0 0`pQX[SЍ\G-ppod`R\2DPA T 0 D0#0CR:DR03/ @@zG-p p`R\2$DP+M 0 `@ 0#0CV`3`#T > T V0@ DS:p@0 @ 2/Y V0DW*D V 'T` z@-̣i, p@@- &@--M @0 i᭣h0A-S`pR@R@3@#SP^PP X #@@@S:$0 p/0PPl@-B@ b 0#030#R00T00S 0S:@-P@`00*Ѝp-M @0 'iDgg@P00//.RP @- 80@@ PTQ/p@-@T P 0R   00p\/0S 0  Q C/P@-M @0 B     C0       C0$ & ( * , .  C4 6 8 : < > 00S00S 00S 00S 00S 0@   CQ܍0 0R/R/0PP/ \P  \ P  0R/ \ / \ \ \0@/0-\0 "0#3  SSL 0 RR/O-MP00#@3QI#PJ.0W0< p00  00R  X4`m!0d 0 .0 m!n!0T0 v>E 0C0" PS 2p/K0Ѝ@T@m!0?0P00 00S 00 o` `!&a oJZ0S?#?00 ? `V d 0s?.P0`V  i?mP0 0S>,"`PUp0ǟ !) JZ0S?#?00 ?Yd 0A?.P0Y7?P `V `T @P pV0`@0d 0 0.0 00 P 0 0 sT0@T @ @Z RQpR`P0@-M0p/0@-0P0Kp/00@PS" 0 1 R !v    T  gPP*Ѝ0(00  ꜂p_  r  O-0 A,aOoPP@`\U@D^`F_N_E@D`N@Do Pm.po%Q4,_< N0 Q$Ϭ!80 P@1#(?<P?!,0PO-TMp 0` $3/P<1p/0 0KS TЍ 0KQ@O@PP@P[SYZQ! 0A3/P!   P0 @ R O-M0@P$00L 000(40 0 `80Se ?Cÿp  d 0    @  U  0002#$ 0 0/0C? @0$0< ;S;0? 0L00D00c0F0 0 00000400@0,0H0p`|0X0d`0PT\0X \(8PЍ|0 00000000 0 00000400#0`Pd`C P TWY00\R00S" 0S8 00RS` D0,00CLd0|0$S|  RH00SH02Kp/0꜀XPTpp8 0o/or"WH 8 0Jp?T00P000  80?0h cl0R7( hPy ?o2S R*0 00000000 0 00000400#Lh0 pl0p 0|t0X0(0\ 3/X0P\ &1T 00KSGP080S0咊HǎHXH0|pG>(0Po`Pd`P`3/P_{$ P<S 00 0S$0 ` cd\f(0| 3/PMB[{\zO@-@ @ 8p@-0M@PQ `0Ѝp0Kp/`0x@-$M\@T 0Kp/0$Ѝ␀@R0  @ hp pt00p/` hp pP00 Ϡ  Ϡ  `xxw@-@M0O0 0@@R Ϡ   0?oT20S 00(0000080 0@ЍA-@<T P(qT@`^P P q@&tJ@dЍq 0@ 0P ` 0p  0 q@ t0U0t0S 0/00 0֯ 0 q@ Xr0@-P$M @S0Ϡ0 0@T?o20S 0000$Ѝ01R@- !p p　0`p/0　uC-@p`R00W0SP LPP P00@ 0S:SS@ 0S00+0C000# @0@S:S  S 00+0C-0S2 9`0S :R00 R#@U Y00W0S P PPPPp 0W*(0"  `0S Ѝ0S l000@ @,QQS040S0U P$o(@-@ s0P@@Ѝs@-@ P P00P0S:SS  0S 00+0C000 0000k 0P S:SSP00+0C@0SV ` _0S :R00 RFP0SB _0S :R00 R3  0 Q:QQ00 0Q:QQ  ` ]_0S :R00 RP M_0 SЍp(@-@ 0P@@Ѝp-zpp p/1зp- pp p/1ȷp-pp/p-pp/H-`X 01CР @#U0P ASK 40CRp-pp p/10Q/ R   RQ -B O-UM2ppo@Qp0"0 0 RP""0 45Pp200Uߍp .PH20 + EA4p/200$S 20  0 0[.PP0: SL 0 Ep0P`0SppW 0< 0@Pt!0 P ` P J  h0 00/S p$.0Px| Q\pt Q\ * R Q\00PE 0 0P  r 00 00 r \nHn(nnmm(KljJlO-M`@pᨀmPP 1 0 00Po1p/0p0p/00x100Ѝ Q\ R  P  P  P 0 R 00< "0p 00 $"00-0P Q\Q\ * R $ 04Q\0( p 0pHHHkj8ji0@-\) R%0P0# \T  0R ^ 0R ^ 0R  $ $0R ^((0@o0000: S  S  /"P 0@- EX0  BA0 Fh0 BB(000@-tM P@-P `0p/00SS CR0032  tЍ0g0@-@QtM tЍ0 PƖ,P@-0Ap p㰀0`p/0㰀g00A- 00S p p@x0@`p/0@@`P@0 p p@( @`p @@lbflfA-bM pP@PAp`V 1 !V0$p/0@bߍe@-p p　0`p/0　eA-P`p1/P[?S/RS@[T V6/P@-d0 ``0X?P0@ 0 S000 00BBBpPQ 0!!- 0@xpP /RgS [0@@OT L0 @04@ TT11lS4SSLR8RQQQlQPO-pH"M 0SN0dS70`0 @p_T 0S巫1 @ 000@00 04/p@-100"SYD0TppPx10"Pt \1000H100SD0 0@00 05rPЍ Y P.0@  0 0 0 320STV @%`P0 @0 0@ 0 t  0@Q Y @0 @0 dH.POOOė ONN,TNC-PR`p@@P000 Ѝ 000 4/PQPU * /PUᨒ *~0@-AM 0\@ C|  8 l  L d  P \  T T  X L  \ D  ` <  l 4  p  `Aߍ0lHPzy|{zHG-@`P(,01101py_ 0SVG0S p ,V pP@-P40pO0 0S0 00 G|GO-Plhhh1 000S Ѝ@p` T T@@  ;P `KPx0x00  SR (PMKPp0p0 P @KP tl  P  l0$$ Q00l0@ TT)W)\))( r/0p@-@SP ` fPV `p0 Qp Qp r' 0A-@S p E0PPa  !UW p0  /O-gM@M Q`P9p/00S)S.0 $  T,@ H 080 0(<0 D `0d0h0 0000000PPmMpP, @P@: 0CS<(23gߍ28pp7@-@P x0Pt0p0p 00P\0% XX0//0Q   Ѝ0@/ Ѝ0c |5@-@0!00  00偁ЍO- GM M4 t; 0@d4 00MX 0a  00V 08Xt0l4 X4p/ 0h4 B>K0C,4 ;(4 :0p$ 04 :0:04 :04 @00l1\4 S02Z?o20S j1Q BK @ P `:0 Z 0QSQ,4\4 $0S1S0S`4  40P 1 00DD 0t4 84 4@4 0<4 00`4 =K0Cx4 0C|4 0S\4S `4`\$Q01 `Pm,B>K0CP H9 0St4oy0P4 G 9d$00S 90 2:`P100S 8 0).럈0@s"d$800P1P@4`&``M _y0SH8d$00X 4ljSp x$|4 L4`S, V`,B>K0CP t7p$00$?oR20S 7p$02`4 S 10S0`4 l1S d7r/``004 M hh$  ll \$R `10`4 @0st4xd$0P4 604 E p600S60W`P+00S h6!dd0Z0@sd$600P1P@4`&``M x R0s50&p c40 S44 0  0Sd$500 Rp% x$|NL`\ 0sC|qM 0\Q040 `10`4 04 Qe Sh  Qh l l Q   P0P 0 h4SPh$ =\@  [1b010S$ pW`l4%@P3 00l4Pp1pqlq$X4R0 !@p10Cp1Z1PX40!#!X40X4 S 2h4 S lt \t \4Q131h4h40 S\4l$S?UD:2/0]\$0\$ !#! 1 !1 p t$ p0PX4  t$0p4 t h4 t0S pC S 0@ 03X4 X l$0l$ !#!U9 1 G00Q,PU, XdL101#0 Q 0 0[1B01X4S [ X4 2`4S V v EK11 + K""}}St8 a A-0p !@1`   1 0+1010S S000QvP R  00 3/0SP0P0@@@U0 3/t)/O-@P`ᠠpPᤐP 00YZ pQPU80 Y000 0S`000QPLP0PY 0 3/$p@-A<4$d,l@b PU 000 0p QL1S/G-$P@(`0 0S8p ?\R @ 0R00$!R, 0U 0,P!T% R P 1P 0k 0*`1pW `VP 0` @R `0  SQ 0S 40PP%O-\MP'P(00 $  0<0200$70D070H070L0<0 1@0TV 0040 1O 1L6$ 0@00  0S$ 600 R& 0 LC!R2 0P0T0801 00,4080Ql 010003501 3Sc!1S aPTpa0`  " 0 P0S 00[0! (0C8 C1 , 02000p(@0P 0 0  0BS0?o2R0Se01a40S  H 0X (00ST (00SP D1I 4 00s0S Q 2Q 2Q 2Q2"00PpT11c!aV 80 ( 0,0p2000@(`0P 01a2#0#Q2T0 0Sp 0 0#2S S Sg0 ?43$ 00S 00S0 V0X$ 0020,0 ᘧ,00p4`W{ 0F8;[kXh "2<U< $CP$4 R0   @ 0 @\Ѝ<Q V0H,X 00"8 S-~P V0S   <00<0<0V,0X`0 p2&<03/P1$ 0<0 ` 08 004 R  (  , X00 !#8  8 嵪`lpP 0`$ 0p4`0<0 @  10SP@00 T ఄ0011 VU} doO-dMx@40p?@0O>C 0C(, 00(0A  QR 0QS0 $P00S 0 7"0(0:#2 0SP 40P0 1SN40HLpC` ,0R0   @ (P L`,0V02S 0#2S 600 T0S60 PQ T@&0 (0l& 2Pt6t&0 S  R0 R"P RL00P@P`$010S00V0P [Z J0X 0P3P3H`T`X`0S ( T0 P0 ,0 ` (0>P T0S0X0SP@,00L0V 0SV 0Uh2l<000D04080K 00[/QR0 p8pΥ2SZ0C 2S X PU*1W PU W  RW PU3 X00SSSP/ h"l2<[QcP P"8pᐥ 010SD3Z 0 0 P@;460P0118 D0S @ u04[ 2S02200) 0S200Q0 PX2000Sp20$Pr\(@L0Sj 8L0, 0dЍXFX㈀ tP 0 P U !+1PpP[  P Պ0@i 0S100Q@0 P0000S10ࣂL 21Pp[ 2PhRl2< SUPPPe`14000 Rq 00Uu UHX <i}MJ/E 1 G-P p`80  B0 S YRt0S2400@P11\ " R@ 1P@@O-`!0p@1RP 2bc!P 0 *  0C C100P Ѝ\  R ‚ R ‚ R ‚ R ‚ 2l1 aV  ‚,, , R`0 xP1a7@-@0S !1 0 00 b0C00  0000 R0cS"00A a00TP Ѝ0P00 "0Ip L00 R<00000@@K8w LKvJJJ0 R 3 #Q R 1Q/p@-$@@PUp  BPpLJ0STp@-@T @0p <<0%P@߻Tp Ep@JO- fM5` 0`Z?@5B0`2 PlLTl000@000@@@Ch2 0 03\@20ld0\360T50D 0 Kd2 <5 KX2 45@" T2 $1<2 & %?K8  , s0%2K4) 0p04P0`l2 )PPPM/00!Bdp`.|D@x4vp/0P .mK  K0S 0 0pQ!p0 00R 1 ~C@C@C@KP2: Sd2`P!1p@PPr`2  t" 00M0p2 t"b ppp24C Р@`"p2   B Dp#p2  R P Р`0  p 8`"0 `2 ! K6 ᒏK^   剏KK   R    d2Ž!P & hSR Sl2 P P  R KP R  `2$  8QQ4 7P( 㑢" R10 h2CQ80P0# *P83Q41D!171'3%0 0 B$ B!጑$匁|汐ᴐ|LIc@Hgmon:DP*8EDE lDpDPDC# 0S/0 @S AS/ 013O-LM0|\ 01s `||pxC$ (@ 7 ,",!  $       P _ Uϋ\[P PU( P  \%QP傡r 漰ᴰ ( Pϙ\Z[ R (P U P\:\V $$@^_U[$$ ^ ^p$@,$((004(,P4`_UW[4P40PU( |`` @ P1 ( ( POT[R 00 01 R R  1^ \ R0; 0<008080@0@0D080<D0 P^[DD0@P80LЍ,CBBBB A@$@?80@-M| 0A `4` .t~P^"@P  1? 0" S0S  0 1R 2 R0@!p R p$ [`    H10S p/[OB @/QR p0S 0R\   0 R   RX  3/0H  R0Ѝ P0<O-$M⸁XbHX`00$ЍOi Q0@[T8 !|   4000#s0Srp 1 0 " 0X0S 0 1R 2 R0d!  R p$ [p    1 00S p[O@ @/QR p0S /Q\ @ 0@0 S004/@|000S@0[00 0$Ѝ ?R0@@ 0@<BK@-@PỘ1S A3U 0 000S6/-`P@`pP@pS R@@/O-4M\X Y `Yq YC 0CppPA HS0p`PCU04Ѝ5a,V E#3.Vࠓ^PE P`A|>nfȌ Q N`#`3`& Q``VN 0CL>a 8\ 0pN3#\Q0N 0C<00Sft$R t<$Qt Sc@$000aPX ZP@P`0- RZ @@ 03#R Y5  S20TI 00Z00S0 0M0 00P ! P $@=0 R 0000000@0@000t$ R Q R R P 0S S0 00S0u[c p4 bO-Ml pb P+P00 @00S h"V000000ߍ @P d"P @J0 @pTtW`20Sph"0Vp000  #P ?00S?0SV ,"Q S0"00(@0PP d"pG0 V S RS +P X X0/ Rr`}?0 002 O-@4Mpo M0R艝0Py(0 RI 00a00 ލ Ѝ0. JP[.4 Pm?8P$0000E0;0 $0 0 0 0P,0,300SS S 3000S 03( 00 0$0P >0nCYH3 0 4309)`:9 (!40 0),1M/0!)J?PE  0, 0 p8`P0s ,1s 000 0 (1{40S"00000M?P 0P ߲ !sZ0 !@P0d, \8 0K0C0 C  C !=K 0!=K0C 0;0(2@PeH8D@808 p00 0 E0 0E,8@S@ YX00T00S 0$p  E0  0EP Z@,8S "0@00048S @^DP Z91}P0000 00;00 @PH8D08 p00 0 E0 0EI@0@0@00@TTT@d0@ 0 T0000S 0@0 00n@DT@@DQ98O-M M4P᠋@0pk0: 0 0L0 H0Hy0P 0 +"0p000ލ Ѝ0P@4+00p0p ZUJT PᢷP PP  ▷PJ @P0w0000 90,000ݯ0w0 0D00;0 0D P@D3D0 P00030 r030poWppZ Z +a0p0pa0U+a0p0pPw> 0.r0CT ,CCCl{ 0DP000`P'p00D P O.0Wc,0H P0 00P8@  00H RF    0FPp p0W4(0?$0Ch040(0S ;pS(  0+0000 MP $0?S$0? SS+R h#Q S 40l#pC000P dP l#00` 0PP ~! ?PHp~URY|~ 7@-, ($ ЍO-IMcH 0 SL1" P1 @@0Ot@T`p P#0p/ 40Iߍ300oP  F0Rʸ3p/@0P@T*?K s00000 K  0  000C0sU *0 0 0p0S_3p/0  p2p/00ZSZ RP 0F Sں P⸠0ắFz Q/?r s0S R P0 0 0p  0p2p/00ZS{`Sx Pt 0 P0R z 00C 000000 0P0T!R   0 @PX1PEp/0LH1 0@T ` 00R7.S5 0XS@ 0.R @0S 0 0B PP!"000B2 :Qr  2!W0C0 R.R.R@0`00C S @P @ V<tO- ,M`pY.@P 1`p/0000` KM0 P 0 00 0(0K0;0 0P(P P0po0(0P0 Y8.l000``CoSV```f(0 0 000`(P ?.dO- MQMD4 `82p00@4 @.PP2` 000 0` Kr0C"$RB~KpGS E;3CK 0A,$6MC>K 0C`0 `;0` 0` `< lP.41<0@$@$1 P0 ``D-oTV```f04,$6440,$04684044,$0046 0 `00<000D4`< P Vt0ST @-$D0  ]PG-0 .<\`dp P@T SS *.S*  C?T0Zp/0S S*B;\!\"L~9 Z`0@T@\ \\ !L]^ZZ>`0n0~>0C>l0CdRO-P30P#RP3 U9 00p/`Z Ѝ P 00?TJ RHP@P 崿0 @T@V`AXDV ?LA@`[ P[Ap`P R0p@-@`VPU 0Zp/0 p  PL00pZ ` 00BQ 000 00pؼ0s@-@100P 0uP .0p/Z0Ѝp 0 C \l R Ͽ0Cυq0CS0! 0,@-^ P^@0 S aCQaB 0CQ BR 0@0C^o@0S !0C]S// R 0  0AA@P \-Q_QR//0S 0-S @-/0@-AM@P P 6 PAߍ00@-AM@PAߍ0 P ! P R 0-S R*S 0@-AMPPAߍ0 @  P0S 00S @-M@P  ܍G-p0M0Z @G0@)P [[`P : p_  nP4 0 00P S+ 00  00 L P000  R 0 R   pG ᪻XڍX| 4O- LM00 `<  (5@R "pMR K.8 PL 0 R88H0 040 0D0 @0 0$0000 S0P0Y8 00<0 ( P30 '(00 I Y0(0 '0H 0<08  ( P 0  K> 00X ( (0D0 HK> 00L ( P(X040S+ HݩPP0@0 40 0d#pS   K008 0<0x ( P 0  L0 00 ( (4000S(0K 0000 P Z* 2 0E 0S 0S d2 ``00 @0000000 0 000D00 0( @0S ᤪ(X1 p!0 0S@0S 00 S0 X0@TS 1 ||00 Qx^r\Q7#- * R.'$\ RYP0ST0 !0p L0 !0 RD0SAx0 !0 R9P0S4H0 !0Q9X|D[ŞPl@ 0@-PP$M h0p/@00P00$Ѝ0 40@)ĭC-BM M`PpnY@ @@ T:0 !0p Bލ Ѝ @[@ T0 !0$P.0 0d4 0`40\40X4 0T40P40L40H4:A-@pP`)0p A@-P`p@~) 0 p00 ЍO-EM`MPp#5p/0$ P 5$!0焴 0ጔ吤 @TR@R.@DOoBU(4L (P 4040|4 0x40#@+.TPd10S@Ta 4 04 0|40x4(0@00<0IP@X OoY(B@T 0S@EލЍ@4$ 0@4Sx4(0 0x(0( |4R8|4[- 0S* ,$0,0000800U{4P00P,P0#U0S0 [t l3$ A0@cx48@@(0080< 400,P@Z  R !R 0D.S 0S40040404 0|40(00@00<0P[D00Y00S 0S}ʀ4S 0( S(08|4[ 0S D妨$0D0001$ 00oS1 $!0 @Y4P0P0,PP  PRy!R R  R 0 0 R j,00,0 x400S 000004000,0W408  [404 0|40(00@00<0OP00Y00SB 0S?0S= <$00005,0S L0 !0$ 00S (0 !0į| 0ܨ0@-PP$M h0p/@00P00$Ѝ0 40a@'괥A-@pP`'0p A@-P`p@' 0 p00 Ѝ@-$Mp@P'`P |0p/@00d00$Ѝ@0 0<008000 @'ꨤxA- Mp@P'`P x0p/@00`00 Ѝ<0 08000 P@k'Ȧ@-@T00 0\ \P /P @-<oR 0 P R P r/0@o/O-Mp@ 0堒 00P1+ XP0404 PPp1011S0 TP@4Y"00000ߍ1Q3 0 00S   P300"0 o1010p0#000 @0 0 00?s00?0O-0AAM SM70H` S30Ppx0(S0x0(SAލЍ0@TO t@ @T: 0 SP0GS ڲ 0/ r qPA-p`@٭0S0Zp/0Pწ0U  S.R .00U  S\RU  S\RcPEЂ@-CMp@P `8P 1 00CߍO-PS$Mp` `VP 0P0Q0?Pl2p/Z0$ЍQ0P0 @ 000p?P0XV?XkVP0000S @ \R0U1 0 ^; 1Z 0 H0S 0CR*0D S0S 0@  0^&ANZ AJ^ Z R R0S\ 00CS00$?,  R00s0?0L4@0D Dy 00CS p @ X 0S*ꄁĀO-AM@MpO` Pt@ @T3:8 0 ,P84PS: /qr Q R PAލЍP 1o/0 - 2 00 - 2 R@20P0 p 0R  R ` @-uv@R PR/lvivQPP@-@` 0Pp S+$ !#%$#"\ p0Sp Ѝ1vp@-@P`0 p@s@-`P@P  Q 0 00S0 k00 000e000Ѝp@- 000  WЍ@- 000 0 ЍPC-P,M@ P ,Ѝ  P   `ppG 0S% 0% 0% 0 0` 0S ` 0S0S  `     !AAG-@ᤐ`< 0RS  <02#, G  Q 0S 0PU P%v5/`f@-@P P @00/ST@-g\@X0@P H0q@00P ,00P@bTt(d 000PP/Ȑx 00R P/괐@-@P u@袛@-@@700hl0R0A-PA` HTQV  p}@z`@-B2@0S x2p l200\20S P2p D200420S (2p 200 20S 2p 10010S 1p 10010S 1p 10010S 1p |100l10S `1p T100uD10S 81 p ,100h10S 1 p 100[00S 0 p 000N00S 0 p 000A @%rHtdv$hduHs\hss\t\s0$qqlu` Xs0A-@TPP0@S S 0!.0P`p⑚U Q P U@ᄚ@@T P@u܌A-`pP`pP@T000P ^t@t0@00P00P0P0 IGExn<d<0p@-0 @TpP  P0@-0A-@`0P P p<08S 0S 6A` 0@sp PT@-$@$0@@@00ldp@-0$PP0@Tpd`00 p@-0@@XPU\ؙ\Pp0X0ҙ0@-I/RQ[ o`000P H0 0  0I$[/QR@5ot0t 0 @-P 圙T T0 00P 0咙4 40 0N?P@0凙Ĵ00P/|P0p@-0@T<00@p0SP isQe@ܷ@-@@\00蘷00p/  P|00p/  Gd00 p/ >L00p/  58p@-PP@ @P 0 Q#00p\0 @G-(A(1@01P0S 1p`10S000 0G `PU 0S 0 P PpX`0P1 ֘ P0SΘ >>%>3>>>>> >$>>'>>> > >consoleStack nowInvalid base: %d.Integer literal out of rangeInvalid digit `%c' in based literal___flex scanner push-back overflowsystem__addressstandard__int processReal(parser_state*, const char*)%s: Assertion `%s' failed.ada-lex.lparsednterm%s %s (basic_string::_M_construct null not validbad buffer in yy_scan_bytes()No file or function "%s".No function "%s" in specified context.Function name "%s" ambiguous herecannot create std::vector larger than max_size()Could not find renamed symbolCould not find renamed variable: %sCould not find %sInternal error in encoding of renaming declarationimpossible value from ada_parse_renamingada-exp.yInvalid attempt to select from type: "%s".No definition of "%s" found.No symbol table is loaded. Use the "file" command.No definition of "%s" in current context.No definition of "%s" in specified context.Could not find renamed symbol "%s"Invalid use of type.Starting parse Entering state %d Error in expression, near `%s'.Stack size increased to %ld Reading a token 16#Based real literals not implemented yet.%2xill-formed or non-terminated string literalambiguous attribute name: `%s'unrecognized attribute: `%s'Invalid character '%s' in expression.flex scanner jammedfatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowout of dynamic memory in yy_get_next_buffer()fatal flex scanner internal error--no action foundNow at end of input. Next token isShiftingReducing stack by rule %d (line %d): $%d = Invalid conversionType required for qualificationCannot slice a typeType required within braces in coercionRight operand of 'in' must be type'modulus must be applied to modular typePrefix must be typeQ%cQU%02xNEW not implemented.expr::ada_choices_component* choice_component()result != nullptr-> $$ =Error: discardingError: poppingCleanup: discarding lookaheadCleanup: poppingint ada_parse(parser_state*)par_state != NULLunchecked_accessunrestricted_accesslastmodulus"end of file""invalid token"NULL_PTRCHARLITTRUEKEYWORDFALSEKEYWORDCOLONCOLONDOT_IDDOT_ALLDOLLAR_VARIABLE_AND_THENELSE'<''>''@''+''-'UNARY'*'STARSTAR'|'TICK_ACCESSTICK_ADDRESSTICK_FIRSTTICK_LASTTICK_LENGTHTICK_MAXTICK_MINTICK_MODULUSTICK_POSTICK_RANGETICK_SIZETICK_TAGTICK_VAL'(''['NEWOTHERS';'')'',''{''}'$acceptexp1primary$@1save_qualifiersimple_exprelationand_expand_then_expor_else_expxor_exptick_arglistopt_type_prefixvar_or_typeaggregate_component_listpositional_listcomponent_groupsotherscomponent_groupcomponent_associationsAggregates only allowed on the right of an assignmentCannot translate to agent expression%*sVector: vector::_M_realloc_insertN4expr23tuple_holding_operationIJNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEEEE^"OGpLN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_EEE^OGpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_EEE^OGOGN4expr16concat_operationE^`PGTPGN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EEEEE^PGpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EEEEE^PGPGN4expr23tuple_holding_operationIJP4typeEEE^XQGpLN4expr14type_operationE^QGQGN4expr19unop_addr_operationE^QGLQGN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EEP4typeEEE^QGpLN4expr23tuple_holding_operationIJ10exp_opcodeSt10unique_ptrINS_9operationESt14default_deleteIS3_EES6_EEE^LRGpLN4expr14ada_resolvableE^RGN4expr24ada_unop_range_operationE^RG@RGN4expr25ada_binop_equal_operationE^SGRGN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_iEEE^DSGpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_iEEE^SGSGN4expr29ada_binop_in_bounds_operationE^TGTGN4expr13ada_componentE^PTGN4expr23tuple_holding_operationIJSt10unique_ptrINS_13ada_componentESt14default_deleteIS2_EEEEE^pTGpLN4expr23ada_aggregate_operationE^TGTGN4expr14unop_operationIL10exp_opcode56EXadL_Z12ada_unop_negP4typeP10expression6nosideS1_P5valueEEEE^ UGLQGN4expr14unop_operationIL10exp_opcode57EXadL_Z14eval_op_lognotP4typeP10expression6nosideS1_P5valueEEEE^|UGLQGN4expr23usual_ax_unop_operationIL10exp_opcode57EXadL_Z14eval_op_lognotP4typeP10expression6nosideS1_P5valueEEEE^UGUGN4expr14unop_operationIL10exp_opcode68EXadL_Z7ada_absP4typeP10expression6nosideS1_P5valueEEEE^lVGLQGN4expr15binop_operationIL10exp_opcode24EXadL_Z13ada_binop_expP4typeP10expression6nosideS1_P5valueS8_EEEE^VGTPGN4expr15binop_operationIL10exp_opcode3EXadL_Z14ada_mult_binopP4typeP10expression6nosideS1_P5valueS8_EEEE^PWGTPGN4expr15binop_operationIL10exp_opcode4EXadL_Z14ada_mult_binopP4typeP10expression6nosideS1_P5valueS8_EEEE^WGTPGN4expr15binop_operationIL10exp_opcode5EXadL_Z14ada_mult_binopP4typeP10expression6nosideS1_P5valueS8_EEEE^@XGTPGN4expr15binop_operationIL10exp_opcode6EXadL_Z14ada_mult_binopP4typeP10expression6nosideS1_P5valueS8_EEEE^XGTPGN4expr15binop_operationIL10exp_opcode18EXadL_Z11eval_op_leqP4typeP10expression6nosideS1_P5valueS8_EEEE^0YGTPGN4expr24usual_ax_binop_operationIL10exp_opcode18EXadL_Z11eval_op_leqP4typeP10expression6nosideS1_P5valueS8_EEEE^YGYGN4expr20comparison_operationIL10exp_opcode18EXadL_Z11eval_op_leqP4typeP10expression6nosideS1_P5valueS8_EEEE^ ZGZGN4expr15binop_operationIL10exp_opcode19EXadL_Z11eval_op_geqP4typeP10expression6nosideS1_P5valueS8_EEEE^ZGTPGN4expr24usual_ax_binop_operationIL10exp_opcode19EXadL_Z11eval_op_geqP4typeP10expression6nosideS1_P5valueS8_EEEE^ [G[GN4expr20comparison_operationIL10exp_opcode19EXadL_Z11eval_op_geqP4typeP10expression6nosideS1_P5valueS8_EEEE^[G|[GN4expr15binop_operationIL10exp_opcode16EXadL_Z12eval_op_lessP4typeP10expression6nosideS1_P5valueS8_EEEE^\GTPGN4expr24usual_ax_binop_operationIL10exp_opcode16EXadL_Z12eval_op_lessP4typeP10expression6nosideS1_P5valueS8_EEEE^t\Gh\GN4expr20comparison_operationIL10exp_opcode16EXadL_Z12eval_op_lessP4typeP10expression6nosideS1_P5valueS8_EEEE^\G\GN4expr15binop_operationIL10exp_opcode17EXadL_Z11eval_op_gtrP4typeP10expression6nosideS1_P5valueS8_EEEE^p]GTPGN4expr24usual_ax_binop_operationIL10exp_opcode17EXadL_Z11eval_op_gtrP4typeP10expression6nosideS1_P5valueS8_EEEE^]G]GN4expr20comparison_operationIL10exp_opcode17EXadL_Z11eval_op_gtrP4typeP10expression6nosideS1_P5valueS8_EEEE^`^GT^GN4expr21ada_bitwise_operationIL10exp_opcode11EEE^^GTPGN4expr21ada_bitwise_operationIL10exp_opcode12EEE^_GTPGN4expr21ada_bitwise_operationIL10exp_opcode13EEE^X_GTPGN4expr14unop_operationIL10exp_opcode92EXadL_Z12ada_atr_sizeP4typeP10expression6nosideS1_P5valueEEEE^_GLQGN4expr14unop_operationIL10exp_opcode93EXadL_Z11ada_atr_tagP4typeP10expression6nosideS1_P5valueEEEE^`GLQGN4expr15binop_operationIL10exp_opcode25EXadL_Z16ada_binop_minmaxP4typeP10expression6nosideS1_P5valueS8_EEEE^x`GTPGN4expr15binop_operationIL10exp_opcode26EXadL_Z16ada_binop_minmaxP4typeP10expression6nosideS1_P5valueS8_EEEE^`GTPGN4expr14unop_operationIL10exp_opcode91EXadL_Z11ada_pos_atrP4typeP10expression6nosideS1_P5valueEEEE^haGLQG|OGDȕd0`OGDȕdH`|PGHhhDȕd@(H`PGDȕd@`QGPDȕd8d0`QG@Dȕd8@d@RGDȕdl `RGDȕdx`SGtDȕdll `8SG(pDȕdxt`SGDȕdĮX`DTGܰDȕdĮ|X`TGDȕd`UGtPDȕd`pUGDdğDȕd8@(`UGijDȕd8@ ``VG$Dȕd8@ VG<Dȕd8@`DWGȻXDȕd@H`WGDȕd@H`4XGHhDȕd@H`XG(Dȕd@H`$YGȺDȕd@H`YG(<Dȕd@H`ZGHh<Dȕd@HPZGȦDȕd@HP[GHh\Dȕd@H`|[G\Dȕd@H([GȹDȕd@H(h\G|Dȕd@؝H`\Gȸ|Dȕd@؝Hd]G(Dȕd@؝H]GȷDȕd@НH`T^G(Dȕd@НHج^GHh(Dȕd@НHج _GDȕd@ȝH`L_GHh(Dȕd@H`_G(Dȕd@H`_GDdDȕd8@`l`G$Dȕd8@``Gȶ<Dȕd@H`\aGСDȕd@H`aGIJpDȕd8@`  !"#!$%&'(!!)*+,!-.!!/0123456!78!9:;<=!!>?@A!BC!!865+6-.+,+++++++411111111111*5%$00'3&(#)1111111111111111 "00 11111111110/ 1111 21!11 1  !!&&$$!$00!!!!a!$$    ~>mok^0\PNG0'p(ZSPI>H'BK-,BI]fyS36?HK9Toh@i;8N|2(YG}&;?K23su`N/.|z]X6Q`c+bMc[e\zhu@)9>N_pszS0z #%7e1#%1#%;;=hh#%==f7e#%#%f ii')i')  """ "<"444<<< EEE4<4""4EFFF !!!F<!<F""!4HHHHIII!]]]IMMM!HI!MJJJ]M!JKKK!JK!$$$KM$LLL^^^$LKJL$MNNN^$mmmNm$KJNOOO$LO$mkcO$&&&&&&&&&L&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&0000000000000000000000000000000000000000000000000000000000000000000PPPQQQ`P\QRRRP[BQ/RSSSTTTRPS.UTVVVS-UT,VYUQ+VPYRUYSUWWWYUQWVYRWYSXZXXZVXZggWXZsXXZglllsXZslWalsggaassaaaaaapppppaaaaannnnnqqqnnnnqrrrqrnnnnrnntttnnnntuuuntuvvvwwwuvywxxxvwyxtyxyzzz{{{yzty{xz|||{}~|}~|}~x{}~}~|}~{|     !"#$%  !"#$%(?VI@EEFeaIZG^IIggHhiiVIiieIZ]II)+,,-...../................000000000000000000001..000000000000000000444:(:EEF;5<<G;6<<\7H=EEF=MGEEF>H<G7)=<HJ=MEEF>)KGEEFLHGJEEFHKGN:LHO444;<<PEEEN=O6TU7HEEFPEEF]G<G=HTUH'7mmmnEEFQGEEFRoHSGfEEFfHQGEEFRHGSEEFHtGEEFHGrqHWtEEFXmmmGnYrqHEEFWsGXolHY+,,,+++++s++++++++++++++++[[[[[[[[[[[[[[[[[[[[+++[[[[[[[[[[[[[[[[[[+++++++++^++++++++++++++++````````````````````++```````````````````EEFEEFj]GjGEEFH]lH_GEEFEEFHuG^IGEEFH^yH]GIIv]HDuICwI~xyEEFAI9IvGz32IwH~xII|&IIz}&{II|IIEEFI}IG{]HIIEEFGHIEEFIGEEFHGIHIEEFGEEFHGEEFEEFHGGEEFHHIGIHEEFEEFIGIGHEEFHGIIHIIIIIIEEFHGEEFHGHEEFGIHIEEFEEFIGIGHEEFHIGIHEEFEEFGIEEFGHIGHEEFHEEFGEEFGHGHHGGHH''''''''''''''*****88888888BBBBIIIIIIIII+++++++++++++++++bbbbbbbbbbbbbbbbcccddddkkkkkppppppppNLGY\LGMGGMGTMG]MGhMGrMG{MG4KMGMGMGMGMGMG]QMGMGMG!RMGVMGMGMGMGMGNGMGPMGMG NGMGNGNG!NGNG-NGO R9NGRNGbNGsNGzNGNG # 8=S"9I1% 3>FFFgMtqrKNX[:R ` TYtttttt*\F ]V`ciDFehjIY"LG!-LG!P!1N#ALG$JI%\Q&SX'FLG(.O)J*T+&P,J- @:?"A9#>;DB+C !$%&'()*,-./012345678<=ABi32 n8>?  >  XYZ[*],_,-./025672::;=M*+,* ,,Fs:;?EAGHIJKLMNOPQRSTUV M*?,h?jAem12i4AlAn s"#$%&:C:t: :A:AD&??A?:? ?"?"#$%&e:<B12348:>?@AD12348:>?@AD   "'( "1234'(8::<@?AB:<=B  "#$%& "'( ?:<B "'( :<B "'( :<B "'( :<B " '( "#$%& :<B,-./0 ?67:;,-./0567:;,-./067:; "#$%&(*+ "#$%&( "#$%&( "#$%&( "#$%&*+ "#$%&*+ "#$%& "#$%& "#$%&yz8`r#7a:k;<0&'9*+/:[;<]\#()##$^>?@ABqXYZCD/uEFvhi$$$EF_|gjpbcdosOPQRSTUVwt V RSTUV.efef{ ,  ef- NOPQRSTUV     ,    ;<=NOPQRSTUV;<>?@AB;<CDEF>?@ABCDEF>?@ABCDEFGHIJKLMlNOPQRSTUVWmnGHIJKLMNOPQRSTUVWGHIJKLMNOPQRSTUVWGHIJKLMNOPQRSTUVWlNOPQRSTUVmnNOPQRSTUVNOPQRSTUVNOPQRSTUVNOPQRSTUVTUXVWZ[Y]TTTTTTT'456789Sa_ut]'Tdijm\TTDEPPPIJTTTTTTTTTTTTTTTTTTTTTTTTOT ^TTTTTTgcefTTFGH]'()23*1#$&% "!TT:T>B;T?TCTTTT' b`nqlorhkTTTvPT<@=AT TTQ],+PTNTTMTps T/.LK   '28<CFJZaehjlnr  !#)/579;=?EOQV_bfjr} !#%  "'(: ,-./067:; "#$%&(38124:@ *+*?*+A?N\ACNN:TTT KLNNKKKKKKHKWKKKKKKKKKMMMMMM::::KLJ ,NK_NKN_A\H*?AD5HKWMMMMNNNN?I*+?NK NTK5?AA?K:N_?*TKNN?NN???EFGGGHHHHIHJHHHHHHKKKKKLLLLLHKKKKKKKKKMMMMMMMMMMMMMNNNNNNOOPPQQRRSSHHHHHHHHHHHHTTUVVHHHHHHHHWWWWXXYZZZ[[\\\]^______HHHM%ţ}~x !"123456Ada(...)Cannot unpack %d bits into buffer of %d bytesCould not find operator name for opcode___XVNTKBLJMLONGEST recursively_update_array_bitsize(type*)../../gdb/ada-lang.ctype->code () == TYPE_CODE_ARRAYvalue* val_atr(type*, LONGEST)discrete_type_p (type)argument to 'VAL out of range%*sPositional, index = %d %*sDiscrete range: %*sName: %*sOthers: %*sAggregate %*sChoices: e.full_namecatch exceptioncatch exception unhandledcatch handlerscatch assertunexpected catchpoint typeGNAT_GCC_exception_Access(gcc_exception).all.occurrence.id_ada_exceptionError in testing exception condition: ___XVLid.full_nameinvalid Ada operator name: %sbkptno`%s' Ada exceptionall Ada exceptionsunhandled Ada exceptions`%s' Ada exception handlersall Ada exceptions handlersfailed Ada assertionsCondition missing after `if' keywordJunk at end of expressionwhat return in %s (enumeral) at %s:? at ? canceled because the command is ambiguous See set/show multiple-symbol.[0] cancel at %p[%p]:%d at %ps:%d '(%s) (enumeral) PS2overload-choiceone or more choice numbersArgument must be choice numbercancelledSelect no more than %d of the aboveUnable to find field %s in struct %s. Abortingobject size is larger than varsize-limitLONGEST ada_discrete_type_high_bound(type*)high.kind () == PROP_UNDEFINEDUnexpected type in ada_discrete_type_high_bound.LONGEST ada_discrete_type_low_bound(type*)low.kind () == PROP_UNDEFINEDUnexpected type in ada_discrete_type_low_bound.Invalid address for Ada main program name.___XR___XERETVALPARENTREP___XV'VAL only defined on discrete types'VAL requires integral argumentwide_wide_characterunsigned char["%02x"]["%04x"]Membership test incompletely implemented; always returns true___XDTBTK___ada%cB%dBad GNAT array descriptor bounds'POS only defined on discrete typesenumeration value is invalid: can't find 'POSlong_integer (GNAT_GCC_exception_Access(gcc_exception).all.occurrence.id)long_integer (e)long_integer (&standard.%s)long_integer (&%s)failed to reevaluate internal exception condition for catchpoint %d: %s<_ada__ada_%svoid ada_lookup_encoded_symbol(const char*, const block*, domain_enum, block_symbol*)___XUT___XUT___XVEP_BOUNDS___XPlong int decode_packed_array_bitsize(type*)is_thick_pntr (type)could not understand bit size information on packed arrayada__tags__dispatch_tablesecond operand of %s must not be zero.attempt to do packed indexing of something other than a packed arraydon't know bounds of arraypacked array index %ld out of boundsCannot assign this kind of variant recordvoid ada_fixup_array_indexes_type(type*)index_desc_type->num_fields () > 0unexpected null name on descriptive typecannot slice a packed arrayMultiple matches for %s invalid dimension number to '%sattempt to take bound of something that is not an arrayLB%dBad GNAT array descriptor___XVS___XVU(null)Type %s is not a structure or union typeType %s has no component named %sada__tags__interface_tagYour Ada runtime appears to be missing some debugging information. Cannot insert Ada exception catchpoint in this configuration.Symbol "%s" is not a function (class = %d)adainitUnable to insert catchpoint. Is this an Ada main program?Unable to insert catchpoint. Try to start the program first.Cannot insert Ada exception catchpoints in this configuration.const char* ada_exception_sym_name(ada_exception_catchpoint_kind)data->exception_info != NULLunexpected catchpoint kind (%d)Catchpoint symbol not found: %sUnable to insert catchpoint. %s is not a function.condition missing after `if' keywordJunk at end of arguments.Could not find a match for %sNo definition found for %stype* to_fixed_range_type(type*, value*)raw_type != NULLraw_type->name () != NULL___LUnknown lower bound, using 1.___UUnknown upper bound, using %ld.___XAcould not find bounds information on packed arraycould not understand bounds information on packed arraycan't unpack arrayBounds unavailable for null array pointer.too many subscripts (%d expected) Temporary catchpoint Catchpoint dispfailed to get exception name: %sunhandled exception-namefailed assertiongdb::unique_xmalloc_ptr ada_exception_message_1()e_msg_val != NULLexception-message%s___XVZunable to read value of %s (%s)There is no member named %s.Attempt to extract a component of a value that is not a record.tsdada__tags__type_specific_dataexpanded_nameInvalid type size for `%s' detected: %s.Invalid type size for detected: %s.record type with dynamic size is larger than varsize-limitLeft operand of assignment is not a modifiable lvalue.Attempt to compare array with non-arrayunexpected attribute encounteredthe 'length attribute applies only to array typesunimplemented type attributeAttempt to dereference null array pointer.Attempt to take contents of a non-pointer value.Unexpected unresolved symbol, %s, during evaluationcould not decode constrained packed array typeint ada_is_redundant_range_encoding(type*, type*)___XDLU_cannot subscript or call something of type `%s'cannot subscript or call a recordwrong number of subscripts; expecting %delement type of array unknownAttempt to index or call something other than an array or functioncannot take slice of non-arrayunable to get positions in slice, use bounds insteadLeft-hand side must be array or record.unable to determine array boundscannot assign arrays of different lengthvalue* ada_promote_array_of_integrals(type*, value*)is_integral_type (TYPE_TARGET_TYPE (type))value_type (val)->code () == TYPE_CODE_ARRAYis_integral_type (TYPE_TARGET_TYPE (value_type (val)))TYPE_LENGTH (TYPE_TARGET_TYPE (type)) > TYPE_LENGTH (TYPE_TARGET_TYPE (value_type (val)))Incompatible types in assignmentExtra components in aggregate ignored.Index in component association out of bounds.Invalid record component association.Unknown component name: %s.numeric_errorinvalid regular expressionAll Ada exceptions matching regular expression "%s": All defined Ada exceptions: Prefix command for changing Ada-specific settings.Generic command for showing Ada-specific settings.trust-PAD-over-XVSThis is related to the encoding used by the GNAT compiler. The debugger should normally trust the contents of PAD types, but certain older versions of GNAT have a bug that sometimes causes the information in the PAD type to be incorrect. Turning this setting "off" allows the debugger to work around this bug. It is always safe to turn this option "off", but this incurs a slight performance penalty, so it is recommended to NOT change this option to "off" unless necessary.Show whether an optimization trusting PAD types over XVS types is activated.Enable or disable an optimization trusting PAD types over XVS types.print-signaturesShow whether the output of formal and return types for functions in the overloads selection menu is activated.Enable or disable the output of formal and return types for functions in the overloads selection menu.Catch Ada exceptions, when raised. Usage: catch exception [ARG] [if CONDITION] Without any argument, stop when any Ada exception is raised. If ARG is "unhandled" (without the quotes), only stop when the exception being raised does not have a handler (and will therefore lead to the task's termination). Otherwise, the catchpoint only stops when the name of the exception being raised is the same as ARG. CONDITION is a boolean expression that is evaluated to see whether the exception should cause a stop.Catch Ada exceptions, when handled. Usage: catch handlers [ARG] [if CONDITION] Without any argument, stop when any Ada exception is handled. With an argument, catch only exceptions with the given name. CONDITION is a boolean expression that is evaluated to see whether the exception should cause a stop.Catch failed Ada assertions, when raised. Usage: catch assert [if CONDITION] CONDITION is a boolean expression that is evaluated to see whether the exception should cause a stop.Attempts to access an object whose size is not a compile-time constant and exceeds this limit will cause an error.Show the maximum number of bytes allowed in a variable-size object.Set the maximum number of bytes allowed in a variable-size object.List all Ada exception names. Usage: info exceptions [REGEXP] If a regular expression is passed as an argument, only those matching the regular expression are listed.Set Ada maintenance-related variables.Show Ada maintenance-related variables.ignore-descriptive-typesWhen enabled, the debugger will stop using the DW_AT_GNAT_descriptive_type DWARF attribute.Show whether descriptive types generated by GNAT should be ignored.Set whether descriptive types generated by GNAT should be ignored.ada-langlanguage_defn::language_defn(language)languages[lang] == nullptr.adb.ads.a.ada.dg__gnat_raise_nodefer_with_msg__gnat_unhandled_exceptionsystem__assertions__raise_assert_failure__gnat_begin_handler__gnat_debug_raise_exception__gnat_debug_raise_assert_failure__gnat_begin_handler_v1constraint_errorprogram_errorstorage_errortasking_errorOadd"+"Osubtract"-"Omultiply"*"Odivide"/"Omod"mod"Orem"rem"Oexpon"**"Olt"<"Ole"<="Ogt">"Oge">="Oeq"="One"/="Oand"and"Oor"or"Oxor"xor"Oconcat"&"Oabs"abs"Onot"not"___clean[.$a-zA-Z0-9_]*$___finalizer[.$a-zA-Z0-9_]*$^[agis]-.*\.ad[bs]$/lib.*/libpthread\.so[.0-9]*$/lib.*/libpthread\.a$/lib.*/libc\.so[.0-9]*$/lib.*/libc\.a$virtual std::string language_defn::compute_program(compile_instance*, const char*, gdbarch*, const block*, CORE_ADDR) const../../gdb/language.hlanguage_defn::compute_program => {%s} %sLONGEST dynamic_prop::const_val() const../../gdb/gdbtypes.hm_kind == PROP_CONSTrange_bounds* type::bounds() consttype::bounds called on type with invalid codebasic_string_view::substr%s: __pos (which is %zu) > __size (which is %zu)virtual void ada_language::collect_symbol_completion_matches(completion_tracker&, complete_symbol_mode, symbol_name_match_type, const char*, const char*, type_code) constcode == TYPE_CODE_UNDEFvector::_M_default_appendvoid language_arch_info::add_primitive_type(type*)type != nullptrshort_integervoid language_arch_info::set_string_char_type(type*)m_string_char_type == nullptrlong_long_integerlong_long_floatnaturalpositivestorage_offsetvoid language_arch_info::set_bool_type(type*, const char*)m_bool_type_default == nullptrm_bool_type_name == nullptrvoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {objfile*}]../../gdb/../gdbsupport/observable.hvisit_states[index] != visit_state::VISITINGAttaching observable %s to observer %sobservervoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {inferior*}]FvP8inferiorEl^GFvP7objfileEl^GN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEEEE^GpLN4expr16string_operationE^G|OGN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_S5_EEE^GpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_S5_EEE^8G,GN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EESt6vectorIS5_SaIS5_EEEEE^GpL19gdb_exception_error^$GGN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EE10exp_opcodeiEEE^HGpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EE10exp_opcodeiEEE^GGN4expr23tuple_holding_operationIJP4typeSt10unique_ptrINS_9operationESt14default_deleteIS4_EEEEE^0GpLN4expr15ada_associationE^G23ada_catchpoint_location^G$FI14ada_catchpoint^GLFI13gdb_exception^G12ada_language^ GNPFvP7objfileE^ !@#$%^&*()+=|~`}{[]";:?/,-GGGGGGGGGGGGGGGGGGGGGGGGGGG G GG G G &G.G!2G7GD=GBG9GGCGG8GD  1h1G11pDȕd0 `__gnat_ada_main_program_name~GGGGGHGaGbGgGlGoGtGG p77Gx$77$Gx78G088X8PGdx88XG@99Dȕd*x`XGFGWGeGsGGG G.GGG GڿGxGGGڿG<"0_0_01_x1_H^`GPLRG G++Ć(18,H* -<ܻGG1NALGJIG\QSXFLG.OT&PJ^HGGGknown_tasks_kind != ADA_TASKS_UNKNOWNYour application does not use any Ada tasks. void print_ada_task_info(ui_out*, const char*, inferior*)task_info != NULLtask-idTIDparent-idP-IDPriStateNameAccepting RV with %-4dWaiting on RV with %-3d[Current task is unknown] [Current task is %s] Task ID %d not known. Use the "info tasks" command to see the IDs of currently known tasksCannot switch to task %s: Task is no longer runningUnable to compute thread ID for task %s. Cannot switch to this task.[Switching to task %s] Ada Task: %s Name: %s Thread: %#lx LWP: %#lx Base CPU: %d Parent: %dNo parent Base Priority: %d State: Accepting rendezvous with %dState: Waiting on task %d's entryada-tasksProvide information about all known Ada tasks.Use this command to switch between Ada tasks. Without argument, this command simply prints the current task ID.UnactivatedRunnableTerminatedWaiting for child activationBlocked in accept or select with terminateWaiting on entry callAsynchronous Selective WaitDelay SleepWaiting for children terminationWaiting for children in terminate alternativeAsynchronous HoldActivatingBlocked in selective wait statementChild Activation WaitAccept or Select TermAsync Select WaitChild Termination WaitWait Child in Term Altvoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {bpstats*, int}]FvP7bpstatsiEl^GPFvP7bpstatsiE^GGRavenscar taskZGfGoGGGGGGGG!gY!gY!gY!gYOG!gYaGGZGfGoGzGGGGGG!G!gY!gY!gY!gYOG!gYaGlG .. basic_string::appendvoid print_range_type(type*, ui_file*, int)../../gdb/ada-typeprint.c%.*s: access (false, true)<%s-byte integer>mod %s<%s-byte float> => %sarray (?) of ? ()new %s with recordtagged record end recordrecord (?) is ... end recordrecord (?) is null; end recordrecord (?) is %*scase ? is %*swhen ? => %*s %*send case; %*send recorda%d: return array (%s<>) of %*scase %s is %*send case; %*swhen | ? => null;int print_record_field_types(type*, type*, ui_file*, int, int, const type_print_options*)prop->kind () == PROP_VARIANT_PARTS""["%0*x"] %p[%p]internal error: unhandled type in ada_print_scalarInvalid type code in symbol table.) (...?)void ada_value_print_1(value*, ui_file*, int, const value_print_options*)../../gdb/ada-valprint.c0x0%ld %psnanbasic_string::replace%s: __pos (which is %zu) > this->size() (which is %zu)Nan%s.0%.*s.0%svoid ada_val_print_string(type*, const gdb_byte*, int, ui_file*, int, const value_print_options*)elttype != NULLTYPE_LENGTH (elttype) != 0void ada_varobj_ind(value*, type*, value**, type**)../../gdb/ada-varobj.cparent_value == NULLparent_type->code () == TYPE_CODE_TYPEDEFunable to get bounds of array, assuming null array%s.all(%s).allint ada_varobj_get_struct_number_of_children(value*, type*)parent_type->code () == TYPE_CODE_STRUCT || parent_type->code () == TYPE_CODE_UNIONvoid ada_varobj_describe_child(value*, type*, const char*, const char*, int, std::string*, value**, type**, std::string*)parent_path_expr != NULL(%s)(%.*s'(%s))(%s)(%s)void ada_varobj_describe_struct_child(value*, type*, const char*, const char*, int, std::string*, value**, type**, std::string*)(%s).%.*sunexpected code path{...}[%d] %s@8dW,addrmap_relocate is not implemented yet for mutable addrmaps../../gdb/addrmap.caddrmap_create_fixed is not implemented yet for fixed addrmapsaddrmap_fixed_set_empty: fixed addrmaps can't be changed addrmap_find is not implemented yet for mutable addrmapsvoid* splay_obstack_alloc(int, void*)size >= sizeof (*n)addrmap* addrmap_mutable_create_fixed(addrmap*, obstack*)fixed->num_transitions == num_transitionsvoid addrmap_mutable_set_empty(addrmap*, CORE_ADDR, CORE_ADDR, void*)TTpDebugger's willingness to use agent in inferior as a helper is %s. If on, GDB will delegate some of the debugging operations to the agent, if the target supports it. This will speed up those operations that are supported by the agent. If off, GDB will not use agent, even if such is supported by the target.Show debugger's willingness to use agent as a helper.Set debugger's willingness to use agent as a helper.onoff8G;G thread-exited,id="%d",group-id="i%d" breakpoints-invalid breakpoint %d catchpoint %d watchpoint %d starting stopped exited %d signalled signal-name signal-name-end signal-string signal-string-end signal breakpoints-headers field %d breakpoints-table record breakpoints-table-end frames-invalid new-thread thread-changed field-begin field-name-end field-value field-end quit error error-begin value-history-begin %d value-begin value-history-value value-history-end value-end display-begin display-number-end display-format display-expression display-expression-end display-value display-end arg-begin arg-name-end arg-value arg-end middle source %s:%d:%d:%s:%s frame-begin %d %s function-call signal-handler-caller frame-address frame-address-end frame-function-name frame-args frame-source-begin frame-source-file frame-source-file-end frame-source-line frame-source-end frame-where frame-end array-section-begin %d elt-rep %u elt-rep-end elt array-section-end annotatevoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {breakpoint*}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {thread_info*, int}]FvP11thread_infoiEl^GFvP10breakpointEl^GPFvP10breakpointE^GGPFvP11thread_infoiE^GGint legacy_register_sim_regno(gdbarch*, int)../../gdb/arch-utils.cregnum >= 0 && regnum < gdbarch_num_regs (gdbarch)This architecture has no method to convert a memory tag to a string.No virtual frame pointer available__bf16gdbarch_update_p: Architecture not found gdbarch_update_p: Architecture %s (%s) unchanged gdbarch_update_p: New architecture %s (%s) selected Architecture of file not recognized.initialize_current_architecture: No archinitialize_current_architecture: Arch not foundinitialize_current_architecture: Selection of initial architecture failedautoShow architecture of target.Set architecture of target.processorSelected architecture %s is not compatible with reported target architecture %sSelected architecture %s is ambiguous with reported target architecture %svoid gdbarch_info_fill(gdbarch_info*)info->bfd_arch_info != NULLThe target architecture is set to "auto" (currently "%s"). The target architecture is set to "%s". could not select an architecture automaticallyset_architecture: bfd_scan_arch failedArchitecture `%s' not recognized. The target endianness is set automatically (currently big endian). The target endianness is set automatically (currently little endian). The target is set to big endian. The target is set to little endian. set_endian: architecture update failedLittle endian target not supported by GDB Big endian target not supported by GDB set_endian: bad valueThis architecture has no method to collect a return address.This target does not support inferior memory allocation by mmap. -mcmodel=large-m%d%sint default_print_insn(bfd_vma, disassemble_info*)disassemble_fn != NULLShow endianness of target.Set endianness of target.autolittlebigGGGorg.gnu.gdb.arm.coreuint32lrcode_ptrcpsrorg.gnu.gdb.arm.vfpd0d1d3d4d5d6d7d9d10d11d12d13d14d15d16d17d18d19d20d21d22d23d24d25d26d27d28d29d30d31org.gnu.gdb.arm.neonstd::vector thumb_get_next_pcs_raw(arm_get_next_pcs*)../../gdb/arch/arm-get-next-pcs.c(itstate & 0x0f) != 0Invalid update to pc in instructionorg.gnu.gdb.arm.m-profilexpsrorg.gnu.gdb.xscale.iwmmxtuint8iwmmxt_v8u8uint16iwmmxt_v4u16iwmmxt_v2u32iwmmxt_vec64iuint64u64wR0wR1wR2wR3wR4wR5wR6wR7wR8wR9wR10wR11wR12wR13wR14wR15wCSSFwCASFwCGR0wCGR1wCGR2wCGR3Invalid Arm FP type: %darm_fpa_extInvalid Arm M type: %darm-linux-gdb supports %d hardware watchpoints but target supports %darm-linux-gdb supports %d hardware breakpoints but target supports %dvoid arm_linux_insert_hw_breakpoint1(const arm_linux_hw_breakpoint*, int)../../gdb/arm-linux-nat.ci != countvoid arm_linux_remove_hw_breakpoint1(const arm_linux_hw_breakpoint*, int)Unexpected error setting breakpointUnexpected error setting watchpointvirtual int arm_linux_nat_target::can_use_hw_breakpoint(bptype, int, int)unknown breakpoint typearm_hwbp_control_t arm_hwbp_control_initialize(unsigned int, arm_hwbp_type, int)(byte_address_select & ~0xffU) == 0hwbp_type != arm_hwbp_break || ((byte_address_select & 0xfU) != 0)void arm_linux_hw_watchpoint_initialize(CORE_ADDR, int, target_hw_bp_type, arm_linux_hw_breakpoint*)cap != NULLcap->max_wp_length != 0Unable to fetch general registers.Unable to fetch the floating point registers.Unable to fetch WMMX registers.Unable to fetch VFP registers.Unable to store general registers.Unable to store floating point registers.Unable to store WMMX registers.Unable to fetch VFP registers (for update).Unable to store VFP registers.ptid_t regcache::ptid() const../../gdb/regcache.hm_ptid != minus_one_ptidHwLwlw<|HlTlgh(0|DoPuHHwDw?/@/((2/$0h.$0h.\s$0h.1]1(0::K(;M(TO(8gDHQ(8S(T(p` p` p` p` ` w`V(//^/Z(///^(T_(_( a(b(_Xf(8g(g(h(^0j(l(m(o(p(/r(/Dt($u(v(v(w(a 4B<,=ȉ`8h>S'{(D|( }(}(~(|(D((|((($(<(((((P((((((0D((T((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wx(w0wkkg8wHadcontrol.step_resume_breakpoint == NULLcouldn't find previous frame to set momentary breakpoint for sigreturn/rt_sigreturnfound SVC callInvalid register name `%s' on expression `%s'.32displaced_step_copy_insn_closure^ HN4expr13add_operationE^ HTPGN4expr18unop_ind_operationE^ H8L36arm_displaced_step_copy_insn_closure^ H H H8$Dȕd@H HXxDğ@d*H HЧLz`xyyСDViS!gY{TmJS8Invalid VFP CPRC type: %d.../../gdb/arm-tdep.cint arm_register_sim_regno(gdbarch*, int)reg >= 0 && reg < gdbarch_num_regs (gdbarch)Bad REGNUM %d__truncdfsf2__aeabi_d2f__tls_get_addr__aeabi_read_tpPrologue scan stopped at %sthumb_analyze_prologuepspno PSP thread stack unwinding supported.The current execution mode assumed (even when symbols are available) is "%s". The current execution mode assumed (when symbols are unavailable) is "%s". The current ARM ABI is "auto" (currently "%s"). The current ARM ABI is "%s". The current ARM floating point model is "auto" (currently "%s"). The current ARM floating point model is "%s". arm_dump_tdep: fp_model = %i arm_dump_tdep: have_fpa_registers = %i arm_dump_tdep: have_wmmx_registers = %i arm_dump_tdep: vfp_register_count = %i arm_dump_tdep: have_vfp_pseudos = %i arm_dump_tdep: have_neon_pseudos = %i arm_dump_tdep: have_neon = %i arm_dump_tdep: Lowest pc = 0x%lx reg-names-The disassembly style is "%.*s". register_status arm_pseudo_read(gdbarch*, readable_regcache*, int, gdb_byte*)regnum >= num_regsregnum < 32void arm_pseudo_write(gdbarch*, regcache*, int, const gdb_byte*)builtin_type_arm_extIVO DVZ OFL UFL INX Hardware FPU type %d Software FPU type %d mask: __gdb_builtin_type_neon_q__gdb_builtin_type_neon_dProcess record does not support instruction 0x%0x at address %s. no syscall record support int arm_record_ld_st_reg_offset(insn_decode_record*)no decoding pattern foundconst gdb_byte* arm_sw_breakpoint_from_kind(gdbarch*, int, int*)unexpected arm breakpoint kindarm(v[^- ]*)?could not update architectureAAPCSInvalid ABI accepted: %s.Invalid fp model accepted: %s.int trad_frame_saved_reg::realreg() const../../gdb/trad-frame.hm_kind == trad_frame_saved_reg_kind::REALREGread r%d value %.8lxdisplaced_read_regdetected PC offset %.8lx for STM instructioncleanup_block_store_pc__acle_se_copying unpredictable insn %.8lxarm_copy_unpredcopying undefined insn %.8lxarm_copy_undefcopying b immediate insn %.4x with offset %dthumb_copy_bcopying insn %.4x, opcode/class '%s' unmodifiedthumb_copy_unmodified_16bitcopying insn %.4x %.4x, opcode/class '%s' unmodifiedthumb_copy_unmodified_32bitcopying insn %.8lx, opcode/class '%s' unmodifiedarm_copy_unmodifiedarm_analyze_prologueint arm_record_vfp_data_proc_insn(insn_decode_record*)Process record: error reading memory at addr %s len = %d. int arm_record_extension_space(insn_decode_record*)!INSN_RECORDED(arm_insn_r)int thumb2_record_str_single_data(insn_decode_record*)int arm_vfp_cprc_sub_candidate(type*, arm_vfp_cprc_base_type*)count == 0(TYPE_LENGTH (t) % unitlen) == 0arm_store_return_value: Floating point model not supportedarm_extract_return_value: Floating point model not supportedcopying %s immediate insn %.8lxarm_copy_b_bl_blxSingle-stepping BX to non-word-aligned ARM instruction.writing pc %.8lxInstruction wrote to PC in an unexpected way when single-steppingInvalid argument to displaced_write_regcleanup for svc, resume at %.8lxUnexpected register %d.plt.sec__ARM_call_via_.gnu.sgstubsread pc value %.8lxcopying insn %.8lxarm_copy_bx_blx_regwriting r%d value %.8lxvoid cleanup_block_load_pc(gdbarch*, regcache*, arm_displaced_step_copy_insn_closure*)num_to_shuffle < 16LDM: move loaded register r%d to r%dcleanup_block_load_pcLDM: register r%d already in the right placeLDM: restored clobbered register r%dincdecbeforeCannot single-step exception returnvoid cleanup_block_load_all(gdbarch*, regcache*, arm_displaced_step_copy_insn_closure*)dsc->u.block.load != 0ldmemulating block transfer: %s %s %scleanup_block_load_allcopying ldr pc (0x%x) R%d %c imm12 %.4xthumb2_copy_load_literalldrbldrcopying %s%s r%d [r%d] insn %.8lxarm_copy_ldr_str_ldrb_strbcopying ldr r%d [r%d] insn %.4x%.4xthumb2_copy_load_reg_immcopro load/storecopying coprocessor load/store insn %.4x%.4xthumb2_copy_copro_load_storeneon 64bit xfer/mrrc/mrrc2/mcrr/mcrr2copying undefined insn %.4x %.4xthumb_32bit_copy_undefvfp/neon vmovvfp/neon vstm/vpushvfp/neon vldm/vpopvstrstc/stc2coproccopying coprocessor load/store insn %.8lxarm_copy_copro_load_storevfp/neon mrrc/mcrrneon 64bit xfermrrc/mrrc2vfp dataproccdp/cdp2neon 8/16/32 bit xfermcr/mcr2mrc/mrc2copying svc insn %.8lxarm_copy_svcpreload regcopying preload insn %.8lxarm_copy_preload_regarm_copy_preloadtbhtbbcbnzALUunprivileged process thumb insn %.4x at %.8lxthumb_process_displaced_insn%s base 0x%x offset 0x%x offset 0x%xthumb2_copy_table_branchload/store dual/exsrs/rfedisplaced: Unpredictable LDM or STM with base register r15unpredictable ldm/stmcopying block transfer insn %.4x%.4xthumb2_copy_block_xferint thumb2_copy_block_xfer(gdbarch*, uint16_t, uint16_t, regcache*, arm_displaced_step_copy_insn_closure*)LDM r%d%s, {..., pc}: original reg list %.4x, modified list %.4xALU immcopying reg %s insn %.4x%.4xthumb2_copy_alu_immdp (shift reg)copying %s insn %.4x %.4x with offset %.8lxthumb2_copy_b_bl_blxmisc ctrlcopying thumb adr r%d, #%d:%d insn %.4x%.4xthumb_copy_pc_relative_32bitdp/pbdp/micopying pld/pli pc (0x%x) %c imm12 %.4xthumb2_copy_preloadpli/pldldrb{reg, immediate}/ldrbtpld/unalloc memhintldrh/ldrhtldrtneon elt/struct load/storedp(reg)mul/mua/difflmul/lmuathumb_process_displaced_32bit_insn: Instruction decode errorshift/add/sub/mov/cmpdata-processingcopying insn %.4xthumb_copy_bx_blx_regALU regcopying ALU reg insn %.4xthumb_copy_alu_regspecial datacopying thumb ldr r%d [pc #%d]thumb_copy_16bit_ldr_literalldr/strcopying thumb adr r%d, #%d insn %.4xthumb_decode_pc_relative_16bitsp-relativecopying %s [r%d = 0x%x] insn %.4x to %.8lxthumb_copy_cbnz_cbzcopying thumb pop {%.8x, pc} insn %.4xthumb_copy_pop_pc_16bitPOP {..., pc}: original reg list %.4x, modified list %.4xIf-Thencopying svc insn %.4xthumb_copy_svcthumb_process_displaced_16bit_insn: Instruction decode errorstepping insn %.8lx at %.8lxarm_process_displaced_insncpssetendneon dataprocunallocated mem hintclrexdsbdmbisbsrsmovwmovtmsr immALU immediatecopying immediate %s insn %.8lxarm_copy_alu_immcopying reg %s insn %.8lxarm_copy_alu_regALU shifted regcopying shifted reg %s insn %.8lxarm_copy_alu_shifted_regmrs/msrclzbxjsaturating add/subbkptsmchalfword mul/mlasynchextra load/storecopying %sextra load/store insn %.8lxarm_copy_extra_ld_stcopy_extra_ld_st: instruction decode errorparallel add/sub signedparallel add/sub unsigneddecode/pack/unpack/saturate/reverseusad8usada8sbfxbfcbfiubfxcopying block transfer insn %.8lxarm_copy_block_xferarm_process_displaced_insn: Instruction decode errorwriting insn %.8lx at %.8lxarm_displaced_init_closurewriting insn %.4x at %.8lxcopy %s->%sProcess record: arm_process_record addr = %s unknown ARM EABI version 0x%xorg.gnu.gdb.arm.fpas0q0gdbarch* arm_gdbarch_init(gdbarch_info, gdbarch_list*)vfp_register_count == 0 || vfp_register_count == 16 || vfp_register_count == 32arm_gdbarch_init: bad byte order for float formatvoid arm_record_special_symbol(gdbarch*, objfile*, asymbol*)name[0] == '$'check mode of %.8lx instead of %.8lxarm_pc_is_thumbfake__stack_chk_guardGNU struct return in %s = %sarm_push_dummy_callarg %d in %s = 0x%sarg %d @ sp + %d.ARM.exidx.ARM.extabarm-tdepVarious ARM-specific commands.reg-names-std%s - %s The valid values are: The default is "std".disassemblerShow the disassembly style.Set the disassembly style.apcs32When off, a 26-bit PC will be used.Show usage of ARM 32-bit mode.Set usage of ARM 32-bit mode.fpuauto - Determine the FP typefrom the OS-ABI. softfpa - Software FP, mixed-endian doubles on little-endian ARMs. fpa - FPA co-processor (GCC compiled). softvfp - Software FP with pure-endian doubles. vfp - VFP co-processor.Show the floating point type.Set the floating point type.Show the ABI.Set the ABI.fallback-modeShow the mode assumed when symbols are unavailable.Set the mode assumed when symbols are unavailable.force-modeShow the mode assumed even when symbols are available.Set the mode assumed even when symbols are available.When on, arm-specific debugging is enabled.Show ARM debugging.Set ARM debugging.wCIDwConq1q2q3q4q5q6q7q8q9q10q11q12q13q14q15s1s3s5s6s7s8s9s10s11s12s13s14s15s17s18s19s20s21s22s23s24s25s26s27s28s29s30s31arm m exceptionarm stubarm epiloguearm exidx__gcc_personality_v0__gxx_personality_v0__gcj_personality_v0__gnu_objc_personality_v0arm prologuef5f6f7fpsa3wrsoftfpasoftvfpLONGEST trad_frame_saved_reg::addr() constm_kind == trad_frame_saved_reg_kind::ADDRCORE_ADDR objfile::section_offset(bfd_section*) const../../gdb/objfiles.hsection->owner == nullptr || section->owner == this->obfdsddqo'H-HX-HQX-H -H -H-H-H-H-H-H"-H&-H*-HAS.-H2-H6-H:-H>-HB-HF-HJ-HN-HR-HV-HZ-H^-Hb-Hf-Hr'H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,HhUT P PuSSkUShkUrkU|SSSSH GHRKuVV PV.H.H.H .H,GkGSHkG.Hk'H.HHH*\xh`hUT P PuSSkUShkUrkU|SS,TOWH G3Hp44H羾SHS GHHR GGGGG!G%G)G-G1G5G:G?GDGIGNG,H,HSGYG!gY!gY!gY!gY_GeGkGqG!gY!gY!gY!gYEGHG[OKGNGQGTGWG&HZG]GaGeGiGmGqGuGyG}GGGGGGGGGGGGGG-H;;5hUT P PuSSkUShkUrkU|S S S S S SHkUV .HV-L@UMbUF0LU U U 4$H Y OW GS .H-H-H-H-HkGTS^3H*N12_GLOBAL__N_122arm_instruction_readerE^3H3H*N12_GLOBAL__N_129target_arm_instruction_readerE^4H*N12_GLOBAL__N_122abstract_memory_readerE^@4H4H*N12_GLOBAL__N_118instruction_readerEasync-signals[event-loop] mark_async_signal_handler: markingasync signal handler `` clearing async signal handler `%s`clear_async_signal_handlerevent-loopinvoking async signal handler `%s`invoke_async_signal_handlersvoid delete_async_signal_handler(async_signal_handler**)../../gdb/async-event.cprev_ptrmarking async event handler `%s`mark_async_event_handlerclearing async event handler `%s`clear_async_event_handlerinvoking async event handler `%s`check_async_event_handlersvoid delete_async_event_handler(async_event_handler**)$datadir$debugdirExpanded $-variables to "%s".auto_load_expand_dir_vars$debugdir:$datadir/auto-loadMatching file "%s" to pattern "%s"filename_is_in_pattern_1Matched - empty patternNot matched - pattern "%s".Matched - file "%s" to pattern "%s".Directory argument required.%s%c%sDebugging output for files of 'set auto-load ...' is %s. Auto-load files are safe to load from any directory. List of directories from which it is safe to auto-load files is %s. List of directories from which to load auto-loaded scripts is %s. Auto-loading of .gdbinit script from current directory is %s. Auto-loading of canned sequences of commands scripts is %s. Local .gdbinit file was not found. Local .gdbinit file "%ps" has been loaded. Local .gdbinit file "%ps" has not been loaded. .debug_gdb_scriptsUnsupported auto-load script at offset %u in section %s of file %ps. Use `info auto-load %s-scripts [REGEXP]' to list them.Auto-loading specific settings. Configure various auto-load-specific variables such as automatic loading of Python scripts.Valid is only global 'set auto-load no'; otherwise check the auto-load sub-commands.void set_auto_load_cmd(const char*, int)../../gdb/auto-load.clist->type == set_cmdShow auto-loading specific settings. Show configuration of various auto-load-specific variables such as automatic loading of Python scripts.Print current status of auto-loaded files. Print whether various files like Python scripts or .gdbinit files have been found and/or loaded.Resolved file "%s" as "%s".filename_is_in_auto_load_safe_path_vecFile "%s" matches directory "%s".YesNo full name: full_pathinfolistvoid info_auto_load_cmd(const char*, int)!list->is_prefix ()list->type == not_set_cmdUpdating directories of "%s".auto_load_safe_path_vec_updateUsing directory "%s".Resolved directory "%s" as "%s".And canonicalized as "%s".$HOMEFile "%ps" auto-loading has been declined by your `auto-load safe-path' set to "%s"..gdbinitTo enable execution of this file add add-auto-load-safe-path %s line to your configuration file "%s". To completely disable this security protection add set auto-load safe-path / line to your configuration file "%s". For more information about this security protection see the "Auto-loading safe path" section in the GDB manual. E.g., run from the shell: info "(gdb)Auto-loading safe path" Attempted file "%s" %s.auto_load_objfile_script_1Searching 'set auto-load scripts-directory' path "%s".Loading %s script "%s" by extension for objfile "%s".int auto_load_objfile_script_1(objfile*, const char*, const extension_language_defn*).exeauto-load: Stripped .exe suffix, retrying with "%s".auto_load_objfile_scriptCouldn't read %s section of %psInvalid entry in %s sectionNon-nul-terminated entry in %s at offset %uEmpty entry in %s at offset %uLoading %s script "%s" from section "%s" of objfile "%s".source_script_fileMissing auto-load script at offset %u in section %s of file %ps. Use `info auto-load %s-scripts [REGEXP]' to list them.Missing/bad script name in entry at offset %u in section %s of file %ps.execute_script_contentsDirectory argument required. Use 'set auto-load safe-path /' for disabling the auto-load safe-path security.Invalid regexp: %sAutoLoadedScriptsTableLoadedScriptNo auto-load scripts matching %s. No auto-load scripts. gdb-scriptsIf enabled, canned sequences of commands are loaded when the debugger reads an executable or shared library. This option has security implications for untrusted inferiors.Show whether auto-loading of canned sequences of commands scripts is enabled.Enable or disable auto-loading of canned sequences of commands scripts.Print the list of automatically loaded sequences of commands. Usage: info auto-load gdb-scripts [REGEXP]If enabled, canned sequences of commands are loaded when debugger starts from .gdbinit file in current directory. Such files are deprecated, use a script associated with inferior executable file instead. This option has security implications for untrusted inferiors.Show whether auto-loading .gdbinit script in current directory is enabled.Enable or disable auto-loading of .gdbinit script in current directory.Print whether current directory .gdbinit file has been loaded. Usage: info auto-load local-gdbinitGDB scripts: OBJFILE%s Automatically loaded scripts are located in one of the directories listed by this option. Script names: %s%s%s This option is ignored for the kinds of scripts having 'set auto-load ... off'. Directories listed here need to be present also in the 'set auto-load safe-path' option.Show the list of directories from which to load auto-loaded scripts.Set the list of directories from which to load auto-loaded scripts.Various files loaded automatically for the 'set auto-load ...' options must be located in one of the directories listed by this option. Warning will be printed and file will not be used otherwise. You can mix both directory and filename entries. Setting this parameter to an empty list resets it to its default value. Setting this parameter to '/' (without the quotes) allows any file for the 'set auto-load ...' options. Each path entry can be also shell wildcard pattern; '*' does not match directory separator. This option is ignored for the kinds of files having 'set auto-load ... off'. This option has security implications for untrusted inferiors.Show the list of files and directories that are safe for auto-loading.Set the list of files and directories that are safe for auto-loading.Add entries to the list of directories from which it is safe to auto-load files. See the commands 'set auto-load safe-path' and 'show auto-load safe-path' to access the current full list setting.add-auto-load-safe-pathAdd entries to the list of directories from which to load auto-loaded scripts. See the commands 'set auto-load scripts-directory' and 'show auto-load scripts-directory' to access the current full list setting.add-auto-load-scripts-directoryWhen non-zero, debugging output for files of 'set auto-load ...' is displayed.Show auto-load verifications debugging.Set auto-load verifications debugging.void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {}]FvvEl^^OHPFvvE^lOHdOH_dl_auxvtarget_xfer_status ld_so_xfer_auxv(gdb_byte*, const gdb_byte*, ULONGEST, ULONGEST, ULONGEST*)../../gdb/auxv.cblock % auxv_pair_size == 0target_xfer_status memory_xfer_auxv(target_ops*, target_object, const char*, gdb_byte*, const gdb_byte*, ULONGEST, ULONGEST, ULONGEST*)object == TARGET_OBJECT_AUXVreadbuf || writebuf/proc/%d/auxv%-4s %-20s %-30s End of vectorAT_NULLEntry should be ignoredAT_IGNOREFile descriptor of programAT_EXECFDProgram headers for programAT_PHDRSize of program header entryAT_PHENTNumber of program headersAT_PHNUMSystem page sizeAT_PAGESZBase address of interpreterAT_BASEFlagsAT_FLAGSEntry point of programAT_ENTRYProgram is not ELFAT_NOTELFReal user IDAT_UIDEffective user IDAT_EUIDReal group IDAT_GIDEffective group IDAT_EGIDFrequency of times()AT_CLKTCKString identifying platformAT_PLATFORMMachine-dependent CPU capability hintsUsed FPU control wordAT_FPUCWData cache block sizeAT_DCACHEBSIZEInstruction cache block sizeAT_ICACHEBSIZEUnified cache block sizeAT_UCACHEBSIZEAT_IGNOREPPCString identifying base platformAT_BASE_PLATFORMAddress of 16 random bytesAT_RANDOMExtension of AT_HWCAPAT_HWCAP2File name of executableAT_EXECFNBoolean, was exec setuid-like?AT_SECURESpecial system info/entry pointsAT_SYSINFOSystem-supplied DSO's ELF headerAT_SYSINFO_EHDRL1 Instruction cache informationAT_L1I_CACHESHAPEL1 Instruction cache sizeAT_L1I_CACHESIZEL1 Instruction cache geometryAT_L1I_CACHEGEOMETRYL1 Data cache informationAT_L1D_CACHESHAPEL1 Data cache sizeAT_L1D_CACHESIZEL1 Data cache geometryAT_L1D_CACHEGEOMETRYL2 cache informationAT_L2_CACHESHAPEL2 cache sizeAT_L2_CACHESIZEL2 cache geometryAT_L2_CACHEGEOMETRYL3 cache informationAT_L3_CACHESHAPEL3 cache sizeAT_L3_CACHESIZEL3 cache geometryAT_L3_CACHEGEOMETRYMinimum stack size for signal deliveryAT_MINSIGSTKSZAT_SUN_UIDAT_SUN_RUIDAT_SUN_GIDAT_SUN_RGIDDynamic linker's ELF headerAT_SUN_LDELFDynamic linker's section headersAT_SUN_LDSHDRString giving name of dynamic linkerAT_SUN_LDNAMELarge pagesizeAT_SUN_LPAGESZPlatform name stringAT_SUN_PLATFORMAT_SUN_CAP_HW1Should flush icache?AT_SUN_IFLUSHCPU name stringAT_SUN_CPUCOFF entry point addressAT_SUN_EMUL_ENTRYCOFF executable file descriptorAT_SUN_EMUL_EXECFDCanonicalized file name given to execveAT_SUN_EXECNAMEString for name of MMU moduleAT_SUN_MMUDynamic linker's data segment addressAT_SUN_LDDATAAF_SUN_ flags passed from the kernelAT_SUN_AUXFLAGSName of emulation binary for runtime linkerAT_SUN_EMULATORName of brand libraryAT_SUN_BRANDNAMEAux vector for brand modules 1AT_SUN_BRAND_AUX1Aux vector for brand modules 2AT_SUN_BRAND_AUX2Aux vector for brand modules 3AT_SUN_BRAND_AUX3Machine-dependent CPU capability hints 2AT_SUN_CAP_HW2The program has no auxiliary information now.No auxiliary vector found, or failed reading it.Auxiliary vector is empty.Display the inferior's auxiliary vector. This is information provided by the operating system at program startup.Invalid type of operand to `!'.Invalid combination of types in %s.gen_fetch: strange size../../gdb/ax-gdb.cgen_fetch: Unsupported type code `%s'.Register $%s not available'%s' is a user-register; GDB cannot yet trace user-register contents.$%s is not a trace state variable; GDB agent expressions cannot use convenience variables.less thangen_deref: expected a pointerAttempt to dereference a generic pointer.void gen_ptradd(agent_expr*, axs_value*, axs_value*, axs_value*)pointer_type (value1->type)value2->type->code () == TYPE_CODE_INTgen_var_ref: LOC_CONST_BYTES symbols are not supportedCannot compute value of typedef `%s'.Couldn't resolve symbol `%s'.void gen_var_ref(agent_expr*, axs_value*, symbol*)LOC_COMPUTED variable missing a methodCannot find value of botched symbol `%s'.static field `%s' has been optimized out, cannot usegen_bitfield_ref: bitfield too wideno `%s' foundValue not scalar: cannot be an rvalue.The left operand of `%s' is not a %s.Structure does not live in memory.Couldn't find member named `%s' in struct/union/class `%s'Invalid type cast: intended type must be scalar.Casts to requested type are not yet implemented.Left operand of `@' must be an object in memory.Right operand of `@' must be a constant, in agent expressions.Right operand of `@' must be an integer.Right operand of `@' must be positive.May only assign to trace state variablesvirtual void expr::assign_operation::do_generate_ax(expression*, agent_expr*, axs_value*, type*)ivarop != nullptr$%s is not a trace state variable, may not assign to itpointers to bitfield members not allowedCannot reference non-static field "%s"No symbol "%s" in namespace "%s".non-aggregate type in gen_aggregate_elt_refThere is no field named %spointer to a structure or uniongen_expr: unhandled struct caseTranslate an expression into remote agent bytecode for tracing. Usage: maint agent [-at LOCATION,] EXPRESSION If -at is given, generate remote agent bytecode for this location. If not, generate remote agent bytecode for current frame pc address.Translate an expression into remote agent bytecode for evaluation. Usage: maint agent-eval [-at LOCATION,] EXPRESSION If -at is given, generate remote agent bytecode for this location. If not, generate remote agent bytecode for current frame pc address.agent-evalTranslate an expression into remote agent bytecode for evaluation and display the bytecodes.agent-printfnegationInvalid type of operand to `~'.Argument of unary `*' is not a pointer.Operand of `&' is an rvalue, which has no address.Operand of `&' is in a register, and has no address.void gen_expr_unop(expression*, exp_opcode, expr::operation*, agent_expr*, axs_value*)invalid case in gen_expr_unopadditionsubtractionvoid gen_ptrsub(agent_expr*, axs_value*, axs_value*, axs_value*)void gen_ptrdiff(agent_expr*, axs_value*, axs_value*, axs_value*, type*)pointer_type (value2->type)First argument of `-' is a pointer, but second argument is neither an integer nor a pointer of the same type.multiplicationdivisionremainderleft shiftright shiftcannot subscript requested type: cannot call user defined functionscannot subscript something of type `%s'cannot subscript requested typeArgument to arithmetic operation not a number or boolean.bitwise andbitwise orbitwise exclusive-orgen_expr: op case sets don't matchvirtual void expr::assign_modify_operation::do_generate_ax(expression*, agent_expr*, axs_value*, type*)$_retvoid agent_eval_command_one(const char*, int, CORE_ADDR)trace_string == 0GDB can't do agent expression translation with overlays.expression to translateMust start with a format string.Bad format string, non-terminated '"'.Invalid argument syntaxN4expr23tuple_holding_operationIJP4typexEEE^jHpLN4expr23tuple_holding_operationIJP11internalvarEEE^PjHpLN4expr15binop_operationIL10exp_opcode20EXadL_Z14eval_op_repeatP4typeP10expression6nosideS1_P5valueS8_EEEE^jHTPGN4expr23tuple_holding_operationIJEEE^kHpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EEP4typeEEE^ %3d %3d %s "%s", %d argsdiv_signeddiv_unsignedrem_signedrem_unsignedlshrsh_signedrsh_unsignedlog_notbit_andbit_orbit_xorbit_notless_signedless_unsignedref16ref32ref64ref_floatref_doubleref_long_doublel_to_dd_to_lif_gotoconst16const32const64zero_extgetvsetvtracevtracenztrace16invalid2"#$%(not applicable) %3d%% void gdb::bcache::print_statistics(const char*)../../gdb/bcache.cstringi < m_unique_count M_Cached '%s' statistics: Total object count: %ld Unique object count: %lu Percentage of duplicates, by count: Total object size: %ld Unique object size: %ld Percentage of duplicates, by size: Max entry size: %d Average entry size: Median entry size: %d Total memory used by bcache, including overhead: %ld Percentage memory overhead: Net memory savings: Hash table size: %3d Hash table expands: %lu Hash table hashes: %lu Half hash misses: %lu Hash table population: Median hash chain length: %3d Average hash chain length: %3lu Maximum hash chain length: %3d yHmmmm?? # @ N3gdb6bcacheE^xHBFD backed targetYou should never see this\K yHyHT|H8y@yy,yw$''\(((4(D((L(((((\((,( ( (!("(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(8(x9(:(:(L;(;(<(=(0>($''@?( @((A(0B(8C(@D(TE(\F(dG((H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(wy yyy$yU(`V(@W( X(Y(Y(Z([(P\(0](^(T_(_( a(b(wXf(8g(g(h(\i(0j(l(m(o(p(q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(10target_bfd^D|HTRsymbol* block_iterator_step(block_iterator*, int)../../gdb/block.citerator->which != FIRST_LOCAL_BLOCKconst block* find_block_in_blockvector(const blockvector*, CORE_ADDR)BLOCKVECTOR_NBLOCKS (bl) >= 2compunit_symtab* get_block_compunit_symtab(const block*)BLOCK_SUPERBLOCK (block) == NULLgb->compunit_symtab != NULLsymbol* block_iter_match_step(block_iterator*, const lookup_name_info&, int)DW_OP_entry_value resolving cannot find DW_TAG_call_site %s in %svoid set_block_compunit_symtab(block*, compunit_symtab*)gb->compunit_symtab == NULLsymbol* block_lookup_symbol_primary(const block*, const char*, domain_enum)BLOCK_SUPERBLOCK (block) == NULL || BLOCK_SUPERBLOCK (BLOCK_SUPERBLOCK (block)) == NULLsymbol* block_find_symbol(const block*, const char*, domain_enum, int (*)(symbol*, void*), void*)const block* get_frame_block(frame_info*, CORE_ADDR*)../../gdb/blockframe.cbl != NULLbool find_pc_partial_function_sym(CORE_ADDR, const general_symbol_info**, CORE_ADDR*, CORE_ADDR*, const block**)i < BLOCK_NRANGES (b)Entry block not found in find_function_entry_range_from_pcint signal_catchpoint_remove_location(bp_location*, remove_bp_reason)../../gdb/break-catch-sig.csignal_catch_counts[iter] > 0signal_catch_counts[i] > 0Catchpoint %d (signal %s), catch signalCatchpoint %d (signalsCatchpoint %d (signalCatchpoint %d (any signal)Catchpoint %d (standard signals)signals "signal "catch-typeCatch signals by their names and/or numbers. Usage: catch signal [[NAME|NUMBER] [NAME|NUMBER]...|all] Arguments say which signals to catch. If no arguments are given, every "normal" signal will be caught. The argument "all" means to also catch signals used by GDB. Arguments, if given, should be one or more signal names (if your system supports that), or signal numbers.'all' cannot be caught with other signalsstd::vector catch_signal_split_args(const char*, bool*)result.empty ()Unknown signal name '%s'.17signal_catchpoint^HLFI4H؝catch syscallCatchpoint %d (syscallsCatchpoint %d (syscall '%s' [%d]Catchpoint %d (any syscall)syscalls "syscall "%s%s, %s%d, (call to syscall (returned from syscall syscall-numbersyscall-nameThe feature 'catch syscall' is not supported on this architecture yet.Unknown syscall number '%d'.group:Unknown syscall group '%s'.Unknown syscall name '%s'.group:%sbreak-catch-syscallCatch system calls by their names, groups and/or numbers. Arguments say which system calls to catch. If no arguments are given, every system call will be caught. Arguments, if given, should be one or more system call names (if your system supports that), system call groups or system call numbers.18syscall_catchpoint^HLFI0H(Ptcatch Catchpoint(rethrow)(throw)(catch)%s %d %sexception throwexception rethrowexception catch (exception rethrown), (exception thrown), (exception caught), matching: Catch an exception, when caught.Catch an exception, when thrown.Catch an exception, when rethrown.No frame selecteddid not find exception probe (does libstdcxx have SDT probes?)libstdcxxnot stopped at a C++ exception catchpointC++ exception catchpoint has too few argumentserror computing probe argument at c++ exception catchpointUnsupported or unknown exception event; cannot catch itinvalid type-matching regexp-probe-stap libstdcxx:throw__cxa_throw-probe-stap libstdcxx:rethrow__cxa_rethrow-probe-stap libstdcxx:catch__cxa_begin_catch20exception_catchpoint^/HLFIHH`HɉHՉHHHHCatchpoint %d (%s)Catchpoint %d (exec)Catchpoint %d (vfork)Catchpoint %d (fork)Specify the type of breakpoint to set. Usage: stop in stop at May only run agent-printf on the targetstd::vector base_breakpoint_decode_location(breakpoint*, event_location*, program_space*)../../gdb/breakpoint.cpure virtual function calledvoid base_breakpoint_create_breakpoints_sal(gdbarch*, linespec_result*, gdb::unique_xmalloc_ptr, gdb::unique_xmalloc_ptr, bptype, bpdisp, int, int, int, const breakpoint_ops*, int, int, int, unsigned int)void base_breakpoint_create_sals_from_location(event_location*, linespec_result*, bptype)void base_breakpoint_print_recreate(breakpoint*, ui_file*)void base_breakpoint_print_mention(breakpoint*)print_stop_action base_breakpoint_print_it(bpstat)int base_breakpoint_works_in_software_mode(const breakpoint*)int base_breakpoint_resources_needed(const bp_location*)int base_breakpoint_breakpoint_hit(const bp_location*, const address_space*, CORE_ADDR, const target_waitstatus*)int base_breakpoint_remove_location(bp_location*, remove_bp_reason)int base_breakpoint_insert_location(bp_location*)Always inserted breakpoint mode is %s. Automatic usage of hardware breakpoints is %s. Debugger's behavior regarding pending breakpoints is %s. Debugger's willingness to use watchpoint hardware is %s. skipping breakpoint: stepping past insn at: %sshould_be_insertedinfrunstepping past non-steppable watchpoint. skipping watchpoint at %s:%dint remove_breakpoint_1(bp_location*, remove_bp_reason)bl->owner != NULLbl->owner->type != bp_nonebl->owner->ops != NULL && bl->owner->ops->remove_location != NULLCould not remove hardware watchpoint %d.int watchpoint_locations_match(bp_location*, bp_location*)w1 != NULLw2 != NULLtcatchThe 'while-stepping' command can only be used for tracepointsThe 'collect' command can only be used for tracepointsteval The 'teval' command can only be used for tracepointsvoid print_one_detail_masked_watchpoint(const breakpoint*, ui_out*)b->loc && b->loc->next == NULL mask void print_mention_ranged_breakpoint(breakpoint*)b->type == bp_hardware_breakpointHardware assisted ranged breakpoint %d from %s to %s.Breakpoint %d address previously adjusted from %s to %s.Breakpoint address adjusted from %s to %s.void set_breakpoint_location_function(bp_location*)loc->owner != NULLbpnumCould not find location of the end of the range.Negative breakpoint number '%.*s'Negative breakpoint location number '%.*s'Bad breakpoint number '%.*s'Bad breakpoint location number '%.*s'Bad breakpoint number at or near: '%s'Bad breakpoint location number at or near: '%s'Inverted breakpoint range at '%.*s'Inverted breakpoint location range at '%.*s'void watchpoint_del_at_next_stop(watchpoint*)w->related_breakpoint->type == bp_watchpoint_scopew->related_breakpoint->related_breakpoint == wint bpstat_check_location(const bp_location*, const address_space*, CORE_ADDR, const target_waitstatus*)bptypes table does not describe type #%d.void init_raw_breakpoint_without_location(breakpoint*, gdbarch*, bptype, const breakpoint_ops*)int bkpt_resources_needed(const bp_location*)bl->owner->type == bp_hardware_breakpointBreakpoint condition evaluation mode is %s (currently %s). Breakpoint condition evaluation mode is %s. void tracepoint_print_one_detail(const breakpoint*, ui_out*)self->type == bp_static_tracepointstatic-tracepoint-marker-string-id marker id is %pF void cmd_list_element::set_context(void*)../../gdb/cli/cli-decode.hm_context == nullptrThe 'while-stepping' command cannot be used for fast tracepointThe 'while-stepping' command cannot be used for static tracepointThe 'while-stepping' command can be used only oncevoid validate_commands_for_breakpoint(breakpoint*, command_line*)while_stepping->body_list_1 == nullptrThe 'while-stepping' command cannot be nestedstd::vector decode_location_default(breakpoint*, event_location*, program_space*)canonical.lsals.size () < 2, program ", process default collect default-collect (disabled)Note: breakpoint Note: breakpoints (all threads) (thread %d)%s%s also set at pc %ps. (%s) pending. (%s,%s) pending. (%s %s) pending. at %ps: file %ps, line %d. (%d locations)TracepointFast tracepointStatic tracepointunhandled tracepoint type %dTemporary breakpointBreakpoint at gnu-indirect-function resolverHardware assisted breakpoint %dDprintf %dvoid print_one_detail_ranged_breakpoint(const breakpoint*, ui_out*) address range: [%s, %s]unload of library matching %sunload of librarychar* wrap_indent_at_field(ui_out*, const char*)total_width < sizeof wrap_indentfullnamependingevaluated-byvoid print_one_ranged_breakpoint(breakpoint*, bp_location**)bl && bl->next == NULLint remove_breakpoint(bp_location*) (exec'd new-exec (vforked process newpid (forked process print_stop_action print_it_masked_watchpoint(bpstat)Invalid hardware watchpoint type. Check the underlying instruction at PC for the memory address and value which triggered this watchpoint. print_stop_action print_it_ranged_breakpoint(bpstat)Temporary ranged breakpoint Ranged breakpoint print_stop_action bkpt_print_it(bpstat)bs->bp_location_at != NULLTemporary breakpoint %pF, Breakpoint %pF, bpstat_what: tracepoint encounteredbpstat_what: unhandled bptype %dhandling bp_jit_eventhandle_jit_eventvoid handle_jit_event(CORE_ADDR)jit_bp_sym.objfile != nullptrreading through apparently deleted breakpoint #%d?void one_breakpoint_xfer_memory(gdb_byte*, gdb_byte*, const gdb_byte*, ULONGEST, LONGEST, bp_target_info*, gdbarch*)target_info->shadow_contents >= readbuf + len || readbuf >= (target_info->shadow_contents + target_info->shadow_len)int breakpoint_locations_match(bp_location*, bp_location*, bool)loc1->owner != NULLloc2->owner != NULLbp_location* add_location_to_breakpoint(breakpoint*, const symtab_and_line*)loc->pspace != NULLvoid init_raw_breakpoint(breakpoint*, gdbarch*, symtab_and_line, bptype, const breakpoint_ops*)sal.pspace != NULLNo line %d in file "%s".T unordered_remove(std::vector&, typename std::vector::size_type) [with T = bp_location*; typename std::vector::size_type = unsigned int]../../gdb/../gdbsupport/gdb_vecs.hix < vec.size ()T unordered_remove(std::vector&, typename std::vector::iterator) [with T = bp_location*; typename std::vector::iterator = std::vector::iterator]it >= vec.begin () && it < vec.end () task %dcatch execcatch vforkcatch forkrwatchawatch %s mask 0x%sInvalid watchpoint type.dprintf %s,%sftracestrace passcount %d break-range %s, %stbreakthbreakunhandled breakpoint type %d-force-conditionJunk after thread keyword.Junk after task keyword.Unknown task %d._ovly_debug_eventstd::terminate()_Unwind_DebugHookCannot detach breakpoints of inferior_ptidStopped due to shared library event: Stopped due to shared library event (no libraries added or removed) Inferior unloaded Inferior loaded print_bp_stop_message: unrecognized enum valueThread Event Breakpoint: gdb should not stop! Overlay Event Breakpoint: gdb should not stop! Longjmp Master Breakpoint: gdb should not stop! std::terminate Master Breakpoint: gdb should not stop! Exception Master Breakpoint: gdb should not stop! hw-rwpthw-awptMasked hardware watchpoint Masked hardware read watchpoint Masked hardware access (read/write) watchpoint Watchpoint Hardware watchpoint Hardware read watchpoint Hardware access (read/write) watchpoint print_stop_action print_it_watchpoint(bpstat) Old value = New value = Value = probe not foundstatic tracepoint %d changed probed marker from %s to %smarker for static tracepoint %d (%s) not found at previous line numberNow in Ignore count ignored for tracepoint %d.Will stop next time breakpoint %d is reached.Will ignore next crossing of breakpoint %d.Will ignore next %d crossings of breakpoint %d.No breakpoint number %d.a breakpoint numberbad breakpoint number: '%s'Second argument (specified ignore-count) is missing.Setting tracepoint %d's passcount to %d Temporarily disabling breakpoints for unloaded shared library "%s"std::vector location_to_sals(breakpoint*, event_location*, program_space*, int*)b->ops != NULLb->cond_string == NULLvoid check_status_watchpoint(bpstat)is_watchpoint (bs->breakpoint_at)void bpstat_check_watchpoint(bpstat)wpnum Watchpoint %pF deleted because the program has left the block in which its expression is valid. Error evaluating expression for watchpoint %d Watchpoint %d deleted. Bad format string, missing '"'.No function supplied for dprintf callcall (void) %s (%s,%s)call (void) %s (%s)agent-printf %sTarget cannot run dprintf commands, falling back to GDB printfInvalid dprintf style.void update_dprintf_command_list(breakpoint*)printf_line != NULLcommands_command_1(const char*, int, command_line*)::cmd == NULLType commands for breakpoint(s) %s, one per line.N*void print_one_breakpoint_location(breakpoint*, bp_location*, int, bp_location**, int, bool)!loc || loc_number != 0i%d inf task stop only in stack frame at trace only if stop only if (%pF evals) stop only in thread catchpoint tracepoint breakpoint already hit times time times ignore next %pF hits disable after additional next trace buffer usage traceframe-usage bytes pass count not installed on target original-locationBreakpoint %d's condition is now valid at location %d, enabling. Garbage '%s' follows conditionfailed to validate condition at location %d.%d, disabling: %sfailed to validate condition at location %d, disabling: %sNo hardware breakpoint support in the target.Hardware breakpoints used exceeds limit.void init_breakpoint_sal(breakpoint*, gdbarch*, gdb::array_view, event_location_up&&, gdb::unique_xmalloc_ptr, gdb::unique_xmalloc_ptr, gdb::unique_xmalloc_ptr, bptype, bpdisp, int, int, int, const breakpoint_ops*, int, int, int, unsigned int, int)!sals.empty ()Probed static tracepoint marker "%s" Couldn't determine the static tracepoint marker to probeFormat string requiredGarbage '%s' at end of commandBreakpoint %d now unconditional. Could not reset ranged breakpoint %d: multiple locations found void dprintf_re_set(breakpoint*)b->extra_string != NULLCan't set read/access watchpoint when hardware watchpoints are disabled.void update_watchpoint(watchpoint*, int)!val_chain.empty ()int can_use_hardware_watchpoint(const std::vector >&)!vals.empty ()Target does not support this type of hardware watchpoint.There are not enough available hardware resources for this watchpoint.Expression cannot be implemented with read/access watchpoint.Watchpoint %d deleted because the program has left the block in which its expression is valid. bad breakpoint number at or near '%d'No breakpoint number %d. one or more breakpoint numbershit countThread-specific breakpoint %d deleted - thread %s no longer in the thread list. BreakpointTableNumDispEnbAddressWhatNo breakpoints or watchpoints. No breakpoint or watchpoint matching '%s'. (*): Breakpoint condition is invalid at this location. No tracepoints. No tracepoint matching '%s'. No watchpoints. No watchpoint matching '%s'. tracepoint* get_tracepoint_by_number(const char**, number_or_range_parser*)!parser->finished ()bad tracepoint number at or near '%s' No previous tracepoint No tracepoint number %d. passcount command requires an argument (count + optional TP num)No known static tracepoint marker named %svector::reserveNo default breakpoint address now.+-marker %s not foundNo format string following the locationCannot insert breakpoint %d. Cannot set software breakpoint at read-only address %s hardware breakpoint %d not supported in overlay!Overlay breakpoint %d failed: in ROM? int insert_bp_location(bp_location*, ui_file*, int*, int*, int*)bl->owner != nullptrCannot insert breakpoint %d. Temporarily disabling shared library breakpoints: breakpoint #%d Cannot insert hardware breakpoint %d%sCannot insert breakpoint %d. %s Cannot insert breakpoint %d: %s bl->owner->ops != NULL && bl->owner->ops->insert_location != NULLError inserting catchpoint %d: Your system does not support this type of catchpoint.Error inserting catchpoint %d.void swap_insertion(bp_location*, bp_location*)!left->duplicate!right->duplicateNote: automatically using hardware breakpoints for read-only addresses. void bp_locations_target_extensions_update()bl->address >= startbl->address < endvoid update_global_location_list(ugll_insert_mode)is_hardware_watchpoint (loc2->owner)warning: Error removing breakpoint %d Warning: Could not insert hardware watchpoint %d. Could not insert hardware breakpoints: You may have requested too many hardware breakpoints/watchpoints. Only one stop condition allowed. There is currently a %s stop condition defined for this breakpoint.Bad breakpoint argument: '%s'void bpstat_check_breakpoint_conditions(bpstat, thread_info*)Watchpoint condition cannot be tested in the current scopeError in testing breakpoint condition: breakpoint* set_longjmp_breakpoint_for_call_dummy()new_b->related_breakpoint == new_bbreakpoint_up set_momentary_breakpoint(gdbarch*, symtab_and_line, frame_id, bptype)!frame_id_artificial_p (frame_id)tpnumInvalid regexpvoid create_breakpoints_sal(gdbarch*, linespec_result*, gdb::unique_xmalloc_ptr, gdb::unique_xmalloc_ptr, bptype, bpdisp, int, int, int, const breakpoint_ops*, int, int, int, unsigned int)canonical->lsals.size () == 1unsupported or unknown fork kind; cannot catch itYou can specify only one thread.You can specify only one mask.Cannot watch constant value `%.*s'.This target does not support masked watchpoints.Invalid mask or memory region.Junk at end of command.-location %.*sint create_breakpoint(gdbarch*, event_location*, const char*, int, const char*, bool, int, int, bptype, int, auto_boolean, const breakpoint_ops*, int, int, int, unsigned int)May not have a fast tracepoint at %s%sGarbage '%s' at end of locationMultiple breakpoints were set. Use the "delete" command to delete unwanted breakpoints.Make %s pending on future shared library load? Usage: stop at LINE Usage: stop in Uploaded tracepoint %d has no source location, using raw addressUploaded tracepoint %d condition has no source form, ignoring ittracepoint* create_tracepoint_from_upload(uploaded_tp*)%d %dUploaded tracepoint %d actions have no source form, ignoring themvoid delete_breakpoint(breakpoint*)bpt != NULLvoid update_breakpoints_after_exec()!bploc->insertedCouldn't get information on specified line.Delete all tracepoints? No source file specified.No breakpoint at %s.No breakpoint at this line.Deleted breakpoint Deleted breakpoints Delete all breakpoints? libc-probe-stap libc:longjmplibgcc-probe-stap libgcc:unwindError in re-setting breakpoint %d: Cannot enable watchpoint %d: breakpoint* new_single_step_breakpoint(int, gdbarch*)b->thread != 0This target does not support hardware ranged breakpoints.No address range specified.Too few arguments.Could not find location of the beginning of the range.Cannot create a ranged breakpoint with multiple locations.Invalid address range, end precedes start.Address range too large.Target does not support breakpoint condition evaluation. Using host evaluation mode instead.Bad breakpoint number '%d'Bad breakpoint location number '%d'Breakpoint %d's condition is invalid at location %d, cannot enable.Set ignore-count of breakpoint number N to COUNT. Usage is `ignore N COUNT'.Set commands to be executed when the given breakpoints are hit. Give a space-separated breakpoint list as argument after "commands". A list element can be a breakpoint number (e.g. `5') or a range of numbers (e.g. `5-7'). With no argument, the targeted breakpoint is the last one set. The commands themselves follow starting on the next line. Type a line containing "end" to indicate the end of them. Give "silent" as the first line to make the breakpoint silent; then no output is printed when it is hit, except what the commands print.Specify breakpoint number N to break only if COND is true. Usage is `condition [OPTION] N COND', where N is an integer and COND is an expression to be evaluated whenever breakpoint N is reached. Options: %OPTIONS%Set a temporary breakpoint. Like "break" except the breakpoint is only temporary, so it will be deleted when hit. Equivalent to "break" followed by using "enable delete" on the breakpoint number. tbreak [PROBE_MODIFIER] [LOCATION] [thread THREADNUM] [-force-condition] [if CONDITION] PROBE_MODIFIER shall be present if the command is to be placed in a probe point. Accepted values are `-probe' (for a generic, automatically guessed probe type), `-probe-stap' (for a SystemTap probe) or `-probe-dtrace' (for a DTrace probe). LOCATION may be a linespec, address, or explicit location as described below. With no LOCATION, uses current execution address of the selected stack frame. This is useful for breaking on return to a stack frame. THREADNUM is the number from "info threads". CONDITION is a boolean expression. With the "-force-condition" flag, the condition is defined even when it is invalid for all current locations. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple breakpoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints.Set a hardware assisted breakpoint. Like "break" except the breakpoint requires hardware support, some target hardware may not have this support. hbreak [PROBE_MODIFIER] [LOCATION] [thread THREADNUM] [-force-condition] [if CONDITION] PROBE_MODIFIER shall be present if the command is to be placed in a probe point. Accepted values are `-probe' (for a generic, automatically guessed probe type), `-probe-stap' (for a SystemTap probe) or `-probe-dtrace' (for a DTrace probe). LOCATION may be a linespec, address, or explicit location as described below. With no LOCATION, uses current execution address of the selected stack frame. This is useful for breaking on return to a stack frame. THREADNUM is the number from "info threads". CONDITION is a boolean expression. With the "-force-condition" flag, the condition is defined even when it is invalid for all current locations. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple breakpoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints.Set a temporary hardware assisted breakpoint. Like "hbreak" except the breakpoint is only temporary, so it will be deleted when hit. thbreak [PROBE_MODIFIER] [LOCATION] [thread THREADNUM] [-force-condition] [if CONDITION] PROBE_MODIFIER shall be present if the command is to be placed in a probe point. Accepted values are `-probe' (for a generic, automatically guessed probe type), `-probe-stap' (for a SystemTap probe) or `-probe-dtrace' (for a DTrace probe). LOCATION may be a linespec, address, or explicit location as described below. With no LOCATION, uses current execution address of the selected stack frame. This is useful for breaking on return to a stack frame. THREADNUM is the number from "info threads". CONDITION is a boolean expression. With the "-force-condition" flag, the condition is defined even when it is invalid for all current locations. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple breakpoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints.Enable all or some breakpoints. Usage: enable [BREAKPOINTNUM]... Give breakpoint numbers (separated by spaces) as arguments. With no subcommand, breakpoints are enabled until you command otherwise. This is used to cancel the effect of the "disable" command. With a subcommand you can enable temporarily.Enable all or some breakpoints. Usage: enable breakpoints [BREAKPOINTNUM]... Give breakpoint numbers (separated by spaces) as arguments. This is used to cancel the effect of the "disable" command. May be abbreviated to simply "enable".Enable some breakpoints for one hit. Usage: enable breakpoints once BREAKPOINTNUM... If a breakpoint is hit while enabled in this fashion, it becomes disabled.Enable some breakpoints and delete when hit. Usage: enable breakpoints delete BREAKPOINTNUM... If a breakpoint is hit while enabled in this fashion, it is deleted.Enable some breakpoints for COUNT hits. Usage: enable breakpoints count COUNT BREAKPOINTNUM... If a breakpoint is hit while enabled in this fashion, the count is decremented; when it reaches zero, the breakpoint is disabled.Enable some breakpoints and delete when hit. Usage: enable delete BREAKPOINTNUM... If a breakpoint is hit while enabled in this fashion, it is deleted.Enable some breakpoints for one hit. Usage: enable once BREAKPOINTNUM... If a breakpoint is hit while enabled in this fashion, it becomes disabled.Enable some breakpoints for COUNT hits. Usage: enable count COUNT BREAKPOINTNUM... If a breakpoint is hit while enabled in this fashion, the count is decremented; when it reaches zero, the breakpoint is disabled.Disable all or some breakpoints. Usage: disable [BREAKPOINTNUM]... Arguments are breakpoint numbers with spaces in between. To disable all breakpoints, give no argument. A disabled breakpoint is not forgotten, but has no effect until re-enabled.disdisaDisable all or some breakpoints. Usage: disable breakpoints [BREAKPOINTNUM]... Arguments are breakpoint numbers with spaces in between. To disable all breakpoints, give no argument. A disabled breakpoint is not forgotten, but has no effect until re-enabled. This command may be abbreviated "disable".Delete all or some breakpoints. Usage: delete [BREAKPOINTNUM]... Arguments are breakpoint numbers with spaces in between. To delete all breakpoints, give no argument. Also a prefix command for deletion of other GDB objects.delDelete all or some breakpoints or auto-display expressions. Usage: delete breakpoints [BREAKPOINTNUM]... Arguments are breakpoint numbers with spaces in between. To delete all breakpoints, give no argument. This command may be abbreviated "delete".Clear breakpoint at specified location. Argument may be a linespec, explicit, or address location as described below. With no argument, clears all breakpoints in the line that the selected frame is executing in. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. See also the "delete" command which clears breakpoints by number.clearSet breakpoint at specified location. break [PROBE_MODIFIER] [LOCATION] [thread THREADNUM] [-force-condition] [if CONDITION] PROBE_MODIFIER shall be present if the command is to be placed in a probe point. Accepted values are `-probe' (for a generic, automatically guessed probe type), `-probe-stap' (for a SystemTap probe) or `-probe-dtrace' (for a DTrace probe). LOCATION may be a linespec, address, or explicit location as described below. With no LOCATION, uses current execution address of the selected stack frame. This is useful for breaking on return to a stack frame. THREADNUM is the number from "info threads". CONDITION is a boolean expression. With the "-force-condition" flag, the condition is defined even when it is invalid for all current locations. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple breakpoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints.brbrebreaBreak in function/address or break at a line in the current file.Break in function or address.Break at a line in the current file.Status of user-settable breakpoints, or breakpoint number NUMBER. The "Type" column indicates one of: breakpoint - normal breakpoint watchpoint - watchpoint The "Disp" column contains one of "keep", "del", or "dis" to indicate the disposition of the breakpoint after it gets hit. "dis" means that the breakpoint will be disabled. The "Address" and "What" columns indicate the address and file/line number respectively. Convenience variable "$_" and default examine address for "x" are set to the address of the last breakpoint listed unless the command is prefixed with "server ". Convenience variable "$bpnum" contains the number of the last breakpoint set.Status of specified breakpoints (all user-settable breakpoints if no argument). The "Type" column indicates one of: breakpoint - normal breakpoint watchpoint - watchpoint The "Disp" column contains one of "keep", "del", or "dis" to indicate the disposition of the breakpoint after it gets hit. "dis" means that the breakpoint will be disabled. The "Address" and "What" columns indicate the address and file/line number respectively. Convenience variable "$_" and default examine address for "x" are set to the address of the last breakpoint listed unless the command is prefixed with "server ". Convenience variable "$bpnum" contains the number of the last breakpoint set.Status of all breakpoints, or breakpoint number NUMBER. The "Type" column indicates one of: breakpoint - normal breakpoint watchpoint - watchpoint longjmp - internal breakpoint used to step through longjmp() longjmp resume - internal breakpoint at the target of longjmp() until - internal breakpoint used by the "until" command finish - internal breakpoint used by the "finish" command The "Disp" column contains one of "keep", "del", or "dis" to indicate the disposition of the breakpoint after it gets hit. "dis" means that the breakpoint will be disabled. The "Address" and "What" columns indicate the address and file/line number respectively. Convenience variable "$_" and default examine address for "x" are set to the address of the last breakpoint listed unless the command is prefixed with "server ". Convenience variable "$bpnum" contains the number of the last breakpoint set.Set catchpoints to catch events.Set temporary catchpoints to catch events.Catch calls to fork.Catch calls to vfork.Catch calls to exec.Catch loads of shared libraries. Usage: catch load [REGEX] If REGEX is given, only stop for libraries matching the regular expression.Catch unloads of shared libraries. Usage: catch unload [REGEX] If REGEX is given, only stop for libraries matching the regular expression.Set a watchpoint for EXPRESSION. Usage: watch [-location] EXPRESSION Options: %OPTIONS% A watchpoint stops execution of your program whenever the value of an expression changes.Set a read watchpoint for EXPRESSION. Usage: rwatch [-location] EXPRESSION Options: %OPTIONS% A read watchpoint stops execution of your program whenever the value of an expression is read.Set an access watchpoint for EXPRESSION. Usage: awatch [-location] EXPRESSION Options: %OPTIONS% An access watchpoint stops execution of your program whenever the value of an expression is either read or written.Status of specified watchpoints (all watchpoints if no argument).can-use-hw-watchpointsIf zero, gdb will not use hardware for new watchpoints, even if such is available. (However, any hardware watchpoints that were created before setting this to nonzero, will continue to use watchpoint hardware.)Show debugger's willingness to use watchpoint hardware.Set debugger's willingness to use watchpoint hardware.Set a tracepoint at specified location. trace [PROBE_MODIFIER] [LOCATION] [thread THREADNUM] [-force-condition] [if CONDITION] PROBE_MODIFIER shall be present if the command is to be placed in a probe point. Accepted values are `-probe' (for a generic, automatically guessed probe type), `-probe-stap' (for a SystemTap probe) or `-probe-dtrace' (for a DTrace probe). LOCATION may be a linespec, address, or explicit location as described below. With no LOCATION, uses current execution address of the selected stack frame. This is useful for breaking on return to a stack frame. THREADNUM is the number from "info threads". CONDITION is a boolean expression. With the "-force-condition" flag, the condition is defined even when it is invalid for all current locations. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple breakpoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints. Do "help tracepoints" for info on other tracepoint commands.tratracSet a fast tracepoint at specified location. ftrace [PROBE_MODIFIER] [LOCATION] [thread THREADNUM] [-force-condition] [if CONDITION] PROBE_MODIFIER shall be present if the command is to be placed in a probe point. Accepted values are `-probe' (for a generic, automatically guessed probe type), `-probe-stap' (for a SystemTap probe) or `-probe-dtrace' (for a DTrace probe). LOCATION may be a linespec, address, or explicit location as described below. With no LOCATION, uses current execution address of the selected stack frame. This is useful for breaking on return to a stack frame. THREADNUM is the number from "info threads". CONDITION is a boolean expression. With the "-force-condition" flag, the condition is defined even when it is invalid for all current locations. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple breakpoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints. Do "help tracepoints" for info on other tracepoint commands.Set a static tracepoint at location or marker. strace [LOCATION] [if CONDITION] LOCATION may be a linespec, explicit, or address location (described below) or -m MARKER_ID. If a marker id is specified, probe the marker with that name. With no LOCATION, uses current execution address of the selected stack frame. Static tracepoints accept an extra collect action -- ``collect $_sdata''. This collects arbitrary user data passed in the probe point call to the tracing library. You can inspect it when analyzing the trace buffer, by printing the $_sdata variable like any other convenience variable. CONDITION is a boolean expression. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead. Multiple tracepoints at one place are permitted, and useful if their conditions are different. Do "help breakpoints" for info on other commands dealing with breakpoints. Do "help tracepoints" for info on other tracepoint commands.Status of specified tracepoints (all tracepoints if no argument). Convenience variable "$tpnum" contains the number of the last tracepoint set.Delete specified tracepoints. Arguments are tracepoint numbers, separated by spaces. No argument means delete all tracepoints.Disable specified tracepoints. Arguments are tracepoint numbers, separated by spaces. No argument means disable all tracepoints.Enable specified tracepoints. Arguments are tracepoint numbers, separated by spaces. No argument means enable all tracepoints.Set the passcount for a tracepoint. The trace will end when the tracepoint has been passed 'count' times. Usage: passcount COUNT TPNUM, where TPNUM may also be "all"; if TPNUM is omitted, passcount refers to the last tracepoint defined.Save breakpoint definitions as a script.Save current breakpoint definitions as a script. This includes all types of breakpoints (breakpoints, watchpoints, catchpoints, tracepoints). Use the 'source' command in another debug session to restore them.Save current tracepoint definitions as a script. Use the 'source' command in another debug session to restore them.save-tracepointssave tracepointsBreakpoint specific settings. Configure various breakpoint-specific variables such as pending breakpoint behavior.If on, an unrecognized breakpoint location will cause gdb to create a pending breakpoint. If off, an unrecognized breakpoint location results in an error. If auto, an unrecognized breakpoint location results in a user-query to see if a pending breakpoint should be created.Show debugger's behavior regarding pending breakpoints.Set debugger's behavior regarding pending breakpoints.auto-hwIf set, the debugger will automatically use hardware breakpoints for breakpoints set with "break" but falling in read-only memory. If not set, a warning will be emitted for such breakpoints.Show automatic usage of hardware breakpoints.Set automatic usage of hardware breakpoints.always-insertedWhen this mode is on, breakpoints are inserted immediately as soon as they're created, kept inserted even when execution stops, and removed only when the user deletes them. When this mode is off (the default), breakpoints are inserted only when execution continues, and removed when execution stops.Show mode for inserting breakpoints.Set mode for inserting breakpoints.condition-evaluationWhen this is set to "host", breakpoint conditions will be evaluated on the host's side by GDB. When it is set to "target", breakpoint conditions will be downloaded to the target (if the target supports such feature) and conditions will be evaluated on the target's side. If this is set to "auto" (default), this will be automatically set to "target" if it supports condition evaluation, otherwise it will be set to "host".Show mode of breakpoint condition evaluation.Set mode of breakpoint condition evaluation.Set a breakpoint for an address range. break-range START-LOCATION, END-LOCATION where START-LOCATION and END-LOCATION can be one of the following: LINENUM, for that line in the current file, FILE:LINENUM, for that line in that file, +OFFSET, for that number of lines after the current line or the start of the range FUNCTION, for the first line in that function, FILE:FUNCTION, to distinguish among like-named static functions. *ADDRESS, for the instruction at that address. The breakpoint will stop execution of the inferior whenever it executes an instruction at any address within the [START-LOCATION, END-LOCATION] range (including START-LOCATION and END-LOCATION).break-rangeSet a dynamic printf at specified location. dprintf location,format string,arg1,arg2,... location may be a linespec, explicit, or address location. Linespecs are colon-separated lists of location parameters, such as source filename, function name, label name, and line number. Example: To specify the start of a label named "the_top" in the function "fact" in the file "factorial.c", use "factorial.c:fact:the_top". Address locations begin with "*" and specify an exact address in the program. Example: To specify the fourth byte past the start function "main", use "*main + 4". Explicit locations are similar to linespecs but use an option/argument syntax to specify location parameters. Example: To specify the start of the label named "the_top" in the function "fact" in the file "factorial.c", use "-source factorial.c -function fact -label the_top". By default, a specified function is matched against the program's functions in all scopes. For C++, this means in all namespaces and classes. For Ada, this means in all packages. E.g., in C++, "func()" matches "A::func()", "A::B::func()", etc. The "-qualified" flag overrides this behavior, making GDB interpret the specified name as a complete fully-qualified name instead.dprintf-styleThis setting chooses how GDB will do a dynamic printf. If the value is "gdb", then the printing is done by GDB to its own console, as with the "printf" command. If the value is "call", the print is done by calling a function in your program; by default printf(), but you can choose a different function or output stream by setting dprintf-function and dprintf-channel.Show the style of usage for dynamic printf.Set the style of usage for dynamic printf.dprintf-functionShow the function to use for dynamic printf.Set the function to use for dynamic printf.dprintf-channelShow the channel to use for dynamic printf.Set the channel to use for dynamic printf.disconnected-dprintfUse this to let dprintf commands continue to hit and produce output even if GDB disconnects or detaches from the target.Show whether dprintf continues after GDB disconnects.Set whether dprintf continues after GDB disconnects.Target agent only formatted printing, like the C "printf" function. Usage: agent-printf "format string", ARG1, ARG2, ARG3, ..., ARGN This supports most C printf format specifications, like %s, %d, etc. This is useful for formatted output in user-defined commands.Set the condition even if it is invalid for all current locations.This evaluates EXPRESSION and watches the memory to which is refers. -l can be used as a short form of -location.Argument required (file name in which to save)Nothing to save.Unable to open file '%s' for saving (%s) condition $bpnum %s ignore $bpnum %d commands end disable $bpnum disable $bpnum.%d set default-collect %s Saved to file '%s'. ?deleted?hw breakpointsw single-stephw watchpointread watchpointacc watchpointlongjmp resumelongjmp for call dummyexception resumehigh-priority step resumewatchpoint scopestd::terminateshlib eventsthread eventsoverlay eventslongjmp masterstd::terminate masterexception masterjit eventsSTT_GNU_IFUNC resolverSTT_GNU_IFUNC resolver return_longjmp_siglongjmpdstpkeepvoid refcounted_object::incref()../../gdb/../gdbsupport/refcounted-object.hm_refcount >= 0static void bp_location_ref_policy::decref(bp_location*)../../gdb/breakpoint.hloc->refcount () > 0scoped_debug_start_end::~scoped_debug_start_end()../../gdb/../gdbsupport/common-debug.hdebug_print_depth > 0%s: <%s debugging was not enabled on entry>notifyobservable %s notify() calledcalling observer %s of observable %svoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {so_list*}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {inferior*, long long unsigned int, int, const unsigned char*}]St11_Mutex_baseILN9__gnu_cxx12_Lock_policyE2EE^AI17refcounted_object^AIFvP7so_listEl^ BIFvP8inferioryiPKhEl^$BI21command_lines_deleter^@BISt16_Sp_counted_baseILN9__gnu_cxx12_Lock_policyE2EE^`BIAI10tracepoint^BILFI10thread_fsm^BI15fork_catchpoint^BILFIPFvP7so_listE^BIBIPFvP8inferioryiPKhE^CI8BISt19_Sp_counted_deleterIP12command_line21command_lines_deleterSaIvELN9__gnu_cxx12_Lock_policyE2EE^8CIBIBI__BID_d_CISSSSHThosttargetautoI!>I,HN>IHS>ILFIeDfFIglghost or targetagentH9>IC>IB>I$FILJJFIdffdFIffFIgggdbcallnynnyFI0rPr SS|CICICIEIEIGEI11bp_locationH^FIBI10breakpoint^[btrace] [ftrace] %s: fun = %s, file = %s, level = %d, insn = [%u; %u) updating callerset caller..to[btrace] [ftrace] fixup level (%+d) ..bfunInvalid argument.No thread.No btrace configuration.Format: %s. Number of packets: %zu. instruction overflowunknown instructionCannot process branch trace. XML support was disabled at compile time.Cannot process the branch trace configuration. XML support was disabled at compile time.const btrace_insn* btrace_insn_get(const btrace_insn_iterator*)../../gdb/btrace.c0 < endindex < endNo trace.unsigned int btrace_insn_next(btrace_insn_iterator*, unsigned int)adv > 0int btrace_insn_cmp(const btrace_insn_iterator*, const btrace_insn_iterator*)lhs->btinfo == rhs->btinfounsigned int btrace_call_prev(btrace_call_iterator*, unsigned int)it->index <= lengthint btrace_call_cmp(const btrace_call_iterator*, const btrace_call_iterator*)void btrace_set_call_history(btrace_thread_info*, const btrace_call_iterator*, const btrace_call_iterator*)begin->btinfo == end->btinfoInfo about branch tracing data.Branch tracing maintenance commands.Set branch tracing specific variables.Set Intel Processor Trace specific variables.Show branch tracing specific variables.Show Intel Processor Trace specific variables.skip-padWhen enabled, PAD packets are ignored in the btrace packet history.Show whether PAD packets should be skipped in the btrace packet history.Set whether PAD packets should be skipped in the btrace packet history.Print the raw branch tracing data. With no argument, print ten more packets after the previous ten-line print. With '-' as argument print ten packets before a previous ten-line print. One argument specifies the starting packet of a ten-line print. Two arguments with comma between specify starting and ending packets to print. Preceded with '+'/'-' the second argument specifies the distance from the first.Clears the branch tracing packet history. Discards the raw branch tracing data but not the execution history data.clear-packet-historyClears the branch tracing data. Discards the raw branch tracing data and the execution history data. The next 'record' command will fetch the branch tracing data anew.[btrace] clear thread %s (%s) Recording not enabled on thread %s (%s).[btrace] disable thread %s (%s) [btrace] teardown thread %s (%s) btrace_function* ftrace_new_return(btrace_thread_info*, minimal_symbol*, symbol*)caller->next == 0new returnnew return - no callernew return - unknown callernew tail call[btrace] free objfile [btrace] bridge gaps [btrace] [ftrace] checking gap at insn %u (req matches: %d) [btrace] [ftrace] ..matches: %d void ftrace_connect_backtrace(btrace_thread_info*, btrace_function*, btrace_function*)!ftrace_function_switched (lhs, rhs->msym, rhs->sym)[btrace] [ftrace] connecting... ..prev..nextvoid ftrace_connect_bfun(btrace_thread_info*, btrace_function*, btrace_function*)prev->next == 0next->prev == 0[btrace] [ftrace] using next's callers [btrace] [ftrace] using prev's callers [btrace] [ftrace] adding prev's tail calls to next [btrace] [ftrace] fixing up link for tailcall chain ..top..up[btrace] [ftrace] will fix up link in next iteration [btrace] [ftrace] setting global level offset: %d new gap[btrace] compute ftrace Recorded trace may be corrupted at instruction %u (pc = %s).[btrace] [ftrace] no symbol at %s _dl_runtime_resolvenew call_Unwind_[btrace] [ftrace] switching from %s in %s at %s new switchupdate insnRecorded trace may be incomplete at instruction %u (pc = %s).Unexpected branch trace format.Unknown branch trace format.Recording already enabled on thread %s (%s).Intel Processor Trace support was disabled at compile time.[btrace] enable thread %s (%s) Failed to enable recording on thread %s (%s).[btrace] fetch thread %s (%s) void btrace_fetch(thread_info*, const btrace_cpu*)can_access_registers_thread (tp)int btrace_stitch_bts(btrace_data_bts*, thread_info*)!btinfo->functions.empty ()!btrace->blocks->empty ()[btrace] stitching %s to %s Error while trying to read delta trace. Falling back to a full read.first_new_block->begin == 0[btrace] pruning insn at %s for stitching Failed to read branch trace.No trace. '%u' is out of range.%u begin: %s, end: %s vector::_M_range_check: __n (which is %zu) >= this->size() (which is %zu)File "%s" has no build-id, file skippedFile "%s" has a different build-id, file skipped Trying %s... no, unable to compute real path no, unable to open. no, build-id does not match. yes! /.build-id/%02x/target:.debug Looking for separate debug info (build-id) for %s "%s": separate debug info file has no debug infovoid set_last_source_file(const char*)../../gdb/buildsym-legacy.cbuildsym_compunit != nullptr || name == nullptrvoid set_last_source_start_addr(CORE_ADDR)buildsym_compunit != nullptrCORE_ADDR get_last_source_start_addr()using_direct** get_local_using_directives()void set_local_using_directives(using_direct*)using_direct** get_global_using_directives()bool outermost_context_p()context_stack* get_current_context_stack()int get_context_stack_depth()subfile* get_current_subfile()pending** get_local_symbols()pending** get_file_symbols()pending** get_global_symbols()void start_subfile(const char*)void patch_subfile_names(subfile*, const char*)void push_subfile()const char* pop_subfile()compunit_symtab* end_symtab(CORE_ADDR, int)context_stack* push_context(int, CORE_ADDR)context_stack pop_context()block* finish_block(symbol*, pending_block*, const dynamic_prop*, CORE_ADDR, CORE_ADDR)void record_block_range(block*, CORE_ADDR, CORE_ADDR)void record_line(subfile*, int, CORE_ADDR)compunit_symtab* start_symtab(objfile*, const char*, const char*, CORE_ADDR, language)buildsym_compunit == nullptrvoid restart_symtab(compunit_symtab*, const char*, CORE_ADDR)compunit_symtab* buildsym_compunit_symtab()buildsym_compunit != NULLmacro_table* get_macro_table()buildsym_compunit* get_buildsym_compunit()block end address less than block start address in %s (patched it)block end address %s less than block start address %s (patched it)inner block not inside outer block in %sinner block (%s-%s) not inside outer block (%s-%s)block at %s out of orderconst char* buildsym_compunit::pop_subfile()../../gdb/buildsym.c!m_subfile_stack.empty ()void buildsym_compunit::watch_main_source_file_lossage()mainsub_alias != NULL && mainsub_alias != mainsubContext stack not empty in augment_type_symtabBlocks in a type symtabMacro in a type symtabLine numbers recorded in a type symtabcontext_stack buildsym_compunit::pop_context()!m_context_stack.empty ()void buildsym_compunit::push_subfile()m_current_subfile != NULLm_current_subfile->name != NULLContext stack not empty in end_symtabcompunit_symtab* buildsym_compunit::end_symtab_with_blockvector(block*, int, int)static_block != NULLm_subfiles != NULLmain_symtab == COMPUNIT_FILETABS (cu)A %s in expression, near `%s'.parameter types following 'void''void' invalid as parameter typeNumeric constant too large.typed_val_int<%s, %s>tsvalsval<%s>tsymssymbval<%s>\x\x escape without a following hex digit\%c escape without a following hex digit\\void scan_macro_expansion(const char*)c-exp.y! cpstate->macro_original_textint lex_one_token(parser_state*, bool*)(tokentab3[i].flags & FLAG_C) == 0(tokentab2[i].flags & FLAG_C) == 0Invalid number "%s".selectorUnterminated string in expression.Unmatched single quote.Empty character constant.Invalid character constant.Invalid character '%c' in expression.static_castconst_castmemory exhaustedint c_yylex()current.token == TYPENAME%s is not an ObjC ClassUndefined string concatenation.unrecognized type in string concatenation@entry can be used only for function parameters, not for "%s"No symbol "%s" in specified context.`%s' is not defined as an aggregate type.No type "%s" within class or namespace "%s".No symbol "%s" in current context.vector::_M_range_insertlong double new new[] delete[]<<==!=&&||->*syntax errorint c_parse(parser_state*)+=-=*=/=%=<<=>>=&=|=sizeof_Alignofalignof__restrict__complex__and_eqbitandbitorcomplnot_eqxor_eq__typeof____typeof__decltype.*COMPLEX_INTCOMPLEX_FLOATCHARUNKNOWN_CPP_NAMECOMPLETECLASSNAMEOBJC_LBRACNAME_OR_INTOPERATORCLASSTEMPLATESTATIC_CASTCONST_CASTSIGNED_KEYWORDSHORTINT_KEYWORDCONST_KEYWORDVOLATILE_KEYWORDDOUBLE_KEYWORDFLOAT_KEYWORDABOVE_COMMA'?'ORORANDAND'^'ARROW_STARDOT_STARBLOCKNAMEDOTDOTDOT'!''~'type_exp$@2$@3msglistmsgarglistmsgarg$@4$@5lcurlyfunction_methodfunction_method_voidfunction_method_void_or_typelistrcurlystring_expconst_or_volatilesingle_qualifierqualifier_seq_nooptqualifier_seqptr_operator$@6$@7ptr_operator_tsdirect_abs_declarray_modfunc_modscalar_typetypebasetype_nameparameter_typelistnonempty_typelistptypeconversion_type_idconversion_declaratorconst_and_volatileconst_or_volatile_nooptoperfield_namename_not_typenameAttempt to use a type as an expressionN4expr23tuple_holding_operationIJP6symbolEEE^8kIpLN4expr25var_entry_value_operationE^tkIhkIN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EENSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEEEE^kIGN4expr25func_static_var_operationE^@lI4lIN4expr23tuple_holding_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_P4typeEEE^plIpLN4expr24maybe_constant_operationIJSt10unique_ptrINS_9operationESt14default_deleteIS2_EES5_P4typeEEE^lIlIN4expr17complex_operationE^PmIDmIN4expr18structop_operationE^xmILN4expr22structop_ptr_operationE^mILN4expr25structop_member_operationE^mIܟLN4expr23structop_mptr_operationE^mIܟLN4expr13sub_operationE^,nITPGN4expr15binop_operationIL10exp_opcode14EXadL_Z13eval_op_equalP4typeP10expression6nosideS1_P5valueS8_EEEE^PnITPGN4expr24usual_ax_binop_operationIL10exp_opcode14EXadL_Z13eval_op_equalP4typeP10expression6nosideS1_P5valueS8_EEEE^nInIN4expr20comparison_operationIL10exp_opcode14EXadL_Z13eval_op_equalP4typeP10expression6nosideS1_P5valueS8_EEEE^HoIjIHjI-PQjI]jIfjIpjIjIjIjIjIjIjIjIjIhMjI      !"#$%&'()*+,-./01234,5=?67|^&89<>:;<=@+-*/%>?@AB.C[(DEF)!~]:{}ygI2ugI2:gIBIFfgI2igI2lgI2ogI2rgI2gI2 }gI2 K2 I?7EJ@MA4gI77gI6`Q+gI<3N=.gI81gI9vgI:zgI;gIC%HLVtI+bQ%H&gIgIgIgI,L/O4#VSzbHbiK(R*I-I-gI-~I. RTiK'%V0gI0jG3GiK)gIIQ5KghH7gI2 gI&gI|gI~T!gI9shH6gI2 G^gI2 neI!cSbeI aSgI#RgI#RgI#RgI$SgI$SW%TPW W#,5;-.1MS8DuedIdv w{cccccy3dII (((Xh ddd{=AA5x7x".I "(QYK_=FdIIddd@ZL>UYJH6IRK]A8B9GT\=^<_[  !"#$%&'()*+,-./0123457:;?@CDEFMNOPQSVWX GJu66>6-6/0123 J78u(*6> YU _>\N\PU6+, NTPYTUGU'()*6T-TU0AC+,AY\\V+,A./Y'YA*V()*UU]UV[G;>6 'J*(*#PQRSTU\\Y*  Z V *A[()** **Y _;JJ>YR\\\'()*J-\Y0 TU YV*Y 7Y*B=CBB7BHIV*=* [ Y6V\\\Y\UY\abU]`BUUd '()*`V- d0JKLVNOPQRSTUV,;<=>?@ABCDEFGHIJKL+NOPQRSTUd ) !"$%&'()*+,-./01245>GHIJNOUVWZ[^  !"&'()*+,-./01245EFGHIJKL>NOPQRSTUGHIJNOUVWZ[^  !"'(&*-245GHIJKL>NOPQRSTUHIJNOUVWZ[^  !"&NOPQRSTU245HIJKL>NOPQRSTUHIJNOUVWZ[^  !"&+,./245;>>GJHIJNOUVWZ[^'()*+,-./01368:;<=>?@ABCDEFGHIJKLNOPQTU3Z[89:;<=>?@ABCDEFGHIJKLNOPQRSTU]'()*+,-./01;>GJTUY'()*+,-./01G'()*+,-./01YG'()*+,-./01YG3X89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU3Y89:;<=>?@ABCDEFGHIJKLNOPQRSTU9:;<=>?@ABCDEFGHIJKLNOPQRSTU<=>?@ABCDEFGHIJKLNOPQRSTU=>?@ABCDEFGHIJKLNOPQRSTU>?@ABCDEFGHIJKLNOPQRSTU?@ABCDEFGHIJKLNOPQRSTUABCDEFGHIJKLNOPQRSTU$%'()*+,-./01G'()*+,-./01GS[;\}}}}^<}~NSIu Iwx8z>P{Nwx./G{}}OI0D1234a5Z6DPQOTgh#$&'[\|br| 7.M wxzm{ !"#$%&'()*+,-  ;@}}}:}:KLwxzAD{}}}}| _wx</{wxyzG0{X]i`jk12345lo6wxz{wxzp|{qxwxz}{z|s}tuv|}~=|M}} !"|%(||J  Y VE !"#$%&'()*n+,?-./0123456789  !"#$%&'()*+,-./0123456789 QR *+,-/0123456789 *+,-/012356789 #$&'*+,-./012345678T9UVW !"#$%&'()XYZ[\]^_`abcdefg.hijklmnopqrstT !"#$%&'()T.U !"#$%&'()T. !"#$%&'()TB. !"#$%&'()U.wy{T !"#$%&'()T. !"#$%&'()._`cdmpabfqrt:;@Boe{}8(*, | 5<nv;x  H ^][ZYXWQRUVSTOPIMNJKL  !$%7;DECwgy/0.hG'" &?~F=9z43)1+-\#6>2ikjl $(/059=AEOSW[_cgkosz "$+(8A@SWZ^bq{  %5FPY`mv%+3;AN[lw   !"%'/7>FHJLPUahknqtwz} "+0267>EOQZcjkrvwz{~  '4  !"$%&'()*+,-./01245>GHIJNOUVWZ[^abcdmopqstuvxyUUd368:;<=>?@ABCDEFHIJKLNOPQTUZ[ V UdU()* VAAAAUUU()'(*-'*d dddddbcdd6389:;<=>?@ABCDEFGHIJKLNOPQRSTUbdnxy;>JTU{~#l[efg\TT\Y{ b(**Abbbbddbd(***'***YYdcdddddddddddddddddddddd '()*-0[vd [vdcYk_r6rx\{{}\YJUYn6]hijhh\\\\JYY*BBBBYYYYY***d\] \+,wnY6dd\yz\YY|Ydd\j]\\BUUUUd ,+YwXzdddddYYYYfgIigIlgIogIrgIMugIygIMM}gIgIK`aabbbbccddddddddddddddddddddddddddddddedfdgdhhiijjjkddldmnnnopdqqdrddddddddddddddddddddddddddddddddddddddddssddddtttuuvvvuuuwwxxxxxxyyzz|{}{{{{{~0$i ":=cdeC>?@AHBCDEFGRHIJWFKvL9fMC++asmAssemblyminimalMinimalUTF-16BEUTF-16LEUTF-32BEUTF-32LEunhandled c_string_type../../gdb/c-lang.cwchar_tchar16_tchar32_tMalformed escape sequence\x used with no following hex digits.\u used with no following hex digitsCould not convert character constant to target character setToo many array elementsAttempt to take address of value not located in memory.Trying to read string with inappropriate type `%s'.Trying to read string with inappropriate type..s.sx.S.C.cp.cpp.cxx.c++boolN4expr23tuple_holding_operationIJ20c_string_type_valuesSt6vectorINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS8_EEEEE^IpL10c_language^XIN14cplus_language^tIN12asm_language^IN16minimal_language^INLIDȕdD L `hI x)l $/, | h\ h )) &xyyyy yzzp *| * (*0*8* wwI x x , \  \ xyyyy yzzp | * (*0*8* T I P x)x $/, wP+h\ h < )) &xyyyy yzzp *| * (*0*8* wwI ( x) $/, wP+h\ h \ )) &xyyyy yzzp *| *4 (*0*8*< wwI"VIIIIIIIN4expr18c_string_operationE^ILII\ DȕdD L `protected: private: public: typedef publicprivateunion class struct enum void c_type_print_base_1(type*, ui_file*, int, int, language, const type_print_options*, print_offset_data*)../../gdb/c-typeprint.ctype->name () == NULLTYPE_TARGET_TYPE (type) == NULL{unnamed[with %s = static : %d%p[%p] %s; , ...void cp_type_print_method_args(type*, const char*, const char*, int, ui_file*, language, const type_print_options*)nargs > 0args[0].type ()->code () == TYPE_CODE_PTR volatile _Atomic static __restrict__ restrictvoid c_type_print_base_struct_union(type*, ui_file*, int, int, language, const type_print_options*, print_offset_data*)target->code () == TYPE_CODE_TYPEDEF%*s}: %s flag %*s%p[%p] %*s%p[%p] namespace ::*type not handled in c_type_print_varspec_prefix() __attribute__ ((vector_size(type not handled in c_type_print_varspec_suffix() <Could not determine the array high bound%d vtable entries [incomplete object] [uninitialized] (%s%s) (%s ?) + !gYI=TjGO W.WsLOvoid adjust_value_for_child_access(value**, type**, int*, int)../../gdb/c-varobj.ctype && *type!TYPE_IS_REFERENCE (*type)value* value_struct_element_index(value*, int)type->code () == TYPE_CODE_STRUCT || type->code () == TYPE_CODE_UNIONbool c_is_path_expr_parent(const varobj*)var->index < parent_type->num_fields ()std::string c_value_of_variable(const varobj*, varobj_display_formats)varobj_value_is_changeable_p (var)!value_lazy (var->value.get ())(%s)[%s](%s)%s%s*(%s)((%s)%s%s)(%s(class %s%s) %s)void cplus_describe_child(const varobj*, int, std::string*, value**, type**, std::string*)\F C DU T T @T D ],@ XE B M xM M L C ],@ The target wide character set is "auto; currently %s". The target wide character set is "%s". The target character set is "auto; currently %s". The target character set is "%s". The host character set is "auto; currently %s". The host character set is "%s". Cannot convert between character sets `%s' and `%s'int host_hex_value(char)../../gdb/charset.cc >= 'A' && c <= 'F'Converting character setsCould not convert character to `%s' character set\%.3oInternal error while converting character setsUTF-32UTF-%d%sUCS-%d%sUnable to find a valid charset for string conversionsLANGUAGELC_ALLiconv-lThe `host character set' is the one used by the system GDB is running on. The `target character set' is the one used by the program being debugged. You may only use supersets of ASCII for your host character set; GDB does not support any others. To see a list of the character sets GDB supports, type `set charset '.Show the host and target character sets.Set the host and target character sets.host-charsetThe `host character set' is the one used by the system GDB is running on. You may only use supersets of ASCII for your host character set; GDB does not support any others. To see a list of the character sets GDB supports, type `set host-charset '.Show the host character set.Set the host character set.target-charsetThe `target character set' is the one used by the program being debugged. GDB translates characters and strings between the host and target character sets as needed. To see a list of the character sets GDB supports, type `set target-charset'Show the target character set.Set the target character set.target-wide-charsetThe `target wide character set' is the one used by the program being debugged. In particular it is the encoding used by `wchar_t'. GDB translates characters and strings between the host and target character sets as needed. To see a list of the character sets GDB supports, type `set target-wide-charset'Show the target wide character set.Set the target wide character set.ISO-8859-1The followingnot necessarilythe FROM and TOlisted with several500V18859_18859_28859_38859_48859_58859_68859_78859_88859_910646-1:1993ANSI_X3.4-1968ANSI_X3.4-1986ANSI_X3.4ANSI_X3.110-1983ANSI_X3.110ARABIC7ARMSCII-8ASMO-708ASMO_449BIG-5BIG-FIVEBIG5-HKSCSBIG5HKSCSBIGFIVEBRFBS_4730CN-BIG5CN-GBCP-ARCP-HUCP037CP038CP273CP274CP275CP278CP280CP281CP282CP284CP285CP290CP297CP367CP420CP423CP424CP437CP500CP737CP775CP803CP813CP819CP850CP851CP855CP856CP857CP860CP861CP862CP863CP864CP865CP866CP866NAVCP868CP869CP870CP871CP874CP875CP880CP891CP901CP902CP903CP904CP905CP912CP915CP916CP918CP920CP921CP922CP930CP932CP933CP935CP936CP937CP939CP950CP1004CP1008CP1025CP1026CP1046CP1047CP1070CP1079CP1081CP1084CP1089CP1097CP1112CP1122CP1123CP1124CP1125CP1129CP1130CP1132CP1133CP1137CP1140CP1141CP1142CP1143CP1144CP1145CP1146CP1147CP1148CP1149CP1153CP1154CP1155CP1156CP1157CP1158CP1160CP1161CP1162CP1163CP1164CP1166CP1167CP1250CP1251CP1252CP1253CP1254CP1255CP1256CP1257CP1258CP1282CP1364CP1371CP1388CP1390CP1399CP4517CP4899CP4909CP4971CP5347CP9030CP9066CP9448CP10007CP12712CP16804CPIBM861CSA7-1CSA7-2CSASCIICSA_T500-1983CSA_T500CSA_Z243.4-1985-1CSA_Z243.4-1985-2CSA_Z243.419851CSA_Z243.419852CSDECMCSCSEBCDICATDECSEBCDICATDEACSEBCDICCAFRCSEBCDICDKNOCSEBCDICDKNOACSEBCDICESCSEBCDICESACSEBCDICESSCSEBCDICFISECSEBCDICFISEACSEBCDICFRCSEBCDICITCSEBCDICPTCSEBCDICUKCSEBCDICUSCSEUCKRCSEUCPKDFMTJAPANESECSGB2312CSHPROMAN8CSIBM037CSIBM038CSIBM273CSIBM274CSIBM275CSIBM277CSIBM278CSIBM280CSIBM281CSIBM284CSIBM285CSIBM290CSIBM297CSIBM420CSIBM423CSIBM424CSIBM500CSIBM803CSIBM851CSIBM855CSIBM856CSIBM857CSIBM860CSIBM863CSIBM864CSIBM865CSIBM866CSIBM868CSIBM869CSIBM870CSIBM871CSIBM880CSIBM891CSIBM901CSIBM902CSIBM903CSIBM904CSIBM905CSIBM918CSIBM921CSIBM922CSIBM930CSIBM932CSIBM933CSIBM935CSIBM937CSIBM939CSIBM943CSIBM1008CSIBM1025CSIBM1026CSIBM1097CSIBM1112CSIBM1122CSIBM1123CSIBM1124CSIBM1129CSIBM1130CSIBM1132CSIBM1133CSIBM1137CSIBM1140CSIBM1141CSIBM1142CSIBM1143CSIBM1144CSIBM1145CSIBM1146CSIBM1147CSIBM1148CSIBM1149CSIBM1153CSIBM1154CSIBM1155CSIBM1156CSIBM1157CSIBM1158CSIBM1160CSIBM1161CSIBM1163CSIBM1164CSIBM1166CSIBM1167CSIBM1364CSIBM1371CSIBM1388CSIBM1390CSIBM1399CSIBM4517CSIBM4899CSIBM4909CSIBM4971CSIBM5347CSIBM9030CSIBM9066CSIBM9448CSIBM12712CSIBM16804CSIBM11621162CSISO4UNITEDKINGDOMCSISO10SWEDISHCSISO11SWEDISHFORNAMESCSISO14JISC6220ROCSISO15ITALIANCSISO16PORTUGESECSISO17SPANISHCSISO18GREEK7OLDCSISO19LATINGREEKCSISO21GERMANCSISO25FRENCHCSISO27LATINGREEK1CSISO49INISCSISO50INIS8CSISO51INISCYRILLICCSISO58GB1988CSISO60DANISHNORWEGIANCSISO60NORWEGIAN1CSISO61NORWEGIAN2CSISO69FRENCHCSISO84PORTUGUESE2CSISO85SPANISH2CSISO86HUNGARIANCSISO88GREEK7CSISO89ASMO449CSISO90CSISO92JISC62991984BCSISO99NAPLPSCSISO103T618BITCSISO111ECMACYRILLICCSISO121CANADIAN1CSISO122CANADIAN2CSISO139CSN369103CSISO141JUSIB1002CSISO143IECP271CSISO150CSISO150GREEKCCITTCSISO151CUBACSISO153GOST1976874CSISO646DANISHCSISO2022CNCSISO2022JPCSISO2022JP2CSISO2022KRCSISO2033CSISO5427CYRILLICCSISO5427CYRILLIC1981CSISO5428GREEKCSISO10367BOXCSISOLATIN1CSISOLATIN2CSISOLATIN3CSISOLATIN4CSISOLATIN5CSISOLATIN6CSISOLATINARABICCSISOLATINCYRILLICCSISOLATINGREEKCSISOLATINHEBREWCSKOI8RCSKSC5636CSMACINTOSHCSNATSDANOCSNATSSEFICSN_369103CSPC8CODEPAGE437CSPC775BALTICCSPC850MULTILINGUALCSPC862LATINHEBREWCSPCP852CSSHIFTJISCSUCS4CSUNICODECSWINDOWS31JCWI-2CWIDEC-MCSDECDIN_66003DS2089DS_2089E13BEBCDIC-AT-DE-AEBCDIC-AT-DEEBCDIC-BEEBCDIC-BREBCDIC-CA-FREBCDIC-CP-AR1EBCDIC-CP-AR2EBCDIC-CP-BEEBCDIC-CP-CAEBCDIC-CP-CHEBCDIC-CP-DKEBCDIC-CP-ESEBCDIC-CP-FIEBCDIC-CP-FREBCDIC-CP-GBEBCDIC-CP-GREBCDIC-CP-HEEBCDIC-CP-ISEBCDIC-CP-ITEBCDIC-CP-NLEBCDIC-CP-NOEBCDIC-CP-ROECEEBCDIC-CP-SEEBCDIC-CP-TREBCDIC-CP-USEBCDIC-CP-WTEBCDIC-CP-YUEBCDIC-CYRILLICEBCDIC-DK-NO-AEBCDIC-DK-NOEBCDIC-ES-AEBCDIC-ES-SEBCDIC-ESEBCDIC-FI-SE-AEBCDIC-FI-SEEBCDIC-FREBCDIC-GREEKEBCDIC-INTEBCDIC-INT1EBCDIC-IS-FRISSEBCDIC-ITEBCDIC-JP-EEBCDIC-JP-KANAEBCDIC-PTEBCDIC-UKEBCDIC-USEBCDICISFRISSECMA-114ECMA-118ECMA-128ECMA-CYRILLICELOT_928EUC-CNEUC-JISX0213EUC-JP-MSEUC-JPEUC-KREUC-TWEUCCNEUCJP-MSEUCJP-OPENEUCJP-WINEUCJPEUCTWGB13000GB18030GBKGB_1988-80GB_198880GEORGIAN-ACADEMYGEORGIAN-PSGOST_19768-74GOST_19768GOST_1976874GREEK-CCITTGREEK7-OLDHP-GREEK8HP-ROMAN8HP-ROMAN9HP-THAI8HP-TURKISH8HPGREEK8HPROMAN9HPTHAI8HPTURKISH8IBM-803IBM-856IBM-901IBM-902IBM-921IBM-922IBM-930IBM-932IBM-933IBM-935IBM-937IBM-939IBM-943IBM-1008IBM-1025IBM-1046IBM-1047IBM-1097IBM-1112IBM-1122IBM-1123IBM-1124IBM-1129IBM-1130IBM-1132IBM-1133IBM-1137IBM-1140IBM-1141IBM-1142IBM-1143IBM-1144IBM-1145IBM-1146IBM-1147IBM-1148IBM-1149IBM-1153IBM-1154IBM-1155IBM-1156IBM-1157IBM-1158IBM-1160IBM-1161IBM-1162IBM-1163IBM-1164IBM-1166IBM-1167IBM-1364IBM-1371IBM-1388IBM-1390IBM-1399IBM-4517IBM-4899IBM-4909IBM-4971IBM-5347IBM-9030IBM-9066IBM-9448IBM-12712IBM-16804IBM256IBM367IBM437IBM775IBM813IBM819IBM848IBM850IBM852IBM862IBM866NAVIBM874IBM875IBM912IBM915IBM916IBM920IBM1004IBM1046IBM1047IBM1089IBM1162IEC_P27-1IEC_P271INIS-8INIS-CYRILLICISIRI-3342ISIRI3342ISO-2022-CN-EXTISO-2022-CNISO-2022-JP-2ISO-2022-JP-3ISO-2022-JPISO-2022-KRISO-8859-2ISO-8859-3ISO-8859-4ISO-8859-5ISO-8859-6ISO-8859-7ISO-8859-8ISO-8859-9ISO-8859-9EISO-8859-10ISO-8859-11ISO-8859-13ISO-8859-14ISO-8859-15ISO-8859-16ISO-10646ISO-CELTICISO-IR-4ISO-IR-6ISO-IR-8-1ISO-IR-9-1ISO-IR-10ISO-IR-11ISO-IR-14ISO-IR-15ISO-IR-16ISO-IR-17ISO-IR-18ISO-IR-19ISO-IR-21ISO-IR-25ISO-IR-27ISO-IR-37ISO-IR-49ISO-IR-50ISO-IR-51ISO-IR-54ISO-IR-55ISO-IR-57ISO-IR-60ISO-IR-61ISO-IR-69ISO-IR-84ISO-IR-85ISO-IR-86ISO-IR-88ISO-IR-89ISO-IR-90ISO-IR-92ISO-IR-98ISO-IR-99ISO-IR-100ISO-IR-101ISO-IR-103ISO-IR-109ISO-IR-110ISO-IR-111ISO-IR-121ISO-IR-122ISO-IR-126ISO-IR-127ISO-IR-138ISO-IR-139ISO-IR-141ISO-IR-143ISO-IR-144ISO-IR-148ISO-IR-150ISO-IR-151ISO-IR-153ISO-IR-155ISO-IR-156ISO-IR-157ISO-IR-166ISO-IR-179ISO-IR-193ISO-IR-197ISO-IR-199ISO-IR-203ISO-IR-209ISO-IR-226ISO646-CAISO646-CA2ISO646-CNISO646-CUISO646-DEISO646-DKISO646-ESISO646-ES2ISO646-FIISO646-FRISO646-FR1ISO646-GBISO646-HUISO646-ITISO646-JP-OCR-BISO646-JPISO646-KRISO646-NOISO646-NO2ISO646-PTISO646-PT2ISO646-SEISO646-SE2ISO646-USISO646-YUISO2022CNEXTISO6937ISO8859-1ISO8859-2ISO8859-3ISO8859-4ISO8859-5ISO8859-6ISO8859-7ISO8859-8ISO8859-9ISO8859-9EISO8859-10ISO8859-11ISO8859-13ISO8859-14ISO8859-15ISO8859-16ISO11548-1ISO88591ISO88592ISO88593ISO88594ISO88595ISO88596ISO88597ISO88598ISO88599ISO88599EISO885910ISO885911ISO885913ISO885914ISO885915ISO885916ISO_646.IRV:1991ISO_2033-1983ISO_2033ISO_5427-EXTISO_5427ISO_5427:1981ISO_5427EXTISO_5428ISO_5428:1980ISO_6937-2ISO_6937-2:1983ISO_6937ISO_6937:1992ISO_8859-1ISO_8859-1:1987ISO_8859-2ISO_8859-2:1987ISO_8859-3ISO_8859-3:1988ISO_8859-4ISO_8859-4:1988ISO_8859-5ISO_8859-5:1988ISO_8859-6ISO_8859-6:1987ISO_8859-7ISO_8859-7:1987ISO_8859-7:2003ISO_8859-8ISO_8859-8:1988ISO_8859-9ISO_8859-9:1989ISO_8859-9EISO_8859-10ISO_8859-10:1992ISO_8859-14ISO_8859-14:1998ISO_8859-15ISO_8859-15:1998ISO_8859-16ISO_8859-16:2001ISO_9036ISO_10367-BOXISO_10367BOXISO_11548-1ISO_69372JIS_C6220-1969-ROJIS_C6229-1984-BJIS_C62201969ROJIS_C62291984BJOHABJSJUS_I.B1.002KOI-7KOI-8KOI8-RKOI8-RUKOI8-TKOI8-UKOI8KOI8UL10LATIN-9LATIN-GREEK-1LATIN-GREEKLATIN7LATIN8LATIN10MAC-CENTRALEUROPEMAC-ISMAC-SAMIMAC-UKMACMACISMACUKMACUKRAINIANMIKMS-ANSIMS-ARABMS-CYRLMS-EEMS-GREEKMS-HEBRMS-MAC-CYRILLICMS-TURKMS932MS936MSCP949MSCP1361MSMACCYRILLICMSZ_7795.3MS_KANJINATS-DANONATS-SEFINC_NC0010NC_NC00-10NC_NC00-10:81NF_Z_62-010NF_Z_62-010_(1973)NF_Z_62-010_1973NF_Z_62010NF_Z_62010_1973NS_4551-1NS_4551-2NS_45511NS_45512OS2LATIN1OSF00010001OSF00010002OSF00010003OSF00010004OSF00010005OSF00010006OSF00010007OSF00010008OSF00010009OSF0001000AOSF00010020OSF00010100OSF00010101OSF00010102OSF00010104OSF00010105OSF00010106OSF00030010OSF0004000AOSF0005000AOSF05010001OSF100201A4OSF100201A8OSF100201B5OSF100201F4OSF100203B5OSF1002011COSF1002011DOSF1002035DOSF1002035EOSF1002035FOSF1002036BOSF1002037BOSF10010001OSF10010004OSF10010006OSF10020025OSF10020111OSF10020115OSF10020116OSF10020118OSF10020122OSF10020129OSF10020352OSF10020354OSF10020357OSF10020359OSF10020360OSF10020364OSF10020365OSF10020366OSF10020367OSF10020370OSF10020387OSF10020388OSF10020396OSF10020402OSF10020417PT154RK1048RUSCIISEN_850200_BSEN_850200_CSHIFT-JISSHIFT_JISSHIFT_JISX0213SJIS-OPENSJIS-WINSJISSS636127STRK1048-2002ST_SEV_358-88T.61-8BITT.61T.618BITTCVN-5712TCVNTCVN5712-1TCVN5712-1:1993TIS-620TIS620-0TIS620.2529-1TIS620.2533-0TIS620TS-5881TSCIIUCS-2UCS-2BEUCS-2LEUCS-4UCS-4BEUCS-4LEUCS2UHCUJISUNICODEBIGUNICODELITTLEUS-ASCIIUTF-7UTF-8UTF-16UTF7UTF16UTF16BEUTF16LEUTF32UTF32BEUTF32LEVISCIIWCHAR_TWIN-SAMI-2WINBALTRIMWINDOWS-31JWINDOWS-874WINDOWS-936WINDOWS-1250WINDOWS-1251WINDOWS-1252WINDOWS-1253WINDOWS-1254WINDOWS-1255WINDOWS-1256WINDOWS-1257WINDOWS-1258WINSAMI2WS2III IkGIIhUII III)IIIIIIIIIIIJ[IIII#I*I1I8I?IFIMITI[IbIoI~IIII.IIIJIIIIIIIIIIIIIISIII$I*I0I6IIHIRI\IfIpIzIIIIIIIIIIII!I2IAIRIdIrIIIIIIIII II*I:IKIYIhIpIIIIIIIIIII,I9IMI\IhItIIIIIIIIIII II$I5IHIXIiIqI{IIIIIIIIIII II4I I&III*I2I#I6I#I@IGIOITIcIpIzIIIIIIIIIIIII"I/IIGIQIII[I&I/I8IAIJISI\IeInIwIIbIIIIiIIpIIwI~IIIIIIIIIIIIIIIIIII"III+I4I=IFIOIXIaIIIIjIIsI|IIIIIIIIIIIIIIIIIII III(I2I= 0 && n <= countargv (argv)Usage: alias [-a] [--] ALIAS = COMMAND [DEFAULT-ARGS...]ALIAS missing.cmd_list_element* lookup_cmd_for_default_args(const char**, cmd_list_element**)cmd == lcmdInvalid command name: %sInvalid command element name: %sInvalid command to alias to: %sCannot define an alias of an alias that has default argsAlias already exists: %sAlias %s is the name of an existing commandMismatched command length between ALIAS and COMMAND.void alias_command(const char*, int)c_command != NULL && c_command != (struct cmd_list_element *) -1c_command->is_prefix ()ALIAS and COMMAND prefixes do not match.alias_cmd != nullptralias_cmd->default_args.empty ()Dump of assembler code for function %ps: from %ps to %ps: Address range %ps to %ps: End of assembler dump. file: "%s", line number: %d, symbol: "%s" Missing modifier.Invalid disassembly modifier.Cannot specify both /m and /s.No frame selected.No function contains program counter for selected frame.No function contains specified address.Argument required (%s).Maintenance commands. Some gdb commands are provided just for use by gdb maintainers. These commands are subject to frequent change, and may not be as well documented as user commands.internalsObscure features.obscureUser-defined aliases of other commands.User-defined commands. The commands in this class are those defined by the user. Use the "define" command to define a command.user-definedSupport facilities.Status inquiries.Specifying and examining files.Making program stop at certain points.Examining data.Examining the stack. The stack is made up of stack frames. Gdb assigns numbers to stack frames counting from zero for the innermost (currently executing) frame. At any time gdb identifies one frame as the "selected" frame. Variable lookups are done with respect to the selected frame. When the program being debugged stops, gdb selects the innermost frame. The commands below can be used to select other frames by number or address.Running the program.Print working directory. This is used for your program as well.Set working directory to DIR for debugger. The debugger's current working directory specifies where scripts and other files that can be loaded by GDB are located. In order to change the inferior's current working directory, the recommended way is to use the "set cwd" command.Print a constant string. Give string as argument. C escape sequences may be used in the argument. No newline is added at the end of the argument; use "\n" if you want a newline to be printed. Since leading and trailing whitespace are ignored in command arguments, if you want to print some you must use "\" before leading whitespace to be printed or after trailing whitespace.echoscript-extensionoff == no filename extension recognition (all sourced files are GDB scripts) soft == evaluate script according to filename extension, fallback to GDB script strict == evaluate script according to filename extension, error if not supportedShow mode for script filename extension recognition.Set mode for script filename extension recognition.Exit gdb. Usage: quit [EXPR] The optional expression EXPR, if present, is evaluated and the result used as GDB's exit code. The default is zero.Print list of commands.helpverboseShow verbosity.Set verbosity.Generic command for setting command history parameters.Generic command for showing command history parameters.Without an argument, history expansion is enabled.Show history expansion on command input.Set history expansion on command input.Generic command for showing things about the program being debugged.List the completions for the rest of the line as a command.Generic command for showing things about the debugger.Temporarily set SETTING to VALUE, run COMMAND, and restore SETTING. Usage: with SETTING [VALUE] [-- COMMAND] Usage: w SETTING [VALUE] [-- COMMAND] With no COMMAND, repeats the last executed command. SETTING is any setting you can change with the "set" subcommands. E.g.: with language pascal -- print obj with print elements unlimited -- print obj You can change multiple settings using nested with, and use abbreviations for commands and/or values. E.g.: w la p -- w p el u -- p objwith$_gdb_setting_str - returns the value of a GDB setting as a string. Usage: $_gdb_setting_str (setting) auto-boolean values are "off", "on", "auto". boolean values are "off", "on". Some integer settings accept an unlimited value, returned as "unlimited".$_gdb_setting - returns the value of a GDB setting. Usage: $_gdb_setting (setting) auto-boolean values are "off", "on", "auto". boolean values are "off", "on". Some integer settings accept an unlimited value, returned as 0 or -1 depending on the setting.$_gdb_maint_setting_str - returns the value of a GDB maintenance setting as a string. Usage: $_gdb_maint_setting_str (setting) auto-boolean values are "off", "on", "auto". boolean values are "off", "on". Some integer settings accept an unlimited value, returned as "unlimited".$_gdb_maint_setting - returns the value of a GDB maintenance setting. Usage: $_gdb_maint_setting (setting) auto-boolean values are "off", "on", "auto". boolean values are "off", "on". Some integer settings accept an unlimited value, returned as 0 or -1 depending on the setting.Show the history of commands you typed. You can supply a command number to start with, or a `+' to start after the previous command number shown.Show what version of GDB this is.Show how GDB was configured at build time.Generic command for setting gdb debugging flags.Generic command for showing gdb debugging flags.Execute the rest of the line as a shell command. With no arguments, run an inferior shell.Edit specified file or function. With no argument, edits file containing most recent line listed. Editing targets can be specified in these ways: FILE:LINENUM, to edit at that line in that file, FUNCTION, to edit at the beginning of that function, FILE:FUNCTION, to distinguish among like-named static functions. *ADDRESS, to edit at the line containing that address. Uses EDITOR environment variable contents as editor (or ex as default).editSend the output of a gdb command to a shell command. Usage: | [COMMAND] | SHELL_COMMAND Usage: | -d DELIM COMMAND DELIM SHELL_COMMAND Usage: pipe [COMMAND] | SHELL_COMMAND Usage: pipe -d DELIM COMMAND DELIM SHELL_COMMAND Executes COMMAND and sends its output to SHELL_COMMAND. The -d option indicates to use the string DELIM to separate COMMAND from SHELL_COMMAND, in alternative to |. This is useful in case COMMAND contains a | character. With no COMMAND, repeat the last executed command and send its output to SHELL_COMMAND.List specified function or line. With no argument, lists ten more lines after or around previous listing. "list -" lists the ten lines before a previous ten-line listing. One argument specifies a line, and ten lines are listed around that line. Two arguments with comma between specify starting and ending lines to list. Lines can be specified in these ways: LINENUM, to list around that line in current file, FILE:LINENUM, to list around that line in that file, FUNCTION, to list around beginning of that function, FILE:FUNCTION, to distinguish among like-named static functions. *ADDRESS, to list around the line containing that address. With two args, if one is empty, it stands for ten lines away from the other arg. By default, when a single location is given, display ten lines. This can be changed using "set listsize", and the current value can be shown using "show listsize".Disassemble a specified section of memory. Usage: disassemble[/m|/r|/s] START [, END] Default is the function surrounding the pc of the selected frame. With a /s modifier, source lines are included (if available). In this mode, the output is displayed in PC address order, and file names and contents for all relevant source files are displayed. With a /m modifier, source lines are included (if available). This view is "source centric": the output is in source line order, regardless of any optimization that is present. Only the main source file is displayed, not those of, e.g., any inlined functions. This modifier hasn't proved useful in practice and is deprecated in favor of /s. With a /r modifier, raw instructions in hex are included. With a single argument, the function surrounding that address is dumped. Two arguments (separated by a comma) are taken as a range of memory to dump, in the form of "start,end", or "start,+length". Note that the address is interpreted as an expression, not as a location like in the "break" command. So, for example, if you want to disassemble function bar in file foo.c you must type "disassemble 'foo.c'::bar" and not "disassemble foo.c:bar".Run the ``make'' program using the rest of the line as arguments.makeShow definitions of non-python/scheme user defined commands. Argument is the name of the user defined command. With no argument, show definitions of all user defined commands.Search for commands matching a REGEXP. Usage: apropos [-v] REGEXP Flag -v indicates to produce a verbose output, showing full documentation of the matching commands.aproposmax-user-call-depthShow the max call depth for non-python/scheme user-defined commands.Set the max call depth for non-python/scheme user-defined commands.trace-commandsWhen 'on', each command is displayed as it is executed.Show state of GDB CLI command tracing.Set tracing of GDB CLI commands.Define a new command that is an alias of an existing command. Usage: alias [-a] [--] ALIAS = COMMAND [DEFAULT-ARGS...] ALIAS is the name of the alias command to create. COMMAND is the command being aliased to. Options: %OPTIONS% GDB will automatically prepend the provided DEFAULT-ARGS to the list of arguments explicitly provided when using ALIAS. Use "help aliases" to list all user defined aliases and their default args. Examples: Make "spe" an alias of "set print elements": alias spe = set print elements Make "elms" an alias of "elements" in the "set print" command: alias -a set print elms = set print elements Make "btf" an alias of "backtrace -full -past-entry -past-main" : alias btf = backtrace -full -past-entry -past-main Make "wLapPeu" an alias of 2 nested "with": alias wLapPeu = with language pascal -- with print elements unlimited --Read commands from a file named FILE. Usage: source [-s] [-v] FILE -s: search for the script in the source search path, even if FILE contains directories. -v: each command in FILE is echoed as it is executed. Note that the file "%s" is read automatically in this way when GDB is started.The "pwd" command does not take an argument: %sError finding name of working directory: %sWorking directory %ps (canonically %ps). Working directory %ps. Missing arguments.Missing setting before '--' delimitervoid with_command_1(const char*, cmd_list_element*, const char*, int)set_cmd != nullptrCannot use this setting with the "with" commandCouldn't restore setting: %smake source command requires file name of file to source.void source_script_from_stream(FILE*, const char*, const char*)Already at the start of %s.Specified first line '%.*s' is ambiguous: Specified last line '%s' is ambiguous: Junk at end of line specification.Specified first and last lines are in different files.Two empty args do not say what lines to list.No source file for address %s.%s is in %s (%s:%d). %s is at %s:%d. No line number known for %s.No default source file yet. Do "help list"./bin/exNo default source file yet.Specified line is ambiguous: EDITOR%s +%d "%s"Indicates to use the specified delimiter string to separate COMMAND from SHELL_COMMAND, in alternative to |. This is useful in case COMMAND contains a | character.Specify that ALIAS is an abbreviation of COMMAND. Abbreviations are not used in command completion.Missing COMMANDMissing delimiter before SHELL_COMMANDMissing SHELL_COMMANDError launching "%s"shell command "%s" failed: %sKJKJKJoffsoftstrictUndefined %scommand: "%s". Try "help%s%.*s".cmd_list_element* add_alias_cmd(const char*, cmd_list_element*, command_class, int, cmd_list_element**)../../gdb/cli/cli-decode.ctarget != nullptrvoid print_doc_line(ui_file*, const char*, bool)p > strvoid fput_alias_definition_styled(cmd_list_element*, ui_file*)c->is_alias () alias -- subList of classes of %scommands: List of %scommands: Type "help%s" followed by a class name for a list of commands in that class. Type "help all" for the list of all commands. Type "help%s" followed by %scommand name full documentation. Type "apropos word" to search for commands related to "word". Type "apropos -v word" for full documentation of commands related to "word". Command name abbreviations are allowed if unambiguous. Warning: command '%ps' (%ps) is deprecated. Warning: '%ps', an alias for the command '%ps', is deprecated. Warning: command '%ps' is deprecated. Use '%ps'. No alternative known. Lack of needed %scommandAmbiguous %scommand "%s": %s.Argument must be preceded by space. Command class: %s Unclassified commands This command has a hook (or hooks) defined: This command is run after : %s (pre hook) This command is run before : %s (post hook) Invalid command,H2QkG,H2QwJ wbAppend Dump target code/data to a local file.Append target code/data to a local file.Write contents of memory to a raw binary file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in raw target ordered bytes.Write the value of an expression to a raw binary file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in raw target ordered bytes.Write target code/data to an srec file.Write target code/data to an intel hex file.ihexWrite target code/data to a verilog hex file.verilogWrite target code/data to a tekhex file.tekhexWrite target code/data to a raw binary file.Append target code/data to a raw binary file.Write contents of memory to an srec file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in srec format.Write the value of an expression to an srec file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in srec format.Write contents of memory to an ihex file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in intel hex format.Write the value of an expression to an ihex file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in intel hex format.Write contents of memory to a verilog hex file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in verilog hex format.Write the value of an expression to a verilog hex file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in verilog hex format.Write contents of memory to a tekhex file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in tekhex format.Write the value of an expression to a tekhex file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in tekhex format.Write contents of memory to a raw binary file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in binary format.Write the value of an expression to a raw binary file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in raw target ordered bytes.Append contents of memory to a raw binary file. Arguments are FILE START STOP. Writes the contents of memory within the range [START .. STOP) to the specified FILE in raw target ordered bytes.Append the value of an expression to a raw binary file. Arguments are FILE EXPRESSION. Writes the value of EXPRESSION to the specified FILE in raw target ordered bytes.Restore the contents of FILE to target memory. Arguments are FILE OFFSET START END where all except FILE are optional. OFFSET will be added to the base address of the file (default zero). If START and END are given, only the file contents within that range (file relative) will be restored to target memory.Missing filename.gdb::unique_xmalloc_ptr scan_filename(const char**, const char*)../../gdb/cli/cli-dump.cfilename != NULLFailed to open %s: %s.bfd_openw_or_error: %s.bfd_openw does not work with append.bfd_openw_or_error: unknown mode %s..newsecwriting dump file '%s' (%s)No value to %s.Invalid expression.value is not an lval: address assumed to be zeroMissing start address.Missing stop address.Invalid memory address range (start >= end).Start must be less than end.Restore file %s offset 0x%lx start 0x%lx end 0x%lx Failed to open %s: %sStart address is greater than length of binary file %s.Restoring binary file %s into memory (0x%lx to 0x%lx) restore: memory write failed (%s).'%s' is not a recognized file format.skipping section %s... Failed to read bfd file %s: '%s'.Restoring section %s (0x%lx to 0x%lx) into memory (%s to %s) binaryvoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {gdb_signal}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {int}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {enum_flags}]cli-interpFv10gdb_signalEl^bJFviEl^ cJFv10enum_flagsI23user_selected_what_flagEEl^cJ6interp^PcJPFv10gdb_signalE^`cJcJPFviE^cJcJPFv10enum_flagsI23user_selected_what_flagEE^cJHcJ^ddJXdJXdJ  X H cJ  D `   P  X H 15cli_interp_base^DdJXcJ10cli_interpThe logging output mode is %s. Whether logging overwrites or appends to the log file is %s. The current logfile is "%ps". Currently logging to %s. Turn the logging off and on to make the new setting effective.Set logging options.Show logging options.overwriteIf set, logging overrides the log file.Show whether logging overwrites or appends to the log file.Set whether logging overwrites or appends to the log file.If redirect is off, output will go to both the screen and the log file. If redirect is on, output will go only to the log file.Show the logging output mode.Set the logging output mode.debugredirectIf debug redirect is off, debug will go to both the screen and the log file. If debug redirect is on, debug will go only to the log file.Show the logging debug output mode.Set the logging debug output mode.The logfile is used when directing GDB's output.Show the current logfile.Set the current logfile.Enable logging.Disable logging.gdb.txtDone logging to %s. Already logging to %s. set loggingCopying output to %s. Redirecting output to %s. Copying debug output to %s. Redirecting debug output to %s. void gdb::option::save_option_value_in_ctx(gdb::optional&)../../gdb/cli/cli-option.cunhandled option typeNUMBER|unlimited[on|off] -void gdb::option::add_setshow_cmds_for_options(command_class, void*, gdb::array_view, cmd_list_element**, cmd_list_element**)option type not handledUnrecognized option at: %sAmbiguous option at: -%sValue given for `-%s' is not a boolean: %.*sNUMBER-%s requires an argumentgdb::optional gdb::option::parse_option(gdb::array_view, gdb::option::process_options_mode, bool, const char**, gdb::option::parse_option_completion_info*)option type not supportedyes-,H2QkJ_sYDO#OR~YControl nesting too deep!name of command to define"%s" is not a prefix command.Junk in argument list: "%s"Command "%s" is built-in.User-defined.if command requires an argument.while command requires an argument.define command requires an argument.document command requires an argument.command_line_up build_command_line(command_control_type, const char*)../../gdb/cli/cli-script.cloop_continueloop_breakwhile %sif %selsecommands %spythoncompile expressionguileMissing argument %ld in user function.$argUser %scommand "Document a user-defined command. Give command name as argument. Give documentation on following lines. End with a line of just "end".documentDefine a new command name. Command name is argument. Definition appears on following lines, one command per line. End with a line of just "end". Use the "document" command to give documentation for the new command. Commands defined in this way may accept an unlimited number of arguments accessed via $arg0 .. $argN. $argc tells how many arguments have been passed.Define or mark a command as a user-defined prefix command. User defined prefix commands can be used as prefix commands for other user defined commands. If the command already exists, it is changed to a prefix command.define-prefixExecute nested commands WHILE the conditional expression is non zero. The conditional expression must follow the word `while' and must in turn be followed by a new line. The nested commands must be entered one per line, and should be terminated by the word `end'.whileExecute nested commands once IF the conditional expression is non zero. The conditional expression must follow the word `if' and must in turn be followed by a new line. The nested commands must be entered one per line, and should be terminated by the word 'else' or `end'. If an else clause is used, the same rules apply to its nested commands as to the first ones.called with NULL file pointer!%s:%d: Error in sourced command file: %sRecursed on a simple control type.Error reading in canned sequence of commands.End with a line saying just "end".%s %s %s %s Keeping subcommands of prefix command "%s". Redefine command "%s"? Really redefine built-in command "%s"? Command "%s" not redefined.hook-hookpost-Your new `%s' command does not hook any existing command.Proceed? Type commands for definition of "%s".bad switchType documentation for "%s".document %sInvalid control type in canned commands structure.Error executing canned sequence of commands.Max user call depth exceeded -- command aborted.St19_Sp_counted_deleterIDn21command_lines_deleterSaIvELN9__gnu_cxx12_Lock_policyE2EE^vJBIdvJ~ ~  ~ ~ 00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899Junk after "%.*s": %sinteger to set it to, or "unlimited".integer to set it to.integer %s out of rangeonly -1 is allowed to set as unlimitedRequires an argument. Valid arguments are %s.Undefined item: "%.*s".Ambiguous item "%.*s".std::string get_setshow_command_value_string(const cmd_list_element*)../../gdb/cli/cli-setshow.cvoid do_show_command(const char*, int, cmd_list_element*)c->type == show_cmdshowlistoptionlistshow void do_set_command(const char*, int, cmd_list_element*)c->type == set_cmdfilename to set it to."on" or "off" expected."on", "off" or "auto" expected.Junk after item "%.*s": %sgdb internal error: bad var_type in do_setshow_commandSource code styling is enabled. Source code styling is disabled. CLI output styling is enabled. CLI output styling is disabled. int color_number(const char*)../../gdb/cli/cli-style.ccolor not foundbolddimThe "%s" style %s is: %s background colorforeground colorforegroundShow the foreground color for this property.Set the foreground color for this property.backgroundShow the background color for this property.Set the background color for this property.Show the display intensity for this property.Set the display intensity for this property.Style-specific settings. Configure various style-related variables, such as colorsIf enabled, output to the terminal is styled.Show whether CLI is enabled.Set whether CLI styling is enabled.If enabled, source code is styled. Source highlighting may be disabled in this installation of gdb, because it was not linked against GNU Source Highlight. However, it might still be available if the appropriate extension is available at runtime.Show whether source code styling is enabled.Set whether source code styling is enabled.Filename display styling. Configure filename colors and display intensity.Function name display styling. Configure function name colors and display intensityVariable name display styling. Configure variable name colors and display intensityAddress display styling. Configure address colors and display intensityTitle display styling. Configure title colors and display intensity Some commands (such as "apropos -v REGEXP") use the title style to improve readability.Highlight display styling. Configure highlight colors and display intensity Some commands use the highlight style to draw the attention to a part of their output.Metadata display styling. Configure metadata colors and display intensity The "metadata" style is used when GDB displays information about your data, for example ""TUI border display styling. Configure TUI border colors The "tui-border" style is used when GDB displays the border of a TUI window that does not have the focus.TUI active border display styling. Configure TUI active border colors The "tui-active-border" style is used when GDB displays the border of a TUI window that does have the focus.Version string display styling. Configure colors used to display the GDB version string.highlighttitletui-bordertui-active-bordermetadatablackgreenyellowbluemagentacyanwhiteui_file_style::color::color(int)../../gdb/ui-style.hc >= -1 && c <= 255HSJ6PYJ_JfJkJsJxJWzJzJHistory value must have integer type.Convenience variable $%s does not have integer value.Expected integer at: %sTrailing junk at: %sHistory value must have integer type. Convenience variable must have integer value. By default, the command will include non-debug symbols in the output; these can be excluded using the -n flag.%sIf NAMEREGEXP is provided, only prints the %s whose name matches NAMEREGEXP. If -t TYPEREGEXP is provided, only prints the %s whose type matches TYPEREGEXP. Note that the matching is done with the type printed by the 'whatis' command. By default, the command might produce headers and/or messages indicating why no %s can be printed. The flag -q disables the production of these headers and messages.%sinverted rangenegative valuevoid number_or_range_parser::setup_range(int, int, const char*)../../gdb/cli/cli-utils.cstart_value > 0Arguments must be numbers or '$' variables.Unrecognized option '%s' to %s command. Try "help %s".%s: -c and -s are mutually exclusiveCoff PE read debugging is %s. %s!%sUnable to find function "%s" in dll "%s", forward of "%s" in dll "%s" Adding forwarded exported symbol "%s" in dll "%s", pointing to "%s" sect_index_text not initializedUnknown section type for "%s" for entry "%s" in dll "%s" Adding exported symbol "%s" in dll "%s" pe-x86-64pei-x86-64pe-i386pei-i386pe-arm-wince-littlepei-arm-wince-little.textcoff-pe-readWhen set, debugging messages for coff reading of exported symbols are displayed.Show coff PE read debugging.Set coff PE read debugging..data.edataExport RVA for dll "%s" is in section "%s" Wrong value of export RVA for dll "%s": 0x%lx instead of 0x%lx DLL "%s" has %ld export entries, base=%ld Export name "%s" ord. %lu, RVA 0x%lx in dll "%s" not handled Finished reading "%s", exports %ld, forwards %ld, total %ld/%ld. ../../gdb/coffread.c%s: error reading symbols__fuSymbol table entry for %s has bad tagndx valueUnexpected type for symbol %s.stabstr.stabepoc-pe"%s": error reading line numbers."%s": can't get string table_globals_Bad n_sclass for symbol %scoff file name too longLI%LF%LC%LP%LPB%LBB%LBE%LPBX%.bf`.bf' symbol %d has no aux entry.efBad coff function information.`.ef' symbol without matching `.bf' symbol ignored starting at symnum %dUnmatched .ef symbol(s) ignored starting at symnum %d`.ef' symbol %d has no aux entryLine number pointer %s lower than start of line numbers.bb.eb`.eb' symbol without matching `.bb' symbol ignored starting at symnum %dMismatched .eb symbol ignored starting at symnum %d__imp_The debugging information in `%s' is corrupted. The file has a `.stabs' section, but no `.stabstr' section. .&3&& void c_add_code_footer::add_code_footer(compile_i_scope_types, ui_file*)../../gdb/compile/compile-c-support.cUnknown compiler scope reached.#ifndef %s # define %s %s #endif QIInvalid GCC mode size %d.struct __gdb_regs { __gdb_uintptr %sint %s __attribute__ ((__mode__(__%s__)))unsigned unsigned char %s[%s] __attribute__((__aligned__(__BIGGEST_ALIGNMENT__))) char _dummy; }; __gdb_prop_%sgcc_c_fe_contextlibcc1.sogcc_cp_fe_contextcould not find symbol %s in library %sThe loaded version of GCC does not support the required version of the API.typedef unsigned int __attribute__ ((__mode__(__pointer__))) __gdb_uintptr; typedef int __attribute__ ((__mode__(__pointer__))) __gdb_intptr; std::string compile_program::compute(const char*, const block*, CORE_ADDR) [with CompileInstanceType = compile_c_instance; PushUserExpressionPolicy = c_push_user_expression; PopUserExpressionPolicy = pop_user_expression_nop; AddCodeHeaderPolicy = c_add_code_header; AddCodeFooterPolicy = c_add_code_footer; AddInputPolicy = c_add_input; std::string = std::__cxx11::basic_string; CORE_ADDR = long long unsigned int]mode != NULLtypedef int __attribute__ ((__mode__(__%s__))) __gdb_int_%s; void _gdb_expr (struct __gdb_regs *__regs) { #include void _gdb_expr (struct __gdb_regs *__regs, void * __gdb_out_param) { void c_add_code_header::add_code_header(compile_i_scope_types, ui_file*)#pragma GCC user_expression #line 1 "gdb command line" __auto_type __gdb_expr_val = %s; typeof (%s) *__gdb_expr_ptr_type; memcpy (__gdb_out_param, %s__gdb_expr_val, sizeof (*__gdb_expr_ptr_type)); __builtin_addressofstd::string compile_program::compute(const char*, const block*, CORE_ADDR) [with CompileInstanceType = compile_cplus_instance; PushUserExpressionPolicy = cplus_push_user_expression; PopUserExpressionPolicy = cplus_pop_user_expression; AddCodeHeaderPolicy = cplus_add_code_header; AddCodeFooterPolicy = c_add_code_footer; AddInputPolicy = cplus_add_input; std::string = std::__cxx11::basic_string; CORE_ADDR = long long unsigned int]#include #include void _gdb_expr (struct __gdb_regs *__regs, void * __gdb_out_param) { void cplus_add_code_header::add_code_header(compile_i_scope_types, ui_file*)#pragma GCC push_user_expression auto __gdb_expr_val = %s; typedef std::add_pointer::type>::type __gdb_expr_ptr; __gdb_expr_ptr __gdb_expr_ptr_type; std::memcpy (__gdb_out_param, %s (__gdb_expr_val), sizeof (*__gdb_expr_ptr_type)); #pragma GCC pop_user_expression 16compile_instance^J18compile_c_instance^ؙJЙJ22compile_cplus_instance^JЙJЙJ J 0 J gcc_symbol_address "%s": full symbol gcc_symbol_address "%s": minimal symbol gcc_symbol_address "%s": failed Unsupported LOC_CONST_BYTES for symbol "%s".LOC_UNDEF found for "%s".../../gdb/compile/compile-c-symbols.cFortran common block is unsupported for compilation evaluaton of symbol "%s".Symbol "%s" cannot be used for compilation evaluation as it is optimized out.Symbol "%s" is thread-local and currently can only be referenced from the current thread in compiled code.Symbol "%s" cannot be used because there is no selected frameSymbol "%s" cannot be used for compilation evaluation as its address has not been found.void convert_one_symbol(compile_c_instance*, block_symbol, int, int)Unreachable case in convert_one_symbol.void gcc_convert_symbol(void*, gcc_c_context*, gcc_c_oracle_request, const char*)Unrecognized oracle request.gcc_convert_symbol "%s": global symbol gcc_convert_symbol "%s": local symbol gcc_convert_symbol "%s": lookup_symbol failed Local symbol unhandled when generating C code.void generate_c_for_for_one_variable(compile_instance*, string_file*, gdbarch*, std::vector&, CORE_ADDR, symbol*)LOC_COMPUTED variable missing a method.gcc_type convert_int(compile_c_instance*, type*)../../gdb/compile/compile-c-types.cTYPE_LENGTH (type) == 1array type with non-constant lower bound is not supportedcannot convert array type with non-zero lower bound to Cvariably-sized vector type is not supportedgcc_type convert_array(compile_c_instance*, type*)low_bound == 0function has unknown return type; assuming intvariable has unknown type; assuming intcannot convert gdb type to gcc type-std=gnu11 -fno-exceptions -Wno-implicit-function-declarationgot oracle request for address of %s found address for %s! did not find address for %s ../../gdb/compile/compile-cplus-symbols.cvoid convert_one_symbol(compile_cplus_instance*, block_symbol, bool, bool)got oracle request for "%s" minsymfound type for %s did not find type for %s gcc_cp_symbol_kind get_method_access_flag(const type*, int, int)../../gdb/compile/compile-cplus-types.c name = %s, symbol = %s push_namespacepush_classpush_functionreactivate_declpop_binding_levelget_current_binding_level_declmake_namespace_inlineadd_using_namespaceadd_namespace_aliasadd_using_declbuild_decldefine_cdtor_cloneget_decl_typeget_type_decladd_friendbuild_pointer_typebuild_reference_typebuild_pointer_to_member_typestart_template_declbuild_type_template_parameterbuild_template_template_parameterbuild_value_template_parameterbuild_dependent_typenamebuild_dependent_class_templatebuild_dependent_type_template_idbuild_dependent_exprbuild_literal_exprbuild_decl_exprbuild_unary_exprbuild_binary_exprbuild_ternary_exprbuild_unary_type_exprbuild_cast_exprbuild_expression_list_exprbuild_new_exprbuild_call_exprget_expr_typebuild_function_template_specializationbuild_class_template_specializationstart_class_typestart_closure_class_typebuild_fieldfinish_class_typestart_enum_typebuild_enum_constantfinish_enum_typebuild_function_typebuild_exception_spec_variantbuild_method_typeget_function_parameter_declbuild_lambda_exprget_int_typeget_char_typeget_float_typeget_void_typeget_bool_typeget_nullptr_typeget_nullptr_constantbuild_array_typebuild_dependent_array_typebuild_vla_array_typebuild_qualified_typebuild_complex_typebuild_vector_typebuild_constantadd_static_assert<%s> compile-cplus-typesWhen enabled debugging messages are printed during C++ type conversion for the compile commands.Show debugging of C++ compile type conversion.Set debugging of C++ compile type conversion.compile-cplus-scopesWhen enabled debugging messages are printed about definition scopes during C++ type conversion for the compile commands.Show debugging of C++ compile scopes.Set debugging of C++ compile scopes.entering new scope %s compile_cplus_instance::enter_scope(compile_scope&&)::SYMBOL_TYPE (comp.bsymbol.symbol)->code () == TYPE_CODE_NAMESPACE(anonymous namespace)staying in current scope -- scopes are identical leaving scope %s compile_cplus_instance::leave_scope()::identical scopes -- not leaving scope malformed TYPE_NAME during parsingcompile_scope compile_cplus_instance::new_scope(const char*, type*)scope.size () > 0static methodgcc_type compile_cplus_convert_reference(compile_cplus_instance*, type*)unexpected type code for reference typegcc_type compile_cplus_convert_array(compile_cplus_instance*, type*)gcc_type compile_cplus_convert_struct_or_union(compile_cplus_instance*, type*, gcc_cp_symbol_kind)pure virtual methodMethod %s appears to be optimized out. All references to this method will be undefined.field physaddrfield physnamevoid compile_cplus_convert_struct_or_union_members(compile_cplus_instance*, type*, gcc_type)unexpected static field location kindgcc_type compile_cplus_convert_int(compile_cplus_instance*, type*)unhandled TYPE_CODE %d-std=gnu++11%*s__gdb_stack[++__gdb_tos] = (__gdb_uintptr) %s; %*s__gdb_stack[__gdb_tos] = %*s__gdb_stack[__gdb_tos - 1] = %*s--__gdb_tos; %*s__gdb_stack[__gdb_tos + 1] = %*s++__gdb_tos; __label_%u_%svoid note_register(int, std::vector&)../../gdb/compile/compile-loc2c.cregnum >= 0Expression uses "cooked" register and cannot be compiled.(__gdb_uintptr) &__regs->%s__regs->%s + (__gdb_uintptr) %s%*s__attribute__ ((unused)) %s %s; %*s{ void compute_stack_depth_worker(int, int*, std::vector*, std::vector*, bfd_endian, unsigned int, const gdb_byte*, const gdb_byte*)(*info)[start].visitedinconsistent stack depthsunhandled DWARF op: %sop_ptr == op_end%*s%s = %s; %*s} %*s__gdb_uintptr __gdb_stack[%d]; %*s__gdb_uintptr __gdb_tmp; %*sint __gdb_tos = -1; :;/* %s */ DW_OP_regxNo block found for addressNo function found for block__frame_base_%ld__gdb_uintptr%s + %s__gdb_stack[__gdb_tos - %s]%*s__gdb_tmp = __gdb_stack[__gdb_tos - 1]; %*s__gdb_stack[__gdb_tos - 1] = __gdb_stack[__gdb_tos]; %*s__gdb_stack[__gdb_tos] = __gdb_tmp; __gdb_stack[__gdb_tos - 1]%*s__gdb_tmp = __gdb_stack[__gdb_tos]; %*s__gdb_stack[__gdb_tos] = __gdb_stack[__gdb_tos - 1]; %*s__gdb_stack[__gdb_tos - 1] = __gdb_stack[__gdb_tos -2]; %*s__gdb_stack[__gdb_tos - 2] = __gdb_tmp; Unsupported size %d in %s%*s__gdb_stack[__gdb_tos] = *((__gdb_int_%s *) __gdb_stack[__gdb_tos]); ((__gdb_intptr) __gdb_stack[__gdb_tos]) < 0 ? -__gdb_stack[__gdb_tos] : __gdb_stack[__gdb_tos]-__gdb_stack[__gdb_tos]~__gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos] + %s((__gdb_intptr) __gdb_stack[__gdb_tos-1]) / ((__gdb_intptr) __gdb_stack[__gdb_tos])((__gdb_intptr) __gdb_stack[__gdb_tos-1]) >> __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] & __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] - __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] % __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] * __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] | __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] + __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] << __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] >> __gdb_stack[__gdb_tos]__gdb_stack[__gdb_tos-1] ^ __gdb_stack[__gdb_tos](((__gdb_intptr) __gdb_stack[__gdb_tos-1]) <= ((__gdb_intptr) __gdb_stack[__gdb_tos]))(((__gdb_intptr) __gdb_stack[__gdb_tos-1]) >= ((__gdb_intptr) __gdb_stack[__gdb_tos]))(((__gdb_intptr) __gdb_stack[__gdb_tos-1]) == ((__gdb_intptr) __gdb_stack[__gdb_tos]))(((__gdb_intptr) __gdb_stack[__gdb_tos-1]) < ((__gdb_intptr) __gdb_stack[__gdb_tos]))(((__gdb_intptr) __gdb_stack[__gdb_tos-1]) > ((__gdb_intptr) __gdb_stack[__gdb_tos]))(((__gdb_intptr) __gdb_stack[__gdb_tos-1]) != ((__gdb_intptr) __gdb_stack[__gdb_tos]))__cfa_%ld%*sgoto %*sif ((( __gdb_intptr) __gdb_stack[__gdb_tos--]) != 0) goto %*s%s = __gdb_stack[__gdb_tos]; unsigned long Compiled module "%s" section "%s": unattached relocation: %s Compiled module "%s" section "%s": dangerous relocation: %s Cannot resolve relocation to "%s" from compiled module "%s" section "%s".Compiled module "%s" section "%s": warning: %sCompiled module "%s": multiple symbol definitions: %sCompile module: warning: %sCannot map compiled module "%s" section "%s": %svoid copy_sections(bfd*, asection*, void*)../../gdb/compile/compile-object-load.csect_data_got == sect_data.get ()Cannot write compiled module "%s" section "%s" to inferior memory range %s-%s.module "%s" section "%s" size %s prot %u allocated %s bytes at %s prot %u Inferior compiled module address %s is not aligned to BFD required %s."%s": could not open as compiled module: %s"%s": not in loadable format: %s"%s": not in object format.Cannot read symbols of compiled module "%s": %s_gdb_exprCannot find function "%s" in compiled module "%s".Invalid type code %d of function "%s" in compiled module "%s".invalid scope %dInvalid %d parameters of function "%s" in compiled module "%s".Invalid return type of function "%s" in compiled module "%s".Cannot parse symbols of compiled module "%s": %s_GLOBAL_OFFSET_TABLE_ELF symbol "%s" relocated to zero ELF mst_text symbol "%s" relocated to %s ELF mst_text_gnu_ifunc symbol "%s" relocated to %s Could not find symbol "%s" for compiled module "%s".%ld symbols were missing, cannot continue.Invalid type code %d of first parameter of function "%s" in compiled module "%s".Invalid type code %d of dereferenced first parameter of function "%s" in compiled module "%s".compile_module_up compile_object_load(const compile_file_names&, compile_i_scope_types, void*)regs_addr != 0allocated %s bytes at %s for registers _dummyInvalid register "%s" position %s bits or size %s bitsInvalid register "%s" type code %dRegister "%s" is optimized out.Register "%s" is not available.Cannot write register "%s" to inferior memory at %s.__gdb_expr_valNo "%s" symbol found__gdb_expr_ptr_typeType of "%s" is not a pointerExpected address scope in compiled module "%s".Invalid type code %d of symbol "%s" in compiled module "%s".Referenced types do not match for symbols "%s" and "%s" in compiled module "%s".allocated %s bytes at %s for printed value D $  ̦ Ц h void compile_object_run(compile_module_up&&)../../gdb/compile/compile-object-run.cfunc_type->code () == TYPE_CODE_FUNCdata->module->out_value_addr != 0current_arg == func_type->num_fields ()!dtor_found && executed!(dtor_found && executed)Compile command GCC driver filename is "%s". Compile command command-line arguments are "%s". Compile debugging is %s. /tmp/gdbobj-void do_rmdir(void*)../../gdb/compile/compile.cstartswith (dir, TMP_PREFIX)rm -rf Could not remove temporary directory %sUnexpected type id from GCC, check you use recent enough GCC.__%sInvalid register name "%s".Cannot find gdbarch register "%s".Command to compile source code and inject it into the inferior.Compile, inject, and execute code. Usage: compile code [OPTION]... [CODE] Options: %OPTIONS% The source code may be specified as a simple one line expression, e.g.: compile code printf("Hello world\n"); Alternatively, you can type a multiline expression by invoking this command with no argument. GDB will then prompt for the expression interactively; type a line containing "end" to indicate the end of the expression.Evaluate a file containing source code. Usage: compile file [OPTION].. [FILENAME] Options: %OPTIONS%Evaluate EXPR by using the compiler and print result. Usage: compile print [[OPTION]... --] [/FMT] [EXPR] Options: %OPTIONS% Note: because this command accepts arbitrary expressions, if you specify any command option, you must use a double dash ("--") to mark the end of option processing. E.g.: "compile print -o -- myobj". The expression may be specified on the same line as the command, e.g.: compile print i Alternatively, you can type a multiline expression by invoking this command with no argument. GDB will then prompt for the expression interactively; type a line containing "end" to indicate the end of the expression. EXPR may be preceded with /FMT, where FMT is a format letter but no count or size letter (see "x" command).When on, compile command debugging is enabled.Show compile command debugging.Set compile command debugging.compile-argsUse options like -I (include file directory) or ABI settings. String quoting is parsed like in shell, for example: -mno-align-double "-I/dir with a space/include"Show compile command GCC command-line arguments.Set compile command GCC command-line arguments.-O0 -gdwarf-4 -fPIE -Wall -Wno-unused-but-set-variable -Wno-unused-variable -fno-stack-protectorcompile-gccIt should be absolute filename of the gcc executable. If empty the default target triplet will be searched in $PATH.Show compile command GCC driver filename.Set compile command GCC driver filename.The program must be running for the compile command to work.No compiler support for language %s.Neither a simple expression, or a multi-line specified.debug output: %sCommand 'set compile-gcc' requires GCC version 6 or higher (libcc1 interface version 1 or higher)(-[^-]*)?--fpreprocessedPassing %d compiler options: Compiler option %d: <%s> /tmp/gdbobj-XXXXXXCould not make temporary directory%s%sout%d.c%s%sout%d.oCould not open source file for writingCould not write to source filesource file produced: %s Compilation failed.object file produced: %s void eval_compile_command(command_line*, const char*, compile_i_scope_types, void*)scope == COMPILE_I_PRINT_ADDRESS_SCOPEcompile printYou must provide a filename for this command.#include "%s" Suppress automatic 'void _gdb_expr () { CODE }' wrapping.gdb::unlinker::unlinker(const char*)../../gdb/../gdbsupport/gdb_unlinker.hMax number of complaints about incorrect symbols is %s. complaintsShow max number of complaints about incorrect symbols.Set max number of complaints about incorrect symbols.During symbol reading: --More--void complete_line_internal_1(completion_tracker&, const char*, const char*, int, complete_line_internal_reason)../../gdb/completer.ctext == NULLchar* gdb_completion_word_break_characters_throw()tracker.custom_word_point () > 0rl_point >= 0 && rl_point < strlen (rl_line_buffer)const char* completion_find_completion_word(completion_tracker&, const char*, int*)void complete_nested_command_line(completion_tracker&, const char*)tracker.use_custom_word_point ()*** List may be truncated, max-completions reached. ***void gdb_display_match_list(char**, int, int, const match_list_displayer*)max_completions != 0len <= max_completionsDisplay all %d possibilities? (y or n)max-completionsUse this to limit the number of candidates considered during completion. Specifying "unlimited" or -1 disables limiting. Note that setting either no limit or a very large limit can make completion slow.Show maximum number of completion candidates.Set maximum number of completion candidates.Max completions reached.void reg_or_group_completer_1(completion_tracker&, const char*, const char*, reg_completer_targets)(targets & (complete_register_names | complete_reggroup_names)) != 0void collect_explicit_location_matches(completion_tracker&, event_location*, explicit_location_match_type, const char*, const language_defn*)unhandled explicit_location_match_type-probe-probe-stap-probe-dtrace-qualified-label *|"';:?>< !@#$%^&*()+=|~`}{[]"';:?/><,'JJJvP]8IJOJ 15. Disclaimer of Warranty. THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. Limitation of Liability. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 17. Interpretation of Sections 15 and 16. If the disclaimer of warranty and limitation of liability provided above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely approximates an absolute waiver of all civil liability in connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a fee. GNU GENERAL PUBLIC LICENSE Version 3, 29 June 2007 Copyright (C) 2007 Free Software Foundation, Inc. Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The GNU General Public License is a free, copyleft license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. We, the Free Software Foundation, use the GNU General Public License for most of our software; it applies also to any other work released this way by its authors. You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute copies of the software, or if you modify it: responsibilities to respect the freedom of others. For example, if you distribute copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. Developers that use the GNU GPL protect your rights with two steps: (1) assert copyright on the software, and (2) offer you this License giving you legal permission to copy, distribute and/or modify it. For the developers' and authors' protection, the GPL clearly explains that there is no warranty for this free software. For both users' and authors' sake, the GPL requires that modified versions be marked as changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are designed to deny users access to install or run modified versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of protecting users' freedom to change the software. The systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the GPL to prohibit the practice for those products. If such problems arise substantially in other domains, we stand ready to extend this provision to those domains in future versions of the GPL, as needed to protect the freedom of users. Finally, every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. To prevent this, the GPL assures that patents cannot be used to render the program non-free. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS 0. Definitions. "This License" refers to version 3 of the GNU General Public License. "Copyright" also means copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any copyrightable work licensed under this License. Each licensee is addressed as "you". "Licensees" and "recipients" may be individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring copyright permission, other than the making of an exact copy. The resulting work is called a "modified version" of the earlier work or a work "based on" the earlier work. A "covered work" means either the unmodified Program or a work based on the Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily liable for infringement under applicable copyright law, except executing it on a computer or modifying a private copy. Propagation includes copying, distribution (with or without modification), making available to the public, and in some countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or receive copies. Mere interaction with a user through a computer network, with no transfer of a copy, is not conveying. An interactive user interface displays "Appropriate Legal Notices" to the extent that it includes a convenient and prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty for the work (except to the extent that warranties are provided), that licensees may convey the work under this License, and how to view a copy of this License. If the interface presents a list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work for making modifications to it. "Object code" means any non-source form of a work. A "Standard Interface" means an interface that either is an official standard defined by a recognized standards body, or, in the case of interfaces specified for a particular programming language, one that is widely used among developers working in that language. The "System Libraries" of an executable work include anything, other than the work as a whole, that (a) is included in the normal form of packaging a Major Component, but which is not part of that Major Component, and (b) serves only to enable use of the work with that Major Component, or to implement a Standard Interface for which an implementation is available to the public in source code form. A "Major Component", in this context, means a major essential component (kernel, window system, and so on) of the specific operating system (if any) on which the executable work runs, or a compiler used to produce the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an executable work) run the object code and to modify the work, including scripts to control those activities. However, it does not include the work's System Libraries, or general-purpose tools or generally available free programs which are used unmodified in performing those activities but which are not part of the work. For example, Corresponding Source includes interface definition files associated with source files for the work, and the source code for shared libraries and dynamically linked subprograms that the work is specifically designed to require, such as by intimate data communication or control flow between those subprograms and other parts of the work. The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is that same work. 2. Basic Permissions. All rights granted under this License are granted for the term of copyright on the Program, and are irrevocable provided the stated conditions are met. This License explicitly affirms your unlimited permission to run the unmodified Program. The output from running a covered work is covered by this License only if the output, given its content, constitutes a covered work. This License acknowledges your rights of fair use or other equivalent, as provided by copyright law. You may make, run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in force. You may convey covered works to others for the sole purpose of having them make modifications exclusively for you, or provide you with facilities for running those works, provided that you comply with the terms of this License in conveying all material for which you do not control copyright. Those thus making or running the covered works for you must do so exclusively on your behalf, under your direction and control, on terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the conditions stated below. Sublicensing is not allowed; section 10 makes it unnecessary. 3. Protecting Users' Legal Rights From Anti-Circumvention Law. No covered work shall be deemed part of an effective technological measure under any applicable law fulfilling obligations under article 11 of the WIPO copyright treaty adopted on 20 December 1996, or similar laws prohibiting or restricting circumvention of such When you convey a covered work, you waive any legal power to forbid circumvention of technological measures to the extent such circumvention is effected by exercising rights under this License with respect to the covered work, and you disclaim any intention to limit operation or modification of the work as a means of enforcing, against the work's users, your or third parties' legal rights to forbid circumvention of technological measures. 4. Conveying Verbatim Copies. You may convey verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice; keep intact all notices stating that this License and any non-permissive terms added in accord with section 7 apply to the code; keep intact all notices of the absence of any warranty; and give all recipients a copy of this License along with the Program. You may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. Conveying Modified Source Versions. You may convey a work based on the Program, or the modifications to produce it from the Program, in the form of source code under the terms of section 4, provided that you also meet all of these conditions: a) The work must carry prominent notices stating that you modified it, and giving a relevant date. b) The work must carry prominent notices stating that it is released under this License and any conditions added under section 7. This requirement modifies the requirement in section 4 to "keep intact all notices". c) You must license the entire work, as a whole, under this License to anyone who comes into possession of a copy. This License will therefore apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they are packaged. This License gives no permission to license the work in any other way, but it does not invalidate such permission if you have separately received it. d) If the work has interactive user interfaces, each must display Appropriate Legal Notices; however, if the Program has interactive interfaces that do not display Appropriate Legal Notices, your work need not make them do so. A compilation of a covered work with other separate and independent works, which are not by their nature extensions of the covered work, and which are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the compilation's users beyond what the individual works permit. Inclusion of a covered work in an aggregate does not cause this License to apply to the other parts of the aggregate. 6. Conveying Non-Source Forms. You may convey a covered work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable Corresponding Source under the terms of this License, in one of these ways: a) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by the Corresponding Source fixed on a durable physical medium customarily used for software interchange. b) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product that is covered by this License, on a durable physical medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c) Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d) Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no further charge. You need not require recipients to copy the Corresponding Source along with the object code. If the place to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions next to the object code saying where to find the Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e) Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose source code is excluded from the Corresponding Source as a System Library, need not be included in conveying the object code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a dwelling. In determining whether a product is a consumer product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or expects or is expected to use, the product. A product is a consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, unless such uses represent the only significant mode of use of the product. "Installation Information" for a User Product means any methods, procedures, authorization keys, or other information required to install and execute modified versions of a covered work in that User Product from a modified version of its Corresponding Source. The information must suffice to ensure that the continued functioning of the modified object code is in no case prevented or interfered with solely because modification has been made. If you convey an object code work under this section in, or with, or specifically for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for a fixed term (regardless of how the transaction is characterized), the Corresponding Source conveyed under this section must be accompanied by the Installation Information. But this requirement does not apply if neither you nor any third party retains the ability to install modified object code on the User Product (for example, the work has been installed in ROM). The requirement to provide Installation Information does not include a requirement to continue to provide support service, warranty, or updates for a work that has been modified or installed by the recipient, or for the User Product in which it has been modified or installed. Access to a network may be denied when the modification itself materially and adversely affects the operation of the network or violates the rules and protocols for communication across the network. Corresponding Source conveyed, and Installation Information provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that supplement the terms of this License by making exceptions from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as though they were included in this License, to the extent that they are valid under applicable law. If additional permissions apply only to part of the Program, that part may be used separately under those permissions, but the entire Program remains governed by this License without regard to the additional permissions. When you convey a copy of a covered work, you may at your option remove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in certain cases when you modify the work.) You may place additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright permission. Notwithstanding any other provision of this License, for material you add to a covered work, you may (if authorized by the copyright holders of that material) supplement the terms of this License with terms: a) Disclaiming warranty or limiting liability differently from the terms of sections 15 and 16 of this License; or b) Requiring preservation of specified reasonable legal notices or author attributions in that material or in the Appropriate Legal Notices displayed by works containing it; or c) Prohibiting misrepresentation of the origin of that material, or requiring that modified versions of such material be marked in reasonable ways as different from the original version; or d) Limiting the use for publicity purposes of names of licensors or authors of the material; or e) Declining to grant rights under trademark law for use of some trade names, trademarks, or service marks; or f) Requiring indemnification of licensors and authors of that material by anyone who conveys the material (or modified versions of it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "further restrictions" within the meaning of section 10. If the Program as you received it, or any part of it, contains a notice stating that it is governed by this License along with a term that is a further restriction, you may remove that term. If a license document contains a further restriction but permits relicensing or conveying under this License, you may add to a covered work material governed by the terms of that license document, provided that the further restriction does not survive such relicensing or conveying. If you add terms to a covered work in accord with this section, you must place, in the relevant source files, a statement of the additional terms that apply to those files, or a notice indicating where to find the applicable terms. Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as exceptions; the above requirements apply either way. 8. Termination. You may not propagate or modify a covered work except as expressly provided under this License. Any attempt otherwise to propagate or modify it is void, and will automatically terminate your rights under this License (including any patent licenses granted under the third paragraph of section 11). However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same material under section 10. 9. Acceptance Not Required for Having Copies. You are not required to accept this License in order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a copy likewise does not require acceptance. However, nothing other than this License grants you permission to propagate or modify any covered work. These actions infringe copyright if you do not accept this License. Therefore, by modifying or propagating a covered work, you indicate your acceptance of this License to do so. 10. Automatic Licensing of Downstream Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to this License. You are not responsible for enforcing compliance by third parties with this License. An "entity transaction" is a transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, or merging organizations. If propagation of a covered work results from an entity transaction, each party to that transaction who receives a copy of the work also receives whatever licenses to the work the party's predecessor in interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or can get it with reasonable efforts. You may not impose any further restrictions on the exercise of the rights granted or affirmed under this License. For example, you may not impose a license fee, royalty, or other charge for exercise of rights granted under this License, and you may not initiate litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright holder who authorizes use under this License of the Program or a work on which the Program is based. The work thus licensed is called the contributor's "contributor version". A contributor's "essential patent claims" are all patent claims owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by some manner, permitted by this License, of making, using, or selling its contributor version, but do not include claims that would be infringed only as a consequence of further modification of the contributor version. For purposes of this definition, "control" includes the right to grant patent sublicenses in a manner consistent with the requirements of Each contributor grants you a non-exclusive, worldwide, royalty-free patent license under the contributor's essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify and propagate the contents of its contributor version. In the following three paragraphs, a "patent license" is any express agreement or commitment, however denominated, not to enforce a patent (such as an express permission to practice a patent or covenant not to sue for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not to enforce a patent against the party. If you convey a covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone to copy, free of charge and under the terms of this License, through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to deprive yourself of the benefit of the patent license for this particular work, or (3) arrange, in a manner consistent with the requirements of this License, to extend the patent license to downstream recipients. "Knowingly relying" means you have actual knowledge that, but for the patent license, your conveying the covered work in a country, or your recipient's use of the covered work in a country, would infringe one or more identifiable patents in that country that you have reason to believe are valid. If, pursuant to or in connection with a single transaction or arrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a specific copy of the covered work, then the patent license you grant is automatically extended to all recipients of the covered work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its coverage, prohibits the exercise of, or is conditioned on the non-exercise of one or more of the rights that are specifically granted under this License. You may not convey a covered work if you are a party to an arrangement with a third party that is in the business of distributing software, under which you make payment to the third party based on the extent of your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in connection with specific products or compilations that contain the covered work, unless you entered into that arrangement, or that patent license was granted, prior to 28 March 2007. Nothing in this License shall be construed as excluding or limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent law. 12. No Surrender of Others' Freedom. If conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot convey a covered work so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not convey it at all. For example, if you agree to terms that obligate you to collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those terms and this License would be to refrain entirely from conveying the Program. 13. Use with the GNU Affero General Public License. Notwithstanding any other provision of this License, you have permission to link or combine any covered work with a work licensed under version 3 of the GNU Affero General Public License into a single combined work, and to convey the resulting work. The terms of this License will continue to apply to the part which is the covered work, but the special requirements of the GNU Affero General Public License, section 13, concerning interaction through a network will apply to the combination as such. 14. Revised Versions of this License. The Free Software Foundation may publish revised and/or new versions of the GNU General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies that a certain numbered version of the GNU General Public License "or any later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of the GNU General Public License, you may choose any version ever published by the Free Software Foundation. If the Program specifies that a proxy can decide which future versions of the GNU General Public License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Program. Later license versions may give you additional or different permissions. However, no additional obligations are imposed on any author or copyright holder as a result of your choosing to follow a later version. Conditions for redistributing copies of GDB.copyingVarious kinds of warranty you do not have.warrantyThe current BFD target is "%s". core file may not match specified executable file.exec file is newer than core file.No executable file specified. Use the "file" or "exec-file" command.Cannot access memory at address %sMemory at address %s unavailable.unhandled target_xfer_status: %s (%s)../../gdb/corefile.cUse FILE as core dump for examining memory and registers. Usage: core-file FILE No arg means have no core file. This command has been superseded by the `target core' and `detach' commands.gnutargetUse `set gnutarget auto' to specify automatic detection.Show the current BFD target.Set the current BFD target.GNUTARGETCan't fetch registers from this type of core file No core file now. .auxvCouldn't read NT_AUXV note in core file..wcookieCouldn't read StackGhost cookie in core file.Mapped address spaces: Size End AddrStart Addr %10s %10s %10s %10s %s Offset %18s %18s %10s %10s %s Print core file's file-backed mappings.core-file-backed-mappings

void core_target::get_core_register_section(regcache*, const regset*, const char*, int, const char*, bool)../../gdb/corelow.c%s/%ldCouldn't find %s registers in core file.Section `%s' in core file too small.Unexpected size of section `%s' in core file.Couldn't read %s registers from `%s' section in core file.general-purposevoid get_core_registers_cb(const char*, int, int, const regset*, const char*, void*).gdb-tdesc"%s": Core file format not supportedr+bNo core file specified. (Use `detach' to stop debugging a core file.)No core file specified."%s" is not a core dump: %s.reg/Core was generated by `%s'. Program terminated with signal %s, %svoid core_file_command(const char*, int)core_bfd == NULLcore_target::build_file_mappings()::filename != nullptrCan't open file %s during file-backed mapping note processingCan't open file %s which was expanded to %s during file-backed mapping note processingCan't make sectionLocal core dump fileUse a core file as a target. Specify the filename of the core file.ȭP_K_K^bK($''@?( @((A(0B(8C(@D(TE(\F(la (H($'((E J(@O K(HG M(TO(O(P(8Q(Q(R(S(T(e E E E e U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b(H Xf(8g(g(h(U 0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(,'@'@'T'd't''F {(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(w11core_targetThe available C++ ABIs are: cp-abi-listcp-abidocCould not find "%s" in ABI listThe currently selected C++ ABI is "" (longnameABI doesn't define required function is_constructor_nameABI doesn't define required function is_destructor_nameABI doesn't define required function is_vtable_nameABI doesn't define required function is_operator_nameint baseclass_offset(type*, int, const gdb_byte*, LONGEST, CORE_ADDR, const value*)../../gdb/cp-abi.ccurrent_cp_abi.baseclass_offset != NULLCannot determine virtual baseclass offset of incomplete objectGDB does not support pointers to methods on this targetGDB cannot print the vtable on this targetGDB cannot find the typeid on this targetGDB cannot find the type for 'typeid' on this targetGDB cannot find the type from a std::type_info on this targetGDB cannot find the type name from a std::type_info on this targetToo many C++ ABIs, please increase CP_ABI_MAX in cp-abi.cCannot find C++ ABI "%s" to set it as auto default.Automatically selected; currently "%s"Set the ABI used for inspecting C++ objects. "set cp-abi" with no arguments will list the available ABIs.Show the ABI used for inspecting C++ objects.demangle_component* cpname_state::fill_comp(demangle_component_type, demangle_component*, demangle_component*)cp-name-parser.ydemangle_component* cpname_state::make_operator(const char*, int)demangle_component* cpname_state::make_dtor(gnu_v3_dtor_kinds, demangle_component*)demangle_component* cpname_state::make_builtin_type(const char*)demangle_component* cpname_state::make_name(const char*, int)unsigned intunsigned longunsigned shortunsigned long longempty character constantinvalid character constant-in-invalid numberunexpected string literalinvalid characterconstruction vtable for covariant return thunk to reference temporary for typeinfo for typeinfo fn for typeinfo name for global constructors keyed to global destructors keyed to guard variable for VTT for non-virtual thunk to delete delete[] sizeof ELLIPSISDEMANGLER_SPECIALCONSTRUCTION_VTABLECONSTRUCTION_INstart_optdemangler_specialconversion_opconversion_op_nameunqualified_namecolon_namecolon_ext_namecolon_ext_onlyext_only_namenested_nametempltemplate_paramstemplate_argfunction_argsfunction_arglistqualifiers_optqualifiersint_partint_seqbuiltin_typearray_indicatortypespec_2direct_abstract_declaratorabstract_declarator_fndirect_declaratordirect_declarator_1abefnrtv NLGY\LGJ4+5,:EF0/G  !"#$%&'(-.236789@ABCc' 'E''yI.`# *g''/. *'4|5*I=c5F Uaa =EW=E4\}G=ya=GFv{)=}}n ==GGtttvGG4(}}I:;< 4 4}4FF!)*)F)CD )))5)5).5)III)N)))U*=>?%^CDa#a}  "&{&,U\&f;<=>?7CDvZ op !"$%,-./0123416789;<=>?<CDGHI2346789;<=>?CD & !"$%1 <GHI$%$% 1<< !"GHIGHI  !"#*+-./0123456789;<=>?ABCEGHI  !").1= EI !" &' !"&' GI  GI..11 .1==.1EE=GIIE=G I.E1GI46789=;<=>?ECDI.1= EI !" &' !"#)*+G-./0123456789;<=>?ABCEGHI,-./012346789;<=>?CD J !"  !",-./0123456789;<=>?CD./012346789;<=>?CD/012346789;<=>?CD012346789;<=>?CD12346789;<=>?CD89;<=>?CD ,.-g+yacj|P [~}fj^hShoix{uThQR,hh)zhU u uflac"#$*y^j}-h*x{?@Aj zq^() ,i,^Vj^^ _k   !x{*~0^/13k29:O; z<= ^kBC+ Dr _p x{x{ 56e zmzsk'8-.4^_>k_k___k/_ _ k/&_ n /01 23456789:;<=>?@ABCDEFGHIJKLM XYZ[   VWtututuVXXYYXYZZXY[[Z\vV[ZX[YZ[\XYZ[  /01 23456789:;<=>?@ABCDEFGHIJKLM/7 % /  ;a`cd_\[ikZmhbl52Cz@=]egvD4~A +('#$%&!")*-0j 7poX  y:1B8?IKO}3,/.nYsmXPX EG{w9 MHL6XtXWXQqJrVUTRNS\\`bdijqz #$*,-/2367;=@DIMVZ]himoqtx}    %,0;ASV^`krsy} &*.26:>BFJNRVZ^bfkosz~  !"&'GLMOPQRSTVXYZ[abcdehl 4RVYZ #*+-./0123456789;<=>?ABCEGHIZhMM4 .1=EINZ[_fgjkbI_RT[ b Vecb IUVWXZ_fijop $%1?CDFFM5=FZ)`)*i)`Z bIWfmn llllMIM)5)]qqqqqqqqqqqqqqqqqq```hMmm)_gMM)555)MqqJi)III)qrrr)))KLMMMNNOOOOOPPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRSSSSTTTUUVVVVWWXXYYZZZZ[\\]]]]]^^^^^___``aaabbccccccddeeeeeeefffffgghhhhhhhhhhhhiiijjjjkkkkkllmmnnnnooooopppppqrrrrqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqEEEEEEEEdEEEEF]wN!`"#$%&b'd(The `maint namespace' command was removed. Deprecated placeholder for removed functionality.cp_lookup_nested_symbol (%s, %s, %s, %s) cp_lookup_nested_symbol (...) = %s cp_lookup_nested_symbol (...) = NULL (func/method) cp_lookup_nested_symbol called on a non-aggregate type.../../gdb/cp-namespace.cblock_symbol cp_lookup_bare_symbol(const language_defn*, const char*, const block*, domain_enum, int)strstr (name, "::") == NULLblock_symbol lookup_namespace_scope(const language_defn*, const char*, const block*, domain_enum, const char*, int)scope[new_scope_len] == ':'cp_lookup_symbol_imports_or_template (%s, %s, %s, %s) cp_lookup_symbol_imports_or_template (...) = %s basic_string::erasecp_lookup_symbol_namespace (%s, %s, %s, %s) cp_lookup_symbol_namespace (...) = %s cp_lookup_symbol_non_local (%s, %s (scope %s), %s) cp_lookup_symbol_nonlocal (...) = %s demangle_component* unqualified_name_from_comp(demangle_component*)../../gdb/cp-support.clast_template == NULLunexpected demangled name '%s'unable to demangle '%s' (demangler failed with signal %d)%s:%d: %s: %sdemangler-warning%s Attempting to dump core. unsigned int cp_entire_prefix_len(const char*)name[current_len] == ':'RTTI symbol not found for class '%s'RTTI symbol for class '%s' is not a typeRTTI symbol for class '%s' is a namespaceRTTI symbol for class '%s' has bad typebool (* cp_get_symbol_name_matcher(const lookup_name_info&))(const char*, const lookup_name_info&, completion_match_result*)C++ maintenance commands.Print the first class/namespace component of NAME.first_componentShow the virtual function table for a C++ object. Usage: info vtbl EXPRESSION Evaluate EXPRESSION and display the virtual function table for the resulting object.vtblcatch-demangler-crashesIf enabled GDB will attempt to catch demangler crashes and display the offending symbol.Show whether to attempt to catch demangler crashes.Set whether to attempt to catch demangler crashes.internal error: string "%s" failed to be canonicalizedgdb::unique_xmalloc_ptr cp_canonicalize_string_full(const char*, const char* (*)(type*, void*), void*)bool cp_symbol_name_matches_1(const char*, const char*, size_t, strncmp_iw_mode, completion_match_result*)sname[len] == ':'std::istreamstd::iostreamstd::ostreamstd::string^K1K>KLKYK*Z12gdb_demanglePKciEUlvE_members of __vtbl_ptr_typeAn internal GDB problem: ctf_ id_t %ld type already setctf_type_encoding read_base_type failed - %sctf_type_aname read_base_type failed - %sread_base_type: unsupported base kind (%d)bug: psymtab for %s is already read in.Reading in CTF data for %s...../../gdb/ctfread.cdone. ctf_bfdopen failed on %s - %sctf_dict_open failed on %s - %sctf_type_iter scan_partial_symbols failed - %sctf_variable_iter scan_partial_symbols failed - %sctf_enum_next ctf_psymtab_add_enums failed - %sctf_member_iter process_struct_members failed - %sctf_add_var_cb: %s has NO type (%ld)ctf_add_var_cb: kind unsupported (%d)read_restrict_type: NULL base type (%ld)ctf_enum_iter process_enum_type failed - %sctf_array_info read_array_type failed - %sread_pointer_type: NULL target type (%ld)ctf_add_member_cb: %s has NO type (%ld)read_const_type: NULL base type (%ld)read_volatile_type: NULL base type (%ld)virtual void ctf_psymtab::expand_psymtab(objfile*)!readinctf_type_iter psymtab_to_symtab failed - %sctf_variable_iter psymtab_to_symtab failed - %s14partial_symtab^-K16standard_psymtab^HK@KSt15_Sp_counted_ptrIP15psymtab_storageLN9__gnu_cxx12_Lock_policyE2EE^hKBI@KK- -(-$--(K/0 x),,11ctf_psymtab^K\KInvalid character '%c' in expressionint d_yylex()d-exp.yNo symbol table is loaded. Use the "file" command%.*s.%.*sint d_parse(parser_state*)!issuperdelegateinterface^^^^=IDENTIFIERUNKNOWN_NAMEINTEGER_LITERALFLOAT_LITERALCHARACTER_LITERALSTRING_LITERALTRUE_KEYWORDFALSE_KEYWORDNULL_KEYWORDSUPER_KEYWORDCAST_KEYWORDSIZEOF_KEYWORDTYPEOF_KEYWORDTYPEID_KEYWORDINIT_KEYWORDIMMUTABLE_KEYWORDSHARED_KEYWORDSTRUCT_KEYWORDUNION_KEYWORDCLASS_KEYWORDINTERFACE_KEYWORDENUM_KEYWORDTEMPLATE_KEYWORDDELEGATE_KEYWORDFUNCTION_KEYWORDHATHATNOTIDENTITYCommaExpressionAssignExpressionConditionalExpressionOrOrExpressionAndAndExpressionXorExpressionCmpExpressionEqualExpressionIdentityExpressionRelExpressionShiftExpressionAddExpressionMulExpressionUnaryExpressionCastExpressionPowExpressionPostfixExpressionArgumentListArgumentList_optCallExpressionIndexExpressionSliceExpressionPrimaryExpressionArrayLiteralIdentifierExpStringExpTypeExpBasicType2BasicTypeN4expr23tuple_holding_operationIJbEEE^ KpLN4expr14bool_operationE^TKHKN4expr22ternop_slice_operationE^xKGN4expr15binop_operationIL10exp_opcode24EXadL_Z14eval_op_binaryP4typeP10expression6nosideS1_P5valueS8_EEEE^KTPGlKaa0cDȕdaaaa`KpccbDȕd//a,/`Kde8bDȕd@aH`K"ugI"ygI"fgI"igI"lgI"ogI"rgI"gI" }gI" K" I.7EJ/4gI$7gI#K++gI)3N*.gI%1gI&vgI'zgI(I0G,ǙK-`SRVV˙KXjG OOgIgIWљKN bQzbH#VSڙK RLVNLGY\LGKKeI,hIJhIKK!K3K|\VVBKOK]KjKxKKKKKKhIњKKKK KK*K;KLKLGLMG|QhIhIhILGhIVQLLLGLGLLwLLLGLGLG;tXP]KgKdKELjL4KMGMG#iI-K.iI*iIMG!RMGVuKpKKKKKKǛKK՛KKKKK$K2K@KPK_KmKKKKMGKK̜KޜKKKK KK# +H1 : Q# T!&D8+@E64$5>7B.%/&?F*)C  !"#'(,-01239:;<=A$>h645E@678?#%CZ[\@&'F23,-./0123VW$(+7:;HI)6 @J*]^_` >$FdEA"EEBEnFq9+E<=>?@F456GKNLk<=O?@MCDFd gPQRSTUXY"+456<=?@CD8:;<=>n?DE4ghZ[q6B]^_iHIFC\7JKVWPQRSTUVWGLOmXYstMlk u N fgnop `abcdervywzx? {|}~ ^hSWXY_UVTRH "%)67:CDE<[PZb-210./FI43ABJ`dc]Oa   !#$&'(*+,;>=@MFH5Qe\G9?Lfa8 KgN !"$)*,.3468<>@BDFHJLNOSW\]bcjovxz|}~  %,16:I[]_fhjms "+456<=?@CDHIJKLMNOPQRSTUVWXYZ[\_abcdefgi@@YgYYYYYK]^IgYY$#%&'()*+,-./0123:;45C6789<=>?@ >6?h@gI$FEEJKKINOPQRVVVVVVWWVVXXXYYYYFK]`ehgEEKYBAF^FEYLKEhFGHHIJJKKKLLMMNNOOPPQQRRRRSSTTUUUUVVVWWWWXXXXYYYYYYYYYYYZZ[[\\\\\\\\\\]]^^`_abbccccccccccccccdeffggghhhhi*ѥ'(.%)I򥥥ꥥ0  !"#$%&'()*+,@A-./01239j5ubyteushortuintulongucentifloatidoubleirealcfloatcdoublewchardchar.d10d_language^KN Kpp`qx)r$/, wP+hpTq4q)) pxyppy yzzp p| * (*0*8*@*wwD mainunsigned int d_entire_prefix_len(const char*)../../gdb/d-namespace.cname[current_len] == '.'%s.%sblock_symbol d_lookup_nested_symbol(type*, const char*, const block*)called with non-aggregate type.block_symbol lookup_module_scope(const language_defn*, const char*, const block*, domain_enum, const char*, int)scope[new_scope_len] == '.'N_LBRAC/N_RBRAC symbol mismatch at symtab pos %dPremature end of file reading symbol tableCan't find .text section in symbol fileridiculous string table size (%d bytes).bad string table offset in symbol %d../../gdb/dbxread.cmisplaced N_LBRAC entry; discarding local symbols which have no enclosing blockblock start larger than block endstabs"repeated" header file %s not previously seen, at symtab pos %dfailed internal consistency checksect_index_data not initializedsect_index_rodata not initializedunknown symbol type %svoid process_one_symbol(int, int, CORE_ADDR, const char*, const section_offsets&, objfile*, language)unmatched N_LBRAC before symtab pos %dgcc2_compiled.void dbx_expand_psymtab(legacy_psymtab*, objfile*)!pst->readingcc_compiled.__gnu_compiledFirst symbol in segment of executable not a source symbolvoid dbx_read_symtab(legacy_psymtab*, objfile*)!self->readin__DYNAMICstring table offset backs up at %dN_BINCL %s not in entries for any file, at symtab pos %dfunction `%s' appears to be defined outside of all compilation unitsunknown symbol descriptor `%c'ridiculous string table size: %d bytesCan't find any code sections in symbol filestabsect_build_psymtabs: Found stabs (%s), but not string section (%s)Can't find %s section in symbol file14legacy_psymtab^fK\KxK,,T$.&3&&Invalid dcache line size: %u (must be power of 2).Deprecated remotecache flag is %s. Dcache size must be greater than 0.Usage: info dcache [LINENUMBER] No data cache available. No such cache line exists. Line %d: address %s [%d hits] %02x Dcache %u lines of %u bytes each. Contains data for %s Cache state: %d active lines, %d hits remotecacheThis used to enable the data cache for remote targets. The cache functionality is now controlled by the memory region system and the "stack-cache" flag; "remotecache" now does nothing and exists only for compatibility reasons.Show cache use for remote targets.Set cache use for remote targets.Print information on the dcache performance. Usage: info dcache [LINENUMBER] With no arguments, this command prints the cache configuration and a summary of each line in the cache. With an argument, dump" the contents of the given line.dcacheUse this command to set number of lines in dcache and line-size.Show dcachesettings.line-sizeShow dcache line size.Set dcache line size in bytes (must be power of 2).Show number of dcache lines.Set number of dcache lines.dict_add_symbol: non-expandable dictionary../../gdb/dictionary.cvoid insert_symbol_hashed(dictionary*, symbol*)sym->language () == DICT_LANGUAGE (dict)->la_languagedictionary* create_new_language_dictionary(multidictionary*, language)mdict->dictionaries[0] != nullptrcreate_new_language_dictionary: attempted to expand non-expandable multidictionaryTDtDHpt0,tDH0,The current disassembler options are '%s' There are no disassembler options available for this architecture. The following disassembler options are supported for use with the 'set disassembler-options OPTION [,OPTION]...' command: %*c %s For the options above, the following values are supported for "%s": 'set disassembler-options ...' is not supported on this architecture. Invalid disassembler option value: '%s'. disassembler-optionsShow the disassembler options.Set the disassembler options. Usage: set disassembler-options OPTION [,OPTION]... See: 'show disassembler-options' for valid option values.insn-numberis-speculativefunc-name>: %s%02xinstvoid do_mixed_source_and_assembly_deprecated(gdbarch*, ui_out*, symtab*, CORE_ADDR, CORE_ADDR, int, gdb_disassembly_flags)../../gdb/disasm.csymtab != NULL && SYMTAB_LINETABLE (symtab) != NULLasm_insnssrc_and_asm_lineline_asm_insnvoid do_mixed_source_and_assembly(gdbarch*, ui_out*, symtab*, CORE_ADDR, CORE_ADDR, int, gdb_disassembly_flags)main_symtab != NULL && SYMTAB_LINETABLE (main_symtab) != NULLlist_emitter.has_value ()sal.symtab != NULL--- no source info for this pc --- tuple_emitter.has_value ()Displace stepping debugging is %s. When non-zero, displaced stepping specific debugging is enabled.Show displaced stepping debugging.Set displaced stepping debugging.displaced_step_finish_status displaced_step_buffers::finish(gdbarch*, thread_info*, gdb_signal)../../gdb/displaced-stepping.ccopy_insn_closure != nullptrrestored %s %sbuffer != nullptrrestored in ptid %s %srestore_in_ptiddisplaced_step_prepare_status displaced_step_buffers::prepare(thread_info*, CORE_ADDR&)!thread->displaced_step_state.in_progress ()buf.current_thread != threadbreakpoint set in displaced stepping buffer at %s, can't use.selected buffer at %sError accessing memory address %s (%s) for displaced-stepping scratch space.saved %s: %sEnabledNo inferior runningProbe %s:%s cannot be disabled: no enablers.alwaysProbe '%s' has %d arguments, but GDB is requesting argument %u. This should not happen. Please report this bug.../../gdb/dtrace-probe.cskipping section '%s' which does not contain valid DOF data.could not obtain the contents ofsection '%s' in objfile `%s'.Show information about DTrace static probes. Usage: info probes dtrace [PROVIDER [NAME [OBJECT]]] Each argument is a regular expression, used to select probes. PROVIDER matches probe provider names. NAME matches the probe names. OBJECT matches the executable or shared library name.-pdtrace16static_probe_ops^K5probe^0K8K)))))K KJKt**x)),23dtrace_static_probe_ops^K(K12dtrace_probe^K8KK)Dvalue* dummy_frame_prev_register(frame_info*, void**, int)../../gdb/dummy-frame.c id=%s, ptid=%svoid dummy_frame_this_id(frame_info*, void**, frame_id*)void dummy_frame_pop(frame_id, thread_info*)void pop_dummy_frame(dummy_frame**)dummy->id.thread == inferior_thread ()void register_dummy_frame_dtor(frame_id, thread_info*, void (*)(void*, int), void*)Print the contents of the internal dummy-frame stack.dummy-framemaintenance print dummy-framesH=IH0.0static abbrev_table_up abbrev_table::read(dwarf2_section_info*, sect_offset)../../gdb/dwarf2/abbrev.csection->readinCORE_ADDR attribute::as_address() const../../gdb/dwarf2/attribute.c!requires_reprocessingconst char* attribute::as_string() constunsupported die ref attribute form: '%s'Attribute value is not a constant (%s)unrecognized DW_AT_defaulted value (%s)unrecognized DW_AT_virtuality value (%s)Dwarf Error: wrong version in compilation unit header (is %d, should be 2, 3, 4 or 5) [in module %s]read_comp_unit_head: invalid section_kind../../gdb/dwarf2/comp-unit-head.cDwarf Error: wrong unit_type in compilation unit header (is %s, should be %s) [in module %s]Dwarf Error: wrong unit_type in compilation unit header (is %#04x, should be one of: %s, %s, %s, %s or %s) [in module %s]read_comp_unit_head: dwarf from non elf fileDwarf Error: Too big type_offset in compilation unit header (is %s) [in module %s]Dwarf Error: bad offset (%s) in compilation unit header (offset %s + 6) [in module %s]Dwarf Error: bad length (0x%x) in compilation unit header (offset %s + 0) [in module %s]read_address: bad switch, signed [in module %s]read_address: bad switch, unsigned [in module %s]buildsym_compunit* dwarf2_cu::get_builder()../../gdb/dwarf2/cu.ccompunit_symtab* dwarf2_cu::start_symtab(const char*, const char*, CORE_ADDR)m_builder == nullptrDWARF 2DW_FORM_GNU_strp_alt used without .debug_str section [in module %s]DW_FORM_GNU_strp_alt pointing outside of .debug_str section [in module %s]could not read '.gnu_debugaltlink' sectioncould not read '.gnu_debugaltlink' section: %s/.dwz/gdb_bfd_ref_ptr dwz_search_other_debugdirs(std::string&, bfd_byte*, size_t)../../gdb/dwarf2/dwz.cIS_DIR_SEPARATOR (filename[dwz_pos])File "%s" from debuginfod cannot be opened as bfdcould not find '.gnu_debugaltlink' file for %s%s is invalid in this contextno unsigned variant found for type, while evaluating DWARF expressionintegral type expected in DWARF expressionUnsupported address size in DWARF expressions: %d bitsdwarf expression stack underflowAsked for position %d of stack, stack only has %zu elements on it.DWARF expression error: ran off end of buffer reading uleb128 valueDWARF expression error: ran off end of buffer reading sleb128 valueDWARF expression error: ran off end of buffer reading leb128 valueDWARF-2 expression error: `%s' operations must be used either alone or in conjunction with DW_OP_piece or DW_OP_bit_piece.DWARF-2 expression error: Loop detected (%d).DW_OP_regDW_OP_implicit_value: too few bytes available.DW_OP_implicit_valueDW_OP_stack_valueDWARF-2 expression error: DW_OP_implicit_pointer is not allowed in frame contextNot implemented: computing frame base using explicit value operatorNot enough elements for DW_OP_swap. Need 2, have %zu.Not enough elements for DW_OP_rot. Need 3, have %zu.Incompatible types on DWARF stackno signed variant found for type, while evaluating DWARF expressionCan't be reached.../../gdb/dwarf2/expr.cDWARF-2 expression error: DW_OP_GNU_uninit must always be the very last op.DW_OP_entry_value: too few bytes available.DWARF-2 expression error: DW_OP_entry_value is supported only for single DW_OP_reg* or for DW_OP_breg*(0)+DW_OP_deref*DW_OP_reinterpret has wrong sizeUnhandled dwarf expression opcode 0x%xvoid dwarf_expr_context::execute_stack_op(const gdb_byte*, const gdb_byte*)result_val != NULLthis->recursion_depth >= 0void dwarf_expr_context::eval(const gdb_byte*, size_t)this->recursion_depth == old_recursion_depth18dwarf_expr_context^PKhKttint existing_next_levels(frame_info*, tailcall_cache*)../../gdb/dwarf2/frame-tailcall.cretval >= -1void tailcall_frame_this_id(frame_info*, void**, frame_id*)next_frame != NULL(*this_id).artificial_depth > 0void cache_unref(tailcall_cache*)cache->refc > 0htab_find_slot (cache_htab, cache, NO_INSERT) != NULLtailcall_cache* cache_find(frame_info*)fi != NULLvoid cache_ref(tailcall_cache*)int tailcall_frame_sniffer(const frame_unwind*, frame_info*, void**)next_levels >= 0next_levels <= cache->chain_levelsCORE_ADDR pretend_pc(frame_info*, tailcall_cache*)next_levels == 0value* tailcall_frame_prev_register(frame_info*, void**, int)this_frame != cache->next_bottom_framevoid dwarf2_tailcall_sniffer_first(frame_info*, void**, const LONGEST*)*tailcall_cachep == NULLtailcall_cache* cache_new_ref1(frame_info*)int pretended_chain_levels(call_site_chain*)chain_levels <= chain->lengthcache->chain_levels > 0dwarf2 tailcallVKw|XyPy0wDW_OP_push_object_addressDW_OP_addrx or DW_OP_GNU_addr_indexDW_OP_entry_valueDW_OP_GNU_variable_valueDW_OP_call*DW_OP_form_tls_addressDW_OP_call_frame_cfaDW_OP_fbregUnsupported encoding: DW_EH_PE_indirect../../gdb/dwarf2/frame.cInvalid or unsupported encodingUnsupported address sizeThe DWARF stack unwinders are currently %s. armccNot implemented: computing unwound register using explicit value operatorcfa not available for record btrace targetcan't compute CFA for this frame: required registers or memory are unavailablecan't compute CFA for this frame: frame base not availableunwindersWhen enabled the DWARF stack frame unwinders can be used for architectures that support the DWARF unwinders. Enabling the DWARF unwinders for an architecture that doesn't support them will have no effect.Show whether the DWARF stack frame unwinders are used.Set whether the DWARF stack frame unwinders are used.Found an FDE when not expecting it.const gdb_byte* decode_frame_entry_1(gdbarch*, comp_unit*, const gdb_byte*, int, dwarf2_cie_table&, dwarf2_fde_table*, eh_frame_type)fde->cie != NULLCorrupt data in %s:%s; align 4 workaround apparently succeededCorrupt data in %s:%s; align 8 workaround apparently succeededCorrupt data in %s:%sincomplete CFI data; DW_CFA_restore unspecified register %s (#%d) at %sbad CFI data; mismatched DW_CFA_restore_state at %sCall Frame Instruction op %d in vendor extension space is not handled on this architecture.Unknown CFI encountered.skipping .eh_frame info of %s: %sskipping .debug_frame info of %s: %sdwarf2_fde* dwarf2_frame_find_fde(CORE_ADDR*, dwarf2_per_objfile**)!objfile->section_offsets.empty ()!fde_table->empty ()Could not compute CFA; needed to translate this expressionint dwarf2_fetch_cfa_info(gdbarch*, CORE_ADDR, dwarf2_per_cu_data*, int*, LONGEST*, CORE_ADDR*, const gdb_byte**, const gdb_byte**)Unknown CFA rule.dwarf2_frame_cache* dwarf2_frame_cache(frame_info*, void**)fde != NULLcache->per_objfile != nullptrincomplete CFI data; unspecified registers (e.g., %s) at %sUnknown register rule.dwarf2 signaldwarf2void dwarf2_frame_state_reg_info::alloc_regs(int)../../gdb/dwarf2/frame.hnum_regs_requested > 019dwarf_expr_executor^.KhKDK0t\tгtpKܱȨIJKܱȨK%s Cache hits (this session): %u %sCache misses (this session): %u std::string build_id_to_string(const bfd_build_id*)../../gdb/build-id.hbuild_id != NULLThe index cache is currently %s. void index_cache::set_directory(std::string)../../gdb/dwarf2/index-cache.c!dir.empty ()index cache: now using directory %s index cache: enabling (%s) index cache: disabling The index cache directory name is empty, skipping cache lookup..gdb-indexindex cache: trying to read %s index cache: couldn't read %s: %s Couldn't determine a path for the index cache directory.Set index-cache options.index-cacheShow index-cache options.Enable the index cache.Disable the index cache.Show the directory of the index cache.Set the directory of the index cache.Show some stats about the index cache.When non-zero, debugging output for the index cache is displayed.Show display of index-cache debug messages.Set display of index-cache debug messages.index cache: objfile %s has no build id index cache: dwz objfile %s has no build id The index cache directory name is empty, skipping store.index cache: could not make cache directory: %sindex cache: writing index cache for objfile %s index cache: couldn't store index cache for objfile %s: %s20index_cache_resource^K25index_cache_resource_mmap^KK K4couldn't data write to fileftellvoid assert_file_size(FILE*, size_t)../../gdb/dwarf2/index-write.cfile_size == expected_sizeSave a gdb-index file. Usage: save gdb-index [-dwarf-5] DIRECTORY No options create one file with .gdb-index extension for pre-DWARF-5 compatible .gdb_index section. With -dwarf-5 creates two files with extension .debug_names and .debug_str for DWARF-5 .debug_names section.void write_gdbindex_1(FILE*, const data_buf&, const data_buf&, const data_buf&, const data_buf&, const data_buf&)contents.size () == size_of_headerint addrmap_index_data::operator()(CORE_ADDR, void*)it != cu_index_htab.cend ()void add_index_entry(mapped_symtab*, const char*, int, gdb_index_symbol_kind, offset_type)((cu_index) & ~GDB_INDEX_CU_MASK) == 0(kind) >= GDB_INDEX_SYMBOL_KIND_TYPE && (kind) <= GDB_INDEX_SYMBOL_KIND_OTHER.debug_namesCannot use an index to create the indexCannot make an index when the file has multiple .debug_types sections.debug_strsize_t debug_names::bytes() const!m_abbrev_table.empty ()void write_debug_names(dwarf2_per_objfile*, FILE*, FILE*)size64 < 0xfffffff0uint32_t debug_names::bucket_count() constuint32_t debug_names::name_count() constuint32_t debug_names::abbrev_table_bytes() constheader.size () == bytes_of_headervoid debug_names::file_write(FILE*, FILE*) constvoid write_gdbindex(dwarf2_per_objfile*, FILE*, FILE*)insertpair.secondvoid write_hash_table(mapped_symtab*, data_buf&, data_buf&)entry.index_offset == 0dwz_cu_list.empty ()GDBusage: save gdb-index [-dwarf-5] DIRECTORYError while writing index for `%s': -dwarf-5 void debug_names::offset_vec_tmpl::push_back_reorder(size_t) [with OffsetSize = long long unsigned int; size_t = unsigned int]m_vec.back () == elemrenamemkstempCan't open `%s' for writingvoid debug_names::offset_vec_tmpl::push_back_reorder(size_t) [with OffsetSize = unsigned int; size_t = unsigned int]Duplicate string "%s" in .debug_str section [in module %s]void debug_names::build()!value_set.empty ()m_hash_table.size () == name_countN11debug_names10offset_vecE^DKN11debug_names15offset_vec_tmplIjEE^hK`KN11debug_names15offset_vec_tmplIyEE^K`KK(8KH44444444.4444read_offset_1: bad switch [in module %s]../../gdb/dwarf2/leb.cAdding file %zu: %s bad file number in macro information (%d)Adding dir %zu: %s Unknown format content type %sstatement list doesn't fit in .debug_line sectionLONGEST read_checked_initial_length_and_offset(bfd*, const gdb_byte*, const comp_unit_head*, unsigned int*, unsigned int*)../../gdb/dwarf2/line-header.ccu_header->initial_length_size == 4 || cu_header->initial_length_size == 8 || cu_header->initial_length_size == 12intermixed 32-bit and 64-bit DWARF sectionsunsupported version in .debug_line sectionunsupported segment selector size %u in .debug_line sectioninvalid maximum_ops_per_instruction in `.debug_line' sectionline number info header doesn't fit in `.debug_line' sectionLocation address is not set.access outside bounds of object referenced via synthetic pointerDW_TAG_call_site resolving failed to find function name for address %ssymbol* func_addr_to_tail_call_list(gdbarch*, CORE_ADDR)../../gdb/dwarf2/loc.cTYPE_SPECIFIC_FIELD (type) == TYPE_SPECIFIC_FUNCvoid per_cu_dwarf_call(dwarf_expr_context*, cu_offset, dwarf2_per_cu_data*, dwarf2_per_objfile*)block.per_cu == per_cuUnable to access DWARF register number %dUnable to access DWARF register number %ssymbol "%s" is optimized outDWARF operator %s cannot be translated to an agent expressionUnknown DWARF operator 0x%02x cannot be translated to an agent expressionvoid access_memory(gdbarch*, agent_expr*, ULONGEST)nbytes > 0 && nbytes <= sizeof (LONGEST)Whether to always disassemble DWARF expressions is %s. Entry values and tail call frames debugging is %s. %s(%s)dwarf2_find_location_expression: Corrupted DWARF expression.const gdb_byte* dwarf2_find_location_expression(dwarf2_loclist_baton*, size_t*, CORE_ADDR)bad debug_loc_kindCould not find the frame base for "%s".void dwarf2_compile_property_to_c(string_file*, const char*, gdbarch*, std::vector&, const dynamic_prop*, CORE_ADDR, symbol*)prop->kind () == PROP_LOCLISTbad DWARF register number %dbad_register_numberUnrecognized DWARF opcode 0x%02x at %ld %*ld: %s %s [$%s] register %s [$%s] offset %s to %ld %s (bytes) size %s offset %s (bits) DIE %s offset %s [0x%s]> %d [0x%s]> %d byte block: [0x%s]> [$%s]<0>, and a complex DWARF expression: a variable in $%sNo block found for address for symbol "%s".No function found for block for symbol "%s".Unexpected opcode after DW_OP_breg%u for symbol "%s".a variable at frame base reg $%s offset %s+%sa variable at offset %s from base reg $%sa thread-local variable at offset 0x%s in the thread-local storage for `%s'the constant %dan empty %s-byte piece [%s-byte piece]Corrupted DWARF2 expression for "%s".an empty %s-bit piece [%s-bit piece, offset %s bits]multi-location: Base address %sCorrupted DWARF expression for symbol "%s".void loclist_describe_location(symbol*, CORE_ADDR, ui_file*) Range %s-%s: entry-valuesWhen non-zero, the process of determining parameter values from function entry point and tail call frames will be printed.Show entry values and tail call frames debugging.Set entry values and tail call frames debugging.always-disassembleWhen enabled, DWARF expressions are always printed in an assembly-like syntax. When disabled, expressions will be printed in a more conversational style, when possible.Show whether `info address' always disassembles DWARF expressions.Set whether `info address' always disassembles DWARF expressions.cannot use offset on synthetic pointer to registerinvalid location typeCORE_ADDR locexpr_get_frame_base(symbol*, frame_info*)SYMBOL_BLOCK_OPS (framefunc)->find_frame_base_location != NULLCORE_ADDR loclist_get_frame_base(symbol*, frame_info*)DW_AT_call_target is not specified at %s in %sDW_AT_call_target DWARF block resolving requires known frame which is currently not available at %s in %sCannot find function "%s" for a call site target at %s in %sinvalid call site target kindbool dwarf2_evaluate_property(const dynamic_prop*, frame_info*, const property_addr_info*, CORE_ADDR*, bool)baton->property_type != NULLcannot find reference address for offset propertyCannot resolve DW_AT_call_data_valuevalue* coerce_pieced_ref(const value*)closure != NULLclosure->pieces.size () == 1Invalid use of DW_OP_implicit_pointervalue* indirect_pieced_value(value*)piece != NULLBad DW_OP_GNU_variable_value DIE.Type of DW_OP_GNU_variable_value DIE must be an integer or pointer.Should not be able to create a lazy value with an enclosing typeCan't do read-modify-write to update bitfield; containing word has been optimized outCan't do read-modify-write to update bitfield; containing word is unavailableCannot translate DW_OP_implicit_value of %d bytesCannot translate empty pieces to agent expressionsExpression pieces exceed word sizevoid dwarf2_compile_expr_to_ax(agent_expr*, axs_value*, unsigned int, const gdb_byte*, const gdb_byte*, dwarf2_per_cu_data*, dwarf2_per_objfile*)invalid labelUnable to find function for PC %stailcall: initial:tailcall: compare:tailcall: reduced: |void chain_candidate(gdbarch*, gdb::unique_xmalloc_ptr*, std::vector*)(*resultp)->callers + (*resultp)->callees <= (*resultp)->lengthgdb::unique_xmalloc_ptr call_site_find_chain_1(gdbarch*, CORE_ADDR, CORE_ADDR)removed == 1There are no unambiguously determinable intermediate callers or callees between caller function "%s" at %s and callee function "%s" at %scall_site_parameter* dwarf_expr_reg_to_entry_parameter(frame_info*, call_site_parameter_kind, call_site_parameter_u, dwarf2_per_cu_data**, dwarf2_per_objfile**)DW_OP_entry_value resolving callee gdbarch %s (of %s (%s)) does not match caller gdbarch %sDW_OP_entry_value resolving requires caller of %s (%s)DW_OP_entry_value resolving expects callee %s at %s but the called frame is for %s at %sDW_OP_entry_value resolving has found function "%s" at %s can call itself via tail callsCannot find matching parameter at DW_TAG_call_site %s at %sDWARF-2 expression error: DW_OP_entry_value is supported only for single DW_OP_reg* or for DW_OP_fbreg(*)Could not find type for DW_OP_const_typeDW_OP_const_type has different sizes for type and datavoid* dynamic_prop::baton() constm_kind == PROP_LOCEXPR || m_kind == PROP_LOCLIST || m_kind == PROP_ADDR_OFFSETframe address is not available.virtual void dwarf_evaluate_loc_desc::get_frame_base(const gdb_byte**, size_t*)framefunc != NULL23dwarf_evaluate_loc_desc^ LhK26evaluate_for_locexpr_baton^ L L25symbol_needs_eval_context^ LhK Lģd,\Ԡ|L LD,\Ԡ|L L$Dh,|ğdtDs >&)low == highDwarf Error: could not find partial DIE containing offset %s [in module %s]dwarf2_per_cu_data* dwarf2_find_containing_comp_unit(sect_offset, unsigned int, dwarf2_per_objfile*)per_objfile->per_bfd->all_comp_units[low-1]->sect_off <= sect_offinvalid dwarf2 offset %ssect_off < this_cu->sect_off + this_cu->lengthinvalid attribute class or form for '%s' in '%s'location expression too complexdwarf2_section_info create_dwp_v2_or_v5_section(dwarf2_per_objfile*, dwarf2_section_info*, bfd_size_type, bfd_size_type)!section->is_virtualDwarf Error: Bad DWP V2 or V5 section info, doesn't fit in section %s [in module %s]%s used without %s section in CU at offset %s [in module %s]Offset from %s pointing outside of .debug_str.dwo section in CU at offset %s [in module %s]DW_FORM_addr_index used without .debug_addr section [in module %s]DW_FORM_addr_index pointing outside of .debug_addr section [in module %s]CodeWarrior S12/L-ISAmissing .debug_line.dwo sectionmissing .debug_line section.debug_macinfo.dwo.debug_macro.debug_macinfo.debug_macro.dwomissing %s section_MOD_D mainRecording line %u, file %s, address %s Whether to check "physname" is %s. The upper bound on the age of cached DWARF compilation units is %s. void init_cu_die_reader(die_reader_specs*, dwarf2_cu*, dwarf2_section_info*, dwo_file*, abbrev_table*)section->readin && section->buffer != NULLpartial_symtab* dwarf2_include_psymtab::includer() constthis->number_of_dependencies == 1Dwarf Error: unsupported DWP file version (%s) [in module %s]Dwarf Error: number of slots in DWP hash table (%s) is not power of 2 [in module %s]Empty DWP but nr_slots,nr_units,nr_columns not all zero [in modules %s]Dwarf Error: bad DWP hash table, too few columns in section table [in module %s]Dwarf Error: bad DWP hash table, too many columns in section table [in module %s]Dwarf Error: bad DWP hash table, bad section id %d in section table [in module %s]Dwarf Error: bad DWP hash table, duplicate section id %d in section table [in module %s]Dwarf Error: bad DWP hash table, missing/duplicate DWO info/types section [in module %s]Dwarf Error: bad DWP hash table, missing DWO abbrev section [in module %s]Dwarf Error: DWP index section is corrupt (too small) [in module %s]void queue_comp_unit(dwarf2_per_cu_data*, dwarf2_per_objfile*, language)cannot create std::deque larger than max_size()TUDwarf Error: Could not find abbrev number %d in %s at offset %s [in module %s]void alloc_rust_variant(obstack*, type*, int, int, gdb::array_view)discriminant_index == -1 || (discriminant_index >= 0 && discriminant_index < type->num_fields ())default_index == -1 || (default_index >= 0 && default_index < type->num_fields ())range_idx == ranges.size ()var_idx == n_variantsvoid type::set_bounds(range_bounds*)this->code () == TYPE_CODE_RANGEint build_type_psymtab_dependencies(void**, void*)tu_group->type_unit_group_p ()iter->is_debug_typesconst value length mismatch for '%s', got %d, expected %dvoid dwarf2_const_value_attr(const attribute*, type*, const char*, obstack*, dwarf2_cu*, LONGEST*, const gdb_byte**, dwarf2_locexpr_baton**)(*baton)->per_cuunsupported const value attribute form: '%s'void fill_in_loclist_baton(dwarf2_cu*, dwarf2_loclist_baton*, const attribute*)baton->per_cuLocation list used without specifying the CU base address.void dwarf2_symbol_mark_computed(const attribute*, symbol*, dwarf2_cu*, int)location descriptionDie: %s (abbrev %d, offset %s) parent at offset: %s has children: %s attributes: %s (%s) block: size %sexpression: size %sconstant of 16 bytesalt ref address: constant ref: 0x%lx (adjusted)constant: %ssection offset: %ssignature: %sstring: "%s" (%s canonicalized)flag: TRUEflag: FALSEunexpected attribute form: DW_FORM_indirectunsupported attribute form: %d.void dump_die_1(ui_file*, int, int, die_info*)die != NULL Children: [not printed, max nesting level reached] Skipping obsolete .gdb_index section in %s.Skipping deprecated .gdb_index section in %s. Do "set use-deprecated-index-sections on" before the file is read to use the section anyway.virtual void dwarf2_gdb_index::dump(objfile*).gdb_index: faked for "readnow" virtual void dwarf2_debug_names_index::dump(objfile*).debug_names: exists Number of read CUs: %d Number of unread CUs: %d void dwarf2_get_section_info(objfile*, dwarf2_section_enum, asection**, const gdb_byte**, bfd_size_type*)unexpected sectionWrong .debug_names with name index %u but name_count=%u [in module %s]Wrong .debug_names undefined abbrev code %s [in module %s]Unsupported .debug_names form %s [in module %s].debug_names entry has bad CU index %s [in module %s].debug_names entry has bad TU index %s [in module %s]type* dwarf2_per_objfile::int_type(int, bool) constunable to find suitable integer typeDW_FORM_line_strpvoid attribute::set_signature(ULONGEST)Dwarf Error: Cannot handle %s in DWARF reader [in module %s]Suspicious DW_AT_byte_size value treated as zero instead of %signoring absolute DW_AT_siblingDW_AT_sibling points backwards (end sequence)Processing actual line %u: file %u, address %s, is_stmt %u, discrim %u%s .debug_line section has line data without a fileFinishing current line, file %s, address %s .debug_line address at offset 0x%lx is 0 [in module %s]Set DWARF specific variables. Configure DWARF variables such as the cache size.dwarfShow DWARF specific variables. Show DWARF variables such as the cache size.max-cache-ageA higher limit means that cached compilation units will be stored in memory longer, and more total memory will be used. Zero disables caching, which can slow down startup.Show the upper bound on the age of cached DWARF compilation units.Set the upper bound on the age of cached DWARF compilation units.dwarf-readWhen enabled (non-zero), debugging messages are printed during DWARF reading and symtab expansion. A value of 1 (one) provides basic information. A value greater than 1 provides more verbose information.Show debugging of the DWARF reader.Set debugging of the DWARF reader.dwarf-dieWhen enabled (non-zero), DIEs are dumped after they are read in. The value is the maximum depth to print.Show debugging of the DWARF DIE reader.Set debugging of the DWARF DIE reader.dwarf-lineWhen enabled (non-zero), line number entries are dumped as they are read in. A value of 1 (one) provides basic information. A value greater than 1 provides more verbose information.Show debugging of the dwarf line reader.Set debugging of the dwarf line reader.check-physnameWhen enabled, GDB's internal "physname" code is checked against the demangler.Show cross-checking of "physname" code against demangler.Set cross-checking of "physname" code against demangler.use-deprecated-index-sectionsWhen enabled, deprecated .gdb_index sections are used anyway. Normally they are ignored either because of a missing feature or performance issue. Warning: This option must be enabled before gdb reads the file.Show whether to use deprecated gdb_index sections.Set whether to use deprecated gdb_index sections.Reading %s %s/%s in DWP V1 file: %screate_dwo_unit_in_dwp_v1Dwarf Error: bad DWP hash table, section number too large [in module %s]Dwarf Error: bad DWP hash table, invalid section found [in module %s]Dwarf Error: bad DWP hash table, missing DWO sections [in module %s]Dwarf Error: bad DWP hash table, too many DWO sections [in module %s]virtual-dwo/%d-%d-%d-%dCreating virtual DWO: %sUsing existing virtual DWO: %sReading %s %s/%s in DWP V2 file: %screate_dwo_unit_in_dwp_v2virtual-dwo/%ld-%ld-%ld-%lddwo_unit* create_dwo_unit_in_dwp_v5(dwarf2_per_objfile*, dwp_file*, uint32_t, const char*, ULONGEST, int)dwp_file->version == 5Reading %s %s/%s in DWP V5 file: %screate_dwo_unit_in_dwp_v5virtual-dwo/%ld-%ld-%ld-%ld-%ld-%ldDwarf Error: bad DWP hash table, lookup didn't terminate [in module %s]Reading %s for %screate_debug_type_hash_tablevoid create_debug_type_hash_table(dwarf2_per_objfile*, dwo_file*, dwarf2_section_info*, htab_up&, rcuh_kind)debug type entry at offset %s is duplicate to the entry at offset %s, signature %s offset %s, signature %sDW_FORM_loclistx used without .debug_loclists section [in module %s]DW_AT_loclists_base is smaller than header size [in module %s]DW_FORM_loclistx pointing outside of .debug_loclists offset array [in module %s]Reading DW_FORM_loclistx index beyond end of.debug_loclists section [in module %s]DW_FORM_rnglistx used without .debug_rnglists section [in module %s]DW_AT_rnglists_base is smaller than header size [in module %s]DW_FORM_rnglistx index pointing outside of .debug_rnglists offset array [in module %s]Reading DW_FORM_rnglistx index beyond end of.debug_rnglists section [in module %s]void read_attribute_reprocess(const die_reader_specs*, attribute*, dwarf_tag)!attr->canonical_string_p ()%s used in Fission stub without %s in CU at offset 0x%lx [in module %s]Unexpected DWARF form.unsupported stack op: '%s'unsupported stack op: '%02x'location description stack overflowlocation description stack underflowDwarf Error: could not find abbrev number %d [in module %s]Read die from %s@0x%x of %s: Offset %d out of bounds for DW_AT_ranges attributeInvalid .debug_rnglists data (no base address)Invalid .debug_rnglists data (inverted range)Invalid .debug_rnglists data (no base address for DW_RLE_offset_pair).debug_rnglists entry has start address of zero [in module %s]Offset %d is not terminated for DW_AT_ranges attributeInvalid .debug_ranges data (no base address)Invalid .debug_ranges data (inverted range).debug_ranges entry has start address of zero [in module %s]partial symbol informationDW_AT_locationDW_AT_low_pc %s is zero for DIE at %s [in module %s]DW_AT_low_pc %s is not < DW_AT_high_pc %s for DIE at %s [in module %s]type_unit_group* get_type_unit_group(dwarf2_cu*, const attribute*)tu_group != nullptrinvalid discriminant marker: %dDW_AT_discr_list missing low valueDW_AT_discr_list missing high valuemangled .debug_line section.debug_line section has line program sequence without an end.dwpDWP file not found: %sopen_and_init_dwp_filevoid dwarf2_locate_common_dwp_sections(bfd*, asection*, dwp_file*)elf_section_nr < dwp_file->num_sectionsDwarf Error: DWP file CU version %s doesn't match TU version %s [in DWP file %s]void dwarf2_locate_v2_dwp_sections(bfd*, asection*, void*)void dwarf2_locate_v5_dwp_sections(bfd*, asection*, void*)DWP file found: %s %s CUs, %s TUsSymtab %s has objects from two different Go packages: %s and %svoid dwarf2_per_objfile::remove_all_cus()!this->per_bfd->queue.has_value ()Discarding section %s which has a section size (%s) larger than the file size [in module %s]int maybe_queue_comp_unit(dwarf2_cu*, dwarf2_per_cu_data*, dwarf2_per_objfile*, language)per_objfile->get_cu (per_cu) != nullptr!per_objfile->symtab_set_p (per_cu)void fill_in_sig_entry_from_dwo_entry(dwarf2_per_objfile*, signatured_type*, dwo_unit*)! sig_entry->queuedper_objfile->get_cu (sig_entry) == NULLsig_entry->v.quick != NULL!per_objfile->symtab_set_p (sig_entry)sig_entry->v.psymtab == NULLsig_entry->signature == dwo_entry->signatureto_underlying (sig_entry->type_offset_in_section) == 0sig_entry->type_unit_group == NULLsig_entry->dwo_unit == NULLcompReading %s unit at offset %s cutu_reader::cutu_reader(dwarf2_per_cu_data*, dwarf2_per_objfile*, dwarf2_cu*, dwo_file*)per_objfile->get_cu (this_cu) == nullptrvirtual void dwarf2_psymtab::read_symtab(objfile*)!per_objfile->symtab_set_p (per_cu_data)signatured_type* add_type_unit(dwarf2_per_objfile*, ULONGEST, void**)signatured_type* lookup_dwo_signatured_type(dwarf2_cu*, ULONGEST)cu->dwo_unit && per_objfile->per_bfd->using_indexsignatured_type* lookup_dwp_signatured_type(dwarf2_cu*, ULONGEST)dwp_file != NULLcould not read '.gdb_index' section from %s; skippingvoid create_cus_from_index(dwarf2_per_bfd*, const gdb_byte*, offset_type, const gdb_byte*, offset_type)per_bfd->all_comp_units.empty ().gdb_index address table has invalid range (%s - %s).gdb_index address table has invalid CU number %uread_comp_units_from_sectionvoid read_comp_units_from_section(dwarf2_per_objfile*, dwarf2_section_info*, dwarf2_section_info*, unsigned int, htab_up&, rcuh_kind)slot != nullptrvoid mapped_index_base::build_name_components(dwarf2_per_objfile*)age_comp_unitsvoid dwarf2_per_objfile::age_comp_units()deleting old CU %svoid rust_union_quirks(dwarf2_cu*)cu->per_cu->lang == language_rustvoid quirk_rust_enum(type*, objfile*)RUST$ENCODED$ENUM$Could not parse Rust enum encoding string "%s"[in module %s]<>RUST$ENUM$DISRvoid dwarf2_per_objfile::set_type_for_signatured_type(signatured_type*, type*)this->m_type_map.find (sig_type) == this->m_type_map.end ()void dwarf2_per_objfile::set_cu(dwarf2_per_cu_data*, dwarf2_cu*)this->get_cu (per_cu) == nullptrvoid cutu_reader::keep()!dummy_pvoid load_full_comp_unit(dwarf2_per_cu_data*, dwarf2_per_objfile*, dwarf2_cu*, bool, language)! this_cu->is_debug_typescu->die_hash == NULLdie_info* follow_die_offset(sect_offset, int, dwarf2_cu**)cu->per_cu != NULLsource CU offset: %s, target offset: %s, source CU contains target offset: %dfollow_die_offsettarget CU offset: %s, target CU DIEs loaded: %dtarget_cu != nullptrper_objfile->per_bfd->reading_partial_symbolsDwarf Error: Cannot find DIE at %s referenced from DIE at %s [in module %s]string type expected for attribute %s for DIE at %s in module %sIBM XL C for OpenCLGNU Go ._sect_off == cu->header.sect_offvoid cutu_reader::init_tu_and_read_dwo_dies(dwarf2_per_cu_data*, dwarf2_per_objfile*, dwarf2_cu*)this_cu->is_debug_types && this_cu->reading_dwo_directlysig_type->dwo_unit != NULLcu->dwo_unit == sig_type->dwo_unitVirtual DWO %s %s found: @%slookup_dwo_cutuDWO file not found: %sopen_and_init_dwo_fileReading %s for %s:create_cus_hash_tableDwarf Error: debug entry at offset %s is missing its dwo_id [in module %s] offset %s, dwo_id %screate_dwo_cu_readervoid create_cus_hash_table(dwarf2_per_objfile*, dwarf2_cu*, dwo_file&, dwarf2_section_info&, htab_up&)debug cu entry at offset %s is duplicate to the entry at offset %s, signature %sDWO file found: %sDWO %s %s(%s) found: @%sDWO %s %s(%s) not foundCould not find DWO %s %s(%s)%s referenced by %s at offset %s [in module %s]cutu_reader::cutu_reader(dwarf2_per_cu_data*, dwarf2_per_objfile*, abbrev_table*, dwarf2_cu*, bool)abbrev_table == NULLsig_type->signature == cu->header.signaturesig_type->type_offset_in_tu == cu->header.type_cu_offset_in_tuthis_cu->sect_off == cu->header.sect_offthis_cu->length == cu->header.get_length ()cu->header.abbrev_sect_off == abbrev_table->sect_offcompilation unit with DW_AT_GNU_dwo_name has children (offset %s) [in module %s]dwo_unit* lookup_dwo_type_unit(dwarf2_cu*, const char*, const char*)Dwarf Error: missing dwo_id for dwo_name %s [in module %s]dwo_unit* lookup_dwo_comp_unit(dwarf2_cu*, const char*, const char*, ULONGEST)!cu->per_cu->is_debug_typesvoid dwarf2_cu::setup_type_unit_groups(die_info*)tug_unshare->symtabs == NULLquick_file_names* dw2_get_file_names(dwarf2_per_cu_data*, dwarf2_per_objfile*)! this_cu->type_unit_group_p ()void dw2_get_file_names_reader(const die_reader_specs*, die_info*)void finish_fixed_point_type(type*, const char*, die_info*, dwarf2_cu*)type->code () == TYPE_CODE_FIXED_POINT && TYPE_SPECIFIC_FIELD (type) == TYPE_SPECIFIC_FIXED_POINTno scale found for fixed-point type (DIE at %s)unexpected negative value for DW_AT_GNU_numerator in DIE at %sunexpected negative value for DW_AT_GNU_denominator in DIE at %s%s DIE not supported as target of DW_AT_small attribute (DIE at %s)unsupported scale attribute %s for fixed-point type (DIE at %s)fixed_point_type_info& type::fixed_point_info() constthis->code () == TYPE_CODE_FIXED_POINTthis->main_type->type_specific.fixed_point_info != nullptrvoid read_signatured_type(signatured_type*, dwarf2_per_objfile*)sig_type->is_debug_typesper_objfile->get_cu (sig_type) == nullptrvoid load_full_type_unit(dwarf2_per_cu_data*, dwarf2_per_objfile*)! per_cu->type_unit_group_p ()per_objfile->get_cu (per_cu) == nullptrDwarf Error: Dummy CU at %s referenced in module %sDwarf Error: Cannot find DIE at %s referenced in module %sDwarf Error: DIE at %s referenced in module %s is neither DW_FORM_block* nor DW_FORM_exprlocdie_info* follow_die_sig_1(die_info*, signatured_type*, dwarf2_cu**)sig_cu != NULLto_underlying (sig_type->type_offset_in_section) != 0Dwarf Error: Cannot find signatured DIE %s referenced from DIE at %s [in module %s]Dwarf Error: Cannot build signatured type %s referenced from DIE at %s [in module %s]Dwarf Error: Problem reading signatured DIE %s referenced from DIE at %s [in module %s]type* lookup_die_type(die_info*, const attribute*, dwarf2_cu*)attr->name == DW_AT_type || attr->name == DW_AT_GNAT_descriptive_type || attr->name == DW_AT_containing_typeDwarf Error: Bad type attribute %s in DIE at %s [in module %s]Dwarf Error: Problem turning containing type into gdb type [in module %s]unrecognized DW_AT_calling_convention value (%s) for a subroutinetype* read_tag_pointer_type(die_info*, dwarf2_cu*)(type_flags & ~TYPE_INSTANCE_FLAG_ADDRESS_CLASS_ALL) == 0invalid pointer size %dInvalid DW_AT_alignment - DIE at %s [in module %s]DW_AT_bit_size and DW_AT_string_length_bit_size not currently supported on DW_TAG_string_type.Self-referential DW_TAG_typedef - DIE at %s [in module %s]Missing DW_AT_lower_bound - DIE at %s [in module %s]Unresolved DW_AT_upper_bound - DIE at %s [in module %s]Unresolved DW_AT_count - DIE at %s [in module %s]Found DW_AT_bit_stride and DW_AT_byte_stride - DIE at %s [in module %s]DW_AT_name missing from DW_TAG_base_typeDW_AT_endianity has unrecognized value %d___XF_type* read_base_type(die_info*, dwarf2_cu*)startswith (gnat_encoding_suffix, GNAT_FIXED_POINT_SUFFIX)_Complex character(unsupported DW_AT_encoding: '%s'unexpected tag in read_type_die: '%s'Dwarf Error: DW_AT_signature has bad form %s in DIE at %s [in module %s]int attr_to_dynamic_prop(const attribute*, die_info*, dwarf2_cu*, dynamic_prop*, type*)default_type != NULLdynamic propertyA problem internal to GDB: DIE %s has type already setconst char* anonymous_struct_prefix(die_info*, dwarf2_cu*)template param type '%s' defined within parent '%s'UNKNOWN_TYPEtemplate parameter missing DW_AT_typeUNKNOWN_VALUEtemplate parameter missing DW_AT_const_valueComputed physname <%s> does not match demangled <%s> (from linkage <%s>) - DIE at %s [in module %s]missing DW_AT_call_return_pc for DW_TAG_call_site DIE %s [in module %s]Duplicate PC %s for DW_TAG_call_site DIE %s [in module %s]Tag %d is not DW_TAG_call_site_parameter in DW_TAG_call_site child DIE %s [in module %s]void read_call_site_scope(die_info*, dwarf2_cu*)Cannot find function owning DW_TAG_call_site DIE %s [in module %s]target_cu->per_objfile->objfile == objfileDW_AT_call_target target DIE has invalid physname, for referencing DIE %s [in module %s]DW_AT_call_target target DIE has invalid low pc, for referencing DIE %s [in module %s]DW_TAG_call_site DW_AT_call_target is neither block nor reference, for DIE %s [in module %s]call_site->parameter_count < nparamsDW_AT_call_parameter offset is not in CU for DW_TAG_call_site child DIE %s [in module %s]No DW_FORM_block* DW_AT_location for DW_TAG_call_site child DIE %s [in module %s]Only single DW_OP_reg or DW_OP_fbreg is supported for DW_FORM_block* DW_AT_location is supported for DW_TAG_call_site child DIE %s [in module %s]No DW_FORM_block* DW_AT_call_value for DW_TAG_call_site child DIE %s [in module %s]No DW_FORM_block* DW_AT_call_data_value for DW_TAG_call_site child DIE %s [in module %s]void compute_delayed_physnames(dwarf2_cu*)cu->per_cu->lang == language_cplusunrecognized DW_AT_calling_convention value (%s) for a typeULONGEST attribute::as_nonnegative() constfile index out of rangesymbol* new_symbol(die_info*, type*, dwarf2_cu*, symbol*)die_is_declaration (die, cu)attrSYMBOL_CLASS (sym) == LOC_OPTIMIZED_OUTunsupported tag: '%s'void dwarf2_add_field(field_info*, die_info*, dwarf2_cu*)missing case in dwarf2_add_fieldunable to read array DW_AT_byte_stride - DIE at %s [in module %s]unable to find array range - DIE at %s [in module %s]GNU F77type* read_array_type(die_info*, dwarf2_cu*)type != element_typeDW_AT_byte_size for array type smaller than the total size of elementsUB%dtype* quirk_ada_thick_pointer(die_info*, dwarf2_cu*, type*)iter->code () == TYPE_CODE_ARRAYdie_info* follow_die_sig(die_info*, const attribute*, dwarf2_cu**)attr->form == DW_FORM_ref_sig8Dwarf Error: Expected reference attribute [in module %s]Tag '%s' has no DW_AT_importchild DW_TAG_imported_declaration expected - DIE at %s [in module %s]child DW_TAG_imported_declaration has unknown imported name - DIE at %s [in module %s]process_die_scope::process_die_scope(die_info*, dwarf2_cu*)!m_die->in_processvoid read_file_scope(die_info*, dwarf2_cu*)per_objfile->sym_cu == nullptrvoid handle_DW_AT_stmt_list(die_info*, dwarf2_cu*, const char*, CORE_ADDR)! cu->per_cu->is_debug_types*slot != NULLdie->tag != DW_TAG_partial_unitCU refers to both DW_AT_macros and DW_AT_macro_infounsupported accessibility %dunexpected virtuality in component of Ada typeunexpected member functions in Ada typevirtual function table pointer not found when defining class '%s'IBM(R) XL C/C++ Advanced Edition__vfp__pfn__deltacould not find suitable symtab for template parameter - DIE at %s [in module %s]void process_enumeration_scope(die_info*, dwarf2_cu*)common block memberVariable in common block has DW_AT_data_member_location - DIE at %s [in module %s]void mark_common_block_symbol_computed(symbol*, die_info*, attribute*, attribute*, dwarf2_cu*)common_loc->form_is_block ()member_loc->form_is_block () || member_loc->form_is_constant ()ptr - baton->data == baton->sizeDIE at %s has too many recursively imported declarationsTag '%s' has unexpected childrenDwarf Error: DW_TAG_imported_unit is not supported in type units [in module %s]Child DIE %s and its abstract origin %s have different tagsChild DIE %s and its abstract origin %s have different parentsMultiple children of DIE %s refer to DIE %s as their abstract originmissing name for subprogram DIE at %scannot get low and high bounds for subprogram DIE at %svoid read_func_scope(die_info*, dwarf2_cu*)cu->get_builder () != nullptrtempl_func != NULLunexpected member function in Ada typemember function type missing for '%s'cannot determine context for virtual member function "%s" (offset %s)DW_AT_vtable_elem_locationMember function "%s" (offset %s) is virtual but the vtable offset is not specifiednested DW_TAG_variant_part seen - DIE at %s [in module %s]DW_AT_discr does not have DIE reference form - DIE at %s [in module %s]saw DW_TAG_variant outside DW_TAG_variant_part - DIE at %s [in module %s]nested DW_TAG_variant seen - DIE at %s [in module %s]Dwarf Error: Type Unit at offset %s contains external reference to offset %s [in module %s]. Dwarf Error: Cannot find DIE at %s [from module %s] unhandled containing DIE tag %s for DIE at %spartial_die_info* load_partial_dies(const die_reader_specs*, const gdb_byte*, int)DW_TAG_typedef has childen - GCC PR debug/47510 bug - DIE at %s [in module %s]malformed enumerator DIE ignoredvoid build_type_psymtabs_reader(const die_reader_specs*, const gdb_byte*, die_info*)Dwarf Error: unexpected tag '%s' at offset %s [in module %s]void process_psymtab_comp_unit_reader(const die_reader_specs*, const gdb_byte*, die_info*, language)! per_cu->is_debug_typesPsymtab for %s unit @%s: %s - %s, %d global, %d static symsprocess_psymtab_comp_unit_readervoid dwarf2_per_objfile::set_symtab(const dwarf2_per_cu_data*, compunit_symtab*)this->m_symtabs[per_cu->index] == nullptrSection .debug_names in %s length %s does not match section length %s, ignoring .debug_names.Section .debug_names in %s has unsupported version %d, ignoring .debug_names.Section .debug_names in %s has unsupported padding %d, ignoring .debug_names.Section .debug_names in %s has unsupported %lu foreign TUs, ignoring .debug_names.Section .debug_names in %s has duplicate index %s, ignoring .debug_names.Section .debug_names in %s has abbreviation_table of size %s vs. written as %u, ignoring .debug_names.dwarf2_initialize_objfilereadnow requestedusing_index already setre-using shared debug names tablere-using shared index tablere-using shared partial symtabscould not read '.debug_names' section from %s; skippingvoid create_cus_from_debug_names(dwarf2_per_bfd*, const mapped_debug_names&, const mapped_debug_names&)Section .debug_aranges in %s has duplicate debug_info_offset %s, ignoring .debug_aranges.Section .debug_aranges in %s entry at offset %s length %s exceeds section length %s, ignoring .debug_aranges.Section .debug_aranges in %s entry at offset %s has unsupported version %d, ignoring .debug_aranges.Section .debug_aranges in %s entry at offset %s debug_info_offset %s does not exists, ignoring .debug_aranges.Section .debug_aranges in %s entry at offset %s address_size %u is invalid, ignoring .debug_aranges.Section .debug_aranges in %s entry at offset %s segment_selector_size %u is not supported, ignoring .debug_aranges.Section .debug_aranges in %s entry at offset %s address list is not properly terminated, ignoring .debug_aranges.found debug namesfound gdb index from filefound gdb index from cacheBuilding psymtabs of objfile %s ...dwarf2_build_psymtabs_hardvoid build_type_psymtabs(dwarf2_per_objfile*)per_objfile->per_bfd->type_unit_groups == NULLBuilding type unit groups ...build_type_psymtabsType unit statistics:print_tu_stats %d TUs %d uniq abbrev tables %d symtabs from stmt_list entries %d symtab sharers %d type units without a stmt_list %d all_type_units reallocsDone building psymtabs of %svoid queue_and_load_all_dwo_tus(dwarf2_cu*)get_dwp_file (cu->per_objfile) == nullptrExpanding one or more symtabs of objfile %s ...process_queueTU %s at offset %sCU at offset %sExpanding symtab of %svoid process_full_type_unit(dwarf2_cu*, language)Done expanding %sDone expanding symtabs of %s.compunit_symtab* dw2_instantiate_symtab(dwarf2_per_cu_data*, dwarf2_per_objfile*, bool)bool dw2_expand_symtabs_matching_one(dwarf2_per_cu_data*, dwarf2_per_objfile*, gdb::function_view, gdb::function_view)symtab != nullptrvoid dw2_symtab_iter_init(dw2_symtab_iterator*, dwarf2_per_objfile*, gdb::optional, domain_enum, offset_type)!index->symbol_name_slot_invalid (namei).gdb_index entry has bad CU index [in module %s](Internal error: pc %s in read in CU, but not in symtab.)virtual compunit_symtab* dwarf2_base_index_functions::find_pc_sect_compunit_symtab(objfile*, bound_minimal_symbol, CORE_ADDR, obj_section*, int)result != NULLvirtual void dwarf2_psymtab::expand_psymtab(objfile*)!readin_p (objfile)get_compunit_symtab (objfile) != nullptr.debug_abbrev.dwo.zdebug_abbrev.dwo.debug_info.dwo.zdebug_info.dwo.debug_line.dwo.zdebug_line.dwo.debug_loc.dwo.zdebug_loc.dwo.debug_loclists.dwo.zdebug_loclists.dwo.zdebug_macinfo.dwo.zdebug_macro.dwo.debug_rnglists.dwo.zdebug_rnglists.dwo.debug_str.dwo.zdebug_str.dwo.debug_str_offsets.dwo.zdebug_str_offsets.dwo.debug_types.dwo.zdebug_types.dwo.debug_cu_index.zdebug_cu_index.debug_tu_index.zdebug_tu_index.debug_info.zdebug_info.debug_abbrev.zdebug_abbrev.debug_line.zdebug_line.debug_loc.zdebug_loc.debug_loclists.zdebug_loclists.zdebug_macinfo.zdebug_macro.zdebug_str.debug_str_offsets.zdebug_str_offsets.debug_line_str.zdebug_line_str.debug_ranges.zdebug_ranges.debug_rnglists.zdebug_rnglists.debug_types.zdebug_types.debug_addr.zdebug_addr.debug_frame.zdebug_frame.eh_frame.gdb_index.zgdb_index.zdebug_names.debug_aranges.zdebug_arangesdwarf_block* attribute::as_block() const../../gdb/dwarf2/attribute.hULONGEST attribute::as_signature() constLONGEST attribute::as_signed() constform_is_signed ()ULONGEST attribute::as_unsigned_reprocess() constform_requires_reprocessing ()ULONGEST attribute::as_unsigned() constform_is_unsigned ()bool attribute::canonical_string_p() constform_is_string ()void attribute::set_string_noncanonical(const char*)void attribute::set_string_canonical(const char*)void attribute::set_block(dwarf_block*)void attribute::set_signed(LONGEST)form == DW_FORM_sdata || form == DW_FORM_implicit_constvoid attribute::set_unsigned(ULONGEST)void attribute::set_unsigned_reprocess(ULONGEST)void attribute::set_address(CORE_ADDR)form == DW_FORM_addr || ((form == DW_FORM_addrx || form == DW_FORM_GNU_addr_index) && requires_reprocessing)address base attribute (offset %s) as wrong formdwarf2_queue_guard::~dwarf2_queue_guard()dwarf2_queue_guard::dwarf2_queue_guard(dwarf2_per_objfile*)!m_per_objfile->per_bfd->queue.has_value ()22quick_symbol_functions^ L17mapped_index_base^,L12mapped_index^HL@L18mapped_debug_names^dL@L17lazy_dwarf_reader^LvP22dwarf2_include_psymtab^L@K@L&XL&0H0|L&0&L88 H  0 < h l L x  @'&xcćLT9t9(D(t(' L(,(L$'L$'x&&&DW_FORM_GNU_str_index or DW_FORM_strxL99h%|LLLLLLLLLLhL+LL?LQLeLzLLLLȀLـLLL LLDW_AT_str_offsetsDW_FORM_GNU_str_index:_vptrGDB4L'(L$'"$'x&&&-L9LFLTLcLoL|LLLLLL{LāLKҁLށLLLL&L4LCLSLdLqLLLLLLLȂLtKԂLLL14dwarf2_psymtab^L@K27dwarf2_base_index_functions^̊L$L16dwarf2_gdb_index^LL24dwarf2_debug_names_index^LLLL$'$'x&&&dwarf2_section_info* dwarf2_section_info::get_containing_section() const../../gdb/dwarf2/section.cbfd* dwarf2_section_info::get_bfd_owner() constsection->s.section != nullptrasection* dwarf2_section_info::get_bfd_section() constconst char* dwarf2_section_info::get_name() constsectp != NULLconst char* dwarf2_section_info::get_file_name() constabfd != nullptrdebug info runs off end of %s section [in module %s]int dwarf2_section_info::get_flags() constvoid dwarf2_section_info::read(objfile*)Dwarf Error: DWP format V2 with relocations is not supported in section %s [in module %s]virtual_offset + size <= containing_section->sizecontaining_section->buffer != NULLabfd != NULLDwarf Error: Can't read DWARF data in section %s [in module %s]Dwarf Error: %s used without required sectionDwarf Error: %s used without %s section [in module %s]%s pointing outside of %s section [in module %s]DW_%s_DW_AT_HP_block_indexvoid elf_gnu_ifunc_resolver_stop(breakpoint*)../../gdb/elfread.cb->type == bp_gnu_ifunc_resolverb_return->type == bp_gnu_ifunc_resolver_returnb_return->loc != NULL && b_return->loc->next == NULLframe_id_p (b_return->frame_id)b_return->related_breakpoint == b_return@pltgnu-indirect-function "%s" has changed its resolved function_address from %s to %svoid elf_gnu_ifunc_resolver_return_stop(breakpoint*)b->type == bp_gnu_ifunc_resolver_returnhandle_inferior_event: Invalid gnu-indirect-function breakpoint type %dcurrent_program_space == b->pspace || b->pspace == NULL%s@got.pltint elf_gnu_ifunc_resolve_by_cache(const char*, CORE_ADDR*)entry_p != NULL.mdebug.ctfReading minimal symbols of objfile %s ... ... minimal symbols previously read Can't read symbols from %s: %s.got.pltDone reading minimal symbols. Loadable section "%s" outside of ELF segments in %s@pDpy.&<&L8}}pXw0tobjc_msg_lookuprespondsToSelector:respondsTo:no 'respondsTo:' or 'respondsToSelector:' methodmethodForSelector:methodFor:no 'methodFor:' or 'methodForSelector:' methodTarget does not respond to this message selector.method address has symbol information with non-function type; skippingExpression of type other than "method returning ..." used as a methodAttempt to take address of register or constant.fake_method::fake_method(type_instance_flags, int, type**)../../gdb/eval.cnum_types == 0Cannot evaluate function -- may be inlinedXmethod is missing return type.Expression of type other than "Function returning ..." used as functionSymbol "%s" does not have any specific entry valueRegister $%s not available.Value of register %s not available.value* eval_op_member(type*, expression*, noside, value*, value*)value_type (arg2)->code () == TYPE_CODE_PTRnon-pointer-to-member value used in pointer-to-member constructNon-integral right operand for "@" operator.Attempt to dereference pointer to member without an objectcould not determine alignment of typeAttempt to use a type name as an expressiontoo many initializersdon't know which variant you want to set(power)set type with unknown sizeincompatible POWERSET tuple elementsPOWERSET tuple element out of rangeInternal error in eval_type.virtual value* expr::scope_operation::evaluate_funcall(type*, expression*, noside, const std::vector >&)Call to overloaded function %s requires `this' pointerNon-pointer-to-member value used in pointer-to-member constructstructurestructure pointervoid refcounted_object::decref()N4expr23tuple_holding_operationIJP4typeNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEEEE^dLpLN4expr24maybe_constant_operationIJP4typeNSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEEEEE^ЙLęLN4expr23tuple_holding_operationIJ12block_symbolEEE^tL4\4Dȕdz D `LDȕdg  `ȡLDȕd8$`Erroneous arithmetic operation.Event loop debugging is %s. void set_debug_event_loop_command(const char*, int, cmd_list_element*)../../gdb/event-top.cInvalid debug event look kind value.error detected on stdin Could not kill the program being debuggedvoid gdb_rl_callback_handler_remove()current_ui == main_uivoid change_line_handler(int)void gdb_rl_callback_handler_install(const char*)!callback_handler_installedvoid gdb_rl_callback_handler_reinstall()ui-%dsigtermsigquitsighupsigfpesigtstpControl whether to show event loop-related debug messages.Show event-loop debugging.Set event-loop debugging. post-server double prompt pre-prompt prompt offall-except-uiallBad switch.../../gdb/exceptions.cCan't create a corefileexec-file-mismatch handling is currently "%s". Writing into executable and core files is %s. warnUnrecognized exec-file-mismatch setting: "%s"../../gdb/exec.cvoid program_space::remove_target_sections(void*)target_xfer_status section_table_xfer_memory_partial(gdb_byte*, const gdb_byte*, ULONGEST, ULONGEST, ULONGEST*, const target_section_table&, gdb::function_view)len != 0 `%ps', file type %s. Cannot find section for the entry point of %ps. Entry point: %s @ %s in %ps Must specify section name and its virtual addressSection %s not foundUse FILE as program to be debugged. It is read for its symbols, for getting the contents of pure memory, and it is the program executed when you use the `run' command. If FILE cannot be found as specified, your execution directory path ($PATH) is searched for a command of that name. No arg means to have no executable file and no symbols.Use FILE as program for getting contents of pure memory. If FILE cannot be found as specified, your execution directory path is searched for a command of that name. No arg means have no executable file.Change the base address of section SECTION of the exec file to ADDR. This can be used if the exec file does not contain section addresses, (such as in the a.out format), or when the addresses specified in the file itself are wrong. Each section must be changed separately. The ``info files'' command lists all the sections and their addresses.Show writing into executable and core files.Set writing into executable and core files.exec-file-mismatchSpecifies how to handle a mismatch between the current exec-file loaded by GDB and the exec-file automatically determined when attaching to a process: ask - warn the user and ask whether to load the determined exec-file. warn - warn the user, but do not change the exec-file. off - do not check for mismatch. GDB detects a mismatch by comparing the build IDs of the files. If the user confirms loading the determined exec-file, then its symbols will be loaded as well.Show exec-file-mismatch handling (ask|warn|off).Set exec-file-mismatch handling (ask|warn|off).target_xfer_status section_table_read_available_memory(gdb_byte*, ULONGEST, ULONGEST, ULONGEST*)end - offset <= lenNo executable file now. writing into executable files is not supported for %s sysroots"%s": could not open as an executable file: %s.void exec_file_attach(const char*, int)current_program_space->exec_filename == nullptr"%s": not in executable format: %sNo executable has been specified and target does not support determining executable automatically. Try using the "file" command.Build ID mismatch between current exec-file %ps and automatically determined exec-file %ps exec-file-mismatch handling is currently "%s"loading %ps %sA program is being debugged already. Are you sure you want to change the file? File not changed.No executable file name was specifiedvoid program_space::add_target_sections(objfile*)Local exec fileUse an executable file as a target. Specify the filename of the executable file.FHYLiLVL2Q11exec_target^شLTRLl%t%x%`%t$''\(((4(D((L((((\((,( ( (!("(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(8(x9(:(:(L;(;(<(=(0>($''@?( @((A(0B(8C(@D(TE(\F(dG((H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(yTyy$yU(`V(@W( X(Y(Y(Z([(P\(0](_( a(b( Xf(8g(g(h(\i(0j(l(m(o(p(q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(%*sFloat: %*sOperation: %s %*sString: %s %*sType: %*sConstant: %s %*sInternalvar: $%s %*sSymbol: %s %*sMinsym %s in objfile %s %*sBlock: %p %*sBlock symbol: %*sType flags: const %*sC string flags: wide u16 u32 ordinary %*sRange:low-default high-default high-exclusive has-strideOP_NULLBINOP_ADDBINOP_SUBBINOP_MULBINOP_DIVBINOP_REMBINOP_MODBINOP_LSHBINOP_RSHBINOP_LOGICAL_ANDBINOP_LOGICAL_ORBINOP_BITWISE_ANDBINOP_BITWISE_IORBINOP_BITWISE_XORBINOP_EQUALBINOP_NOTEQUALBINOP_LESSBINOP_GTRBINOP_LEQBINOP_GEQBINOP_REPEATBINOP_ASSIGNBINOP_COMMABINOP_SUBSCRIPTBINOP_EXPBINOP_MINBINOP_MAXSTRUCTOP_MEMBERSTRUCTOP_MPTRTYPE_INSTANCEBINOP_INTDIVBINOP_ASSIGN_MODIFYBINOP_VALBINOP_CONCATTERNOP_CONDTERNOP_SLICEMULTI_SUBSCRIPTOP_LONGOP_FLOATOP_VAR_VALUEOP_VAR_ENTRY_VALUEOP_VAR_MSYM_VALUEOP_LASTOP_REGISTEROP_INTERNALVAROP_FUNCALLOP_OBJC_MSGCALLOP_COMPLEXOP_STRINGOP_ARRAYUNOP_CASTUNOP_CAST_TYPEUNOP_DYNAMIC_CASTUNOP_REINTERPRET_CASTUNOP_MEMVALUNOP_MEMVAL_TYPEUNOP_NEGUNOP_LOGICAL_NOTUNOP_COMPLEMENTUNOP_INDUNOP_ADDRUNOP_PREINCREMENTUNOP_POSTINCREMENTUNOP_PREDECREMENTUNOP_POSTDECREMENTUNOP_SIZEOFUNOP_ALIGNOFUNOP_PLUSUNOP_ABSUNOP_HIGHOP_BOOLSTRUCTOP_STRUCTSTRUCTOP_PTRSTRUCTOP_ANONYMOUSOP_THISOP_OBJC_SELECTOROP_SCOPEOP_FUNC_STATIC_VAROP_OBJC_NSSTRINGOP_RANGEOP_ADL_FUNCOP_TYPEOFOP_DECLTYPEOP_TYPEIDOP_RUST_ARRAYBINOP_IN_BOUNDSTERNOP_IN_RANGEOP_ATR_FIRSTOP_ATR_LASTOP_ATR_LENGTHOP_ATR_POSOP_ATR_SIZEOP_ATR_TAGOP_ATR_VALUNOP_QUALUNOP_IN_RANGEOP_AGGREGATEOP_F77_UNDETERMINED_ARGLISTUNOP_FORTRAN_KINDUNOP_FORTRAN_FLOORUNOP_FORTRAN_CEILINGUNOP_FORTRAN_ALLOCATEDUNOP_FORTRAN_LOCBINOP_FORTRAN_CMPLXBINOP_FORTRAN_MODULOFORTRAN_LBOUNDFORTRAN_ASSOCIATED-L5L?LILSL]LgLqL{LLLLL̹L޹LLLLLL"L/Lops->initialized != NULLScripting in the "%s" language is not supported in this copy of GDB.void (* ext_lang_script_sourcer(const extension_language_defn*))(const extension_language_defn*, FILE*, const char*)extlang->script_ops->script_sourcer != NULLvoid (* ext_lang_objfile_script_sourcer(const extension_language_defn*))(const extension_language_defn*, objfile*, FILE*, const char*)extlang->script_ops->objfile_script_sourcer != NULLbool ext_lang_auto_load_enabled(const extension_language_defn*)extlang->script_ops->auto_load_enabled != NULLvoid eval_ext_lang_from_control_command(command_line*)unknown extension language in command_linechar* apply_ext_lang_type_printers(ext_lang_type_printers*, type*)bad return from apply_type_printersint apply_ext_lang_val_pretty_printer(value*, ui_file*, int, const value_print_options*, const language_defn*)bad return from apply_val_pretty_printerint breakpoint_ext_lang_cond_says_stop(breakpoint*)stop == EXT_LANG_BP_STOP_UNSETError while looking for matching xmethod workers defined in %s.Error while looking for arg types of a xmethod worker defined in %s.Error while fetching result type of an xmethod worker defined in %s.-gdb.gdbvoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {const char*}]FvPKcEl^LPFvPKcE^LL<{PNL KLLL, ,Overflow on numeric constant..true..false.int f_yylex()f-exp.y!fortran_operators[i].case_sensitivekind value out of rangeint f_yyparse()n == 1 || n == 2(yyvsp[-4].opcode) == FORTRAN_LBOUND || (yyvsp[-4].opcode) == FORTRAN_UBOUNDunhandled intrinsicunsupported kind %d for type %svirtual int f_language::parser(parser_state*) constcomplex_16complex_32integer_2logical_1logical_2logical_8complex_8logicalreal_16real_8precisionfloorceilingmodulocmplxlbounduboundshape.and..or..not..eq..eqv..neqv..xor..ne..le..ge..gt..lt.BOOLEAN_LITERALINT_S2_KEYWORDLOGICAL_S1_KEYWORDLOGICAL_S2_KEYWORDLOGICAL_S8_KEYWORDLOGICAL_KEYWORDREAL_KEYWORDREAL_S8_KEYWORDREAL_S16_KEYWORDCOMPLEX_KEYWORDCOMPLEX_S8_KEYWORDCOMPLEX_S16_KEYWORDCOMPLEX_S32_KEYWORDBOOL_ANDBOOL_ORBOOL_NOTDOUBLEPRECISIONCHARACTERUNOP_INTRINSICUNOP_OR_BINOP_INTRINSICLESSTHANGREATERTHANone_or_two_argscomplexnumranges not allowed in this contextN4expr23fortran_cmplx_operationE^LOGN4expr23tuple_holding_operationIJ10range_flagSt10unique_ptrINS_9operationESt14default_deleteIS3_EES6_S6_EEE^LpLN4expr23fortran_range_operationE^lL`LN4expr14unop_operationIL10exp_opcode99EXadL_Z14eval_op_f_kindP4typeP10expression6nosideS1_P5valueEEEE^LLQGN4expr14unop_operationIL10exp_opcode110EXadL_Z20eval_op_f_associatedP4typeP10expression6nosideS1_P5valueEEEE^LLQGN4expr15binop_operationIL10exp_opcode110EXadL_Z20eval_op_f_associatedP4typeP10expression6nosideS1_P5valueS8_EEEE^LTPGN4expr14unop_operationIL10exp_opcode111EXadL_Z20eval_op_f_array_sizeP4typeP10expression6nosideS1_P5valueEEEE^ LLQGN4expr15binop_operationIL10exp_opcode111EXadL_Z20eval_op_f_array_sizeP4typeP10expression6nosideS1_P5valueS8_EEEE^LTPGN4expr14unop_operationIL10exp_opcode68EXadL_Z13eval_op_f_absP4typeP10expression6nosideS1_P5valueEEEE^LLQGN4expr14unop_operationIL10exp_opcode100EXadL_Z15eval_op_f_floorP4typeP10expression6nosideS1_P5valueEEEE^|LLQGN4expr14unop_operationIL10exp_opcode101EXadL_Z14eval_op_f_ceilP4typeP10expression6nosideS1_P5valueEEEE^LLQGN4expr14unop_operationIL10exp_opcode102EXadL_Z19eval_op_f_allocatedP4typeP10expression6nosideS1_P5valueEEEE^dLLQGN4expr14unop_operationIL10exp_opcode103EXadL_Z14eval_op_f_rankP4typeP10expression6nosideS1_P5valueEEEE^LLQGN4expr14unop_operationIL10exp_opcode104EXadL_Z21eval_op_f_array_shapeP4typeP10expression6nosideS1_P5valueEEEE^PLLQGN4expr14unop_operationIL10exp_opcode105EXadL_Z13eval_op_f_locP4typeP10expression6nosideS1_P5valueEEEE^LLQGN4expr15binop_operationIL10exp_opcode6EXadL_Z13eval_op_f_modP4typeP10expression6nosideS1_P5valueS8_EEEE^@LTPGN4expr15binop_operationIL10exp_opcode107EXadL_Z16eval_op_f_moduloP4typeP10expression6nosideS1_P5valueS8_EEEE^LTPGGĩDȕd0 `LH~h~PxDȕduH``LDȕdtzz`L0{`{uDȕdtz uz`L{{ xDȕd8@u`L|(|wDȕd8@u`L~~zDȕd@uH`|LH|h|wDȕd8@xu`L~~yDȕd@puH`pL~(~@wDȕd8@hu`L}}vDȕd8@`u`XL}}vDȕd8@Xu`LH}h}tvDȕd8@Pu`DL}(}0vDȕd8@Hu`L||uDȕd8@@u`4L||uDȕd8@8u`LHh0yDȕd@0uH`$L(xDȕd@(uH`"L)LLLLL'L'L(L(.gI'L(ogI( L+vgI+%L,zgI,*L*V*/L)NI)>4jI=#\2n==j$===<->?97'8:A)*6,+@  !"#$%&(./012345;=>''>->>!?? !9#">;<-> .>, ??459 ??>> )?@ABCDEFGHIJKLMNOPQRS456789:;<?>`a??d789:;<>Z 9:;<>}6789:;<>"$%&VWX-89>@A  "$%&"-$%&-89>@A89>@A !"$%&- 89>@"$%&- 89 >@"$%&-"$%&89>@> @!-9#>?)+,-./0123456789:;<>A#)+,-./0123456789:;<>A#)+,-./0123456789:;<>A#')+,-./0123456789:;<>?#)+,-./0123456789:;<>?#)+,-./0123456789:;<>?#)+,-./0123456789:;<>?#')+,-./0123456789:;<>#')+,-./0123456789:;<>#)+,-./0123456789:;<>+,-./0123456789:;<>!+,-./0123456789:;<>,-./0123456789:;<>-./0123456789:;<>./0123456789:;<>0123456789:;<>&.(4- V/56789W=0>VW\[YZ]^_`abcXA@FGE fdge  KIHMR#9:<;876014523./(,-*+)j'%LPJShQB "$&NTi!O $&0/:Ylosw{ "&*.26:>BFJNSW[dku~  $+/ !"$%&-89>@CDELMNRU>E>E  >>>EEEEKME#)+,-./0123456789:;<>-9>OPQMEEEF'???EEEEEEEEEEEEEEEEEEEEE THOO ?MOS>Q???'EGEE AEIJ)?'?E'?AEA'?M?EEAAEEJ?EEAEBCCDEEEEEEEEFEGGHEEEIIIIIJJJJJJJJKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEELMNNOOOOOPPPPPQQRRRRRRRRRRRRRRRRRRRSSTU<$%:`};')YZ[*|+fortranFortranDebugging of Fortran array slicing is %s. Repacking of Fortran array slices is %s. logical*1integer*2integer*8logical*2logical*8logical*4real*8real(kind=16)real*16complex*8complex*16complex*32LBOUND can only be applied to arraysUBOUND can only be applied to arraysvoid fortran_array_repacker_base_impl::finish_dimension(bool, bool)../../gdb/f-lang.cm_mark != nullptrunrecognized character typeCan't get dimensions for a non-array typeASSOCIATED can only be applied to pointersarguments to associated must be of same type and kindvalue* fortran_bounds_all_dims(bool, gdbarch*, value*)dst_offset + TYPE_LENGTH (value_type (v)) <= TYPE_LENGTH (value_type (result))TYPE_LENGTH (value_type (v)) == elm_lenLBOUND second argument should be an integerUBOUND second argument should be an integerLBOUND dimension must be from 1 to %dUBOUND dimension must be from 1 to %dvalue* fortran_bounds_for_dimension(bool, gdbarch*, value*, value*)failed to find matching dimensionfailed to get range boundsABS of type %s not supportednon-matching types for parameters to MOD ()calling MOD (N, 0) is undefinedMOD of type %s not supportedargument to CEILING must be of type floatargument to FLOOR must be of type floatnon-matching types for parameters to MODULO ()MODULO of type %s not supportedargument to kind must be an intrinsic typeALLOCATED can only be applied to arraysvalue* eval_op_f_rank(type*, expression*, noside, exp_opcode, value*)op == UNOP_FORTRAN_RANKvalue* eval_op_f_array_shape(type*, expression*, noside, exp_opcode, value*)opcode == UNOP_FORTRAN_SHAPEThe array passed to SHAPE must be allocated or associatedfailed to find array boundsvalue* fortran_array_shape(gdbarch*, const language_defn*, value*)SIZE can only be applied to arraysSIZE can only be used on allocated/associated arraysDIM argument to SIZE must be an integerDIM argument to SIZE must be between 1 and %dvalue* eval_op_f_array_size(type*, expression*, noside, exp_opcode, value*, value*)opcode == FORTRAN_ARRAY_SIZEvalue* eval_op_f_array_size(type*, expression*, noside, exp_opcode, value*)Prefix command for changing Fortran-specific settings.Generic command for showing Fortran-specific settings.repack-array-slicesWhen the user requests a slice of a Fortran array then we can either return a descriptor that describes the array in place (using the original array data in its existing location) or the original data can be repacked (copied) to a new location. When the content of the array slice is contiguous within the original array then the result will never be repacked, but when the data for the new array is non-contiguous within the original array repacking will only be performed when this setting is on.Show whether non-contiguous array slices are repacked.Enable or disable repacking of non-contiguous array slices.fortran-array-slicingWhen on, debugging of Fortran array slicing is enabled.Show debugging of Fortran array slicing.Set debugging of Fortran array slicing.CORE_ADDR fortran_adjust_dynamic_array_base_address_hack(type*, CORE_ADDR)no such vector element (vector not associated)no such vector element (vector not allocated)array not associatedarray not allocatedWrong number of subscriptsProcessing array access: stride must not be 0|-> Range access | |-> Type: %s | |-> Array: | | |-> Low bound: %s | | |-> High bound: %s | | |-> Bit stride: %s | | |-> Byte stride: %s | | |-> Type size: %s | | '-> Target type size: %s | |-> Accessing: | | '-> Element stride: %s array subscript out of boundsincorrect stride and boundary combination| '-> Results: | |-> Offset = %s | |-> Elements = %s | |-> Low bound = %s | |-> High bound = %s | |-> Byte stride = %s | |-> Last element = %s | |-> Remainder = %s | '-> Contiguous = %s |-> Index access | '-> Accessing: | '-> Index: %s no such vector element'-> Final result: |-> Type: %s |-> Total offset: %s |-> Base address: %s fortran_array_repacker_impl::fortran_array_repacker_impl(type*, CORE_ADDR, LONGEST, value*, value*)!value_lazy (val)cannot subscript arrays that are not in memoryCannot perform substring on this type.f.F.for.FOR.ftn.FTN.fpp.FPP.f90.F90.f95.F95.f03.F03.f08.F08can only compute offsets for arrays and stringsunable to read array bounds4_void fortran_array_repacker_base_impl::start_dimension(bool)m_mark == nullptrN4expr23tuple_holding_operationIJ10exp_opcodeSt10unique_ptrINS_9operationESt14default_deleteIS3_EEEEE^LpLxLDȕdP`(L+L.L3L8L=LBLGLLLQLVL[L`LeLjLoLLx)$/, wP+\ ))\xys<<X* *  (@*w810f_language^LNN4expr20fortran_undeterminedE^LGN4expr18fortran_bound_1argE^LxLN4expr18fortran_bound_2argE^$MRGN4expr26fortran_structop_operationE^LMLLDȕd0x`MDȕdP8`@M@htDȕdx@`pM DȕdHH@` )%*s%s%s%*sPTR TO -> ( %*sREF TO -> ( %*s%s%*sstruct %*s%*scharactercharacter*%s%*scharacter*(*)%*sType, C_Union :: %*sType %*sEnd Type %*smodule %sInvalid type code (%d) in symbol table., allocatableNo symbol table info available. void info_common_command_for_block(const block*, const char*, int*)../../gdb/f-valprint.cSYMBOL_CLASS (sym) == LOC_COMMON_BLOCKContents of F77 COMMON block '%s': Contents of blank COMMON block: No common block '%s'. No common blocks. Lower bound may not be '*' in F77Print out the values contained in a Fortran COMMON block..FALSE..TRUE.cK6M}MMM W.WsLOThe assumed file system kind for target reported file names is "%s" (currently "%s"). The assumed file system kind for target reported file names is "%s". target-file-system-kindIf `unix', target file names (e.g., loaded shared library file names) starting the forward slash (`/') character are considered absolute, and the directory separator character is the forward slash (`/'). If `dos-based', target file names starting with a drive letter followed by a colon (e.g., `c:'), are also considered absolute, and the backslash (`\') is also considered a directory separator. Set to `auto' (which is the default), to let GDB decide, based on its knowledge of the target operating system.Show assumed file system kind for target reported file names.Set assumed file system kind for target reported file names.unixdos-basedautoGM8M=MSearch memory for a sequence of bytes. Usage: find [/SIZE-CHAR] [/MAX-COUNT] START-ADDRESS, END-ADDRESS, EXPR1 [, EXPR2 ...] find [/SIZE-CHAR] [/MAX-COUNT] START-ADDRESS, +LENGTH, EXPR1 [, EXPR2 ...] SIZE-CHAR is one of b,h,w,g for 8,16,32,64 bit values respectively, and if not specified the size is taken from the type of the expression in the current language. The two-address form specifies an inclusive range. Note that this means for example that in the case of C-like languages a search for an untyped 0x42 will search for "(int) 0x42" which is typically four bytes, and a search for a string "hello" will include the trailing '\0'. The null terminator can be removed from searching by using casts, e.g.: {char[5]}"hello". The address of the last match is stored as the value of "$_". Convenience variable "$numfound" is set to the number of matches.Missing search parameters.Invalid size granularity.Empty search range. Invalid length.Search space too large.Invalid search space, end precedes start.Overflow in address range computation, choose smaller range.Missing search pattern.Search space too small to contain pattern.numfoundPattern not found. %d pattern%s found. int minsym_lookup_iterator_cb(objfile*, void*)../../gdb/findvar.cdata->result.minsym == NULLextract_typed_address: type is not a pointer or referencestore_typed_address: type is not a pointer or referencevalue* value_of_register_lazy(frame_info*, int)frame_id_p (get_frame_id (next_frame))symbol_needs_kind symbol_read_needs(symbol*)value* read_var_value(symbol*, const block*, frame_info*)lang != NULLvoid read_frame_register_value(value*, frame_info*)VALUE_LVAL (value) == lval_registervirtual value* language_defn::read_var_value(symbol*, const block*, frame_info*) constCannot read `%s' without registersNo frame is currently executing in specified blockNo frame is currently executing in block %s.Unknown argument list address for `%s'.Cannot look up value of a typedef `%s'.Value of register variable not available for `%s'.flavour_name != NULLMissing %s symbol "%s".Cannot look up value of a botched symbol `%s'.Invalid register #%d, expecting 0 <= # < %dThat operation is not available on integers of more than %d bytes.Use of shell to start subprocesses is %s. void prefork_hook(const char*)../../gdb/fork-child.csaved_ui == NULLvoid postfork_hook(pid_t)saved_ui != NULLsetpgrp failed in childexec-wrapperShow the wrapper for running programs.Set a wrapper for running programs. The wrapper prepares the system and environment for the new program.Disable use of an execution wrapper.startup-with-shellShow use of shell to start subprocesses.Set use of shell to start subprocesses. The default is on.   trying unwinder "%s"frame_unwind_try_unwindercaught exception: %sframe_unwind_find_by_frameenterthis_frame=%dframe_unwind_find_by_frame failed../../gdb/frame-unwind.cFrame debugging is %s. An upper bound on the number of backtrace levels is %s. Whether backtraces should continue past the entry point of a program is %s. Whether backtraces should continue past "main" is %s. hashval_t frame_addr_hash(const void*)../../gdb/frame.cf_id.stack_status != FID_STACK_INVALID || f_id.code_addr_p || f_id.special_addr_pthis_frame=%d -> %sframe_debug_got_null_framethis_frame=nullptr -> %sbool frame_stash_add(frame_info*)bool get_frame_pc_masked(const frame_info*)frame->next != nullptrframe->next->prev_pc.status == CC_VALUEframe_info* get_next_frame_sentinel_okay(frame_info*)this_frame != NULLthis_frame != sentinel_frameprogram_space* frame_unwind_program_space(frame_info*)this_framenext_frame=%d -> %sframe_unwind_archframe_unwind_pcPC not availablePC not savedunexpected prev_pc status: %dthis_frame=%d -> this_frame=%d -> CORE_ADDR get_frame_pc(frame_info*)this_frame=%d -> unavailableget_frame_func_if_availablebool get_frame_func_if_available(frame_info*, CORE_ADDR*)next_frame->prev_func.status == CC_VALUEbool get_frame_pc_if_available(frame_info*, CORE_ADDR*)symtab_and_line find_frame_sal(frame_info*)language get_frame_language(frame_info*)frame!= NULLInvalid frame stop reasonconst char* frame_stop_reason_string(frame_info*)fi->prev_pfi->prev == NULLvoid frame_cleanup_after_sniffer(frame_info*)frame->prologue_cache == NULL!frame->prev_pframe->this_id.p != frame_id_status::COMPUTEDvoid frame_prepare_for_sniffer(frame_info*, const frame_unwind*)frame->unwind == NULL!stackstack=stack=stack=stack=,artificial=l=%s -> %dframe_id_pvoid restore_selected_frame(frame_id, int)frame_level != 0(frame_level == -1 && !frame_id_p (frame_id)) || (frame_level != -1 && frame_id_p (frame_id))l=%s, r=%s -> %dframe_id_eqbool frame_id_inner(gdbarch*, frame_id, frame_id)l.code_addr_p && r.code_addr_pis l=%s inner than r=%s? %dframe_id_inner[PAC]{level=%d,type=%s,type=,unwind=%p,unwind=,pc=,pc=%s%s,pc=,pc=,id=,id=,id=%s,func=%sfunc= -> %screate_sentinel_frameaddr=%s, pc=%screate_new_frameframe_unwind_register_valuevalue* frame_unwind_register_value(frame_info*, int)frame=%d, regnum=%d(%s) -> register=%d computed lazy bytes=void frame_register_unwind(frame_info*, int, int*, int*, lval_type*, CORE_ADDR*, int*, gdb_byte*)optimizedp != NULLlvalp != NULLaddrp != NULLrealnump != NULLvoid frame_register(frame_info*, int, int*, int*, lval_type*, CORE_ADDR*, int*, gdb_byte*)frame != NULL && frame->next != NULLAttempt to assign to a register that was not saved.Attempt to assign to an unmodifiable value.Register %d was not savedRegister %d is not availablevoid frame_register_unwind_location(frame_info*, int, int*, lval_type*, CORE_ADDR*, int*)this_frame == NULL || this_frame->level >= 0LONGEST frame_unwind_register_signed(frame_info*, int)ULONGEST frame_unwind_register_unsigned(frame_info*, int)Bad debug information detected: Attempt to read %d bytes from registers.bool get_frame_register_bytes(frame_info*, int, CORE_ADDR, gdb::array_view, int*, int*)void put_frame_register_bytes(frame_info*, int, CORE_ADDR, gdb::array_view)compute_frame_idvoid compute_frame_id(frame_info*)fi->this_id.p == frame_id_status::NOT_COMPUTEDfi=%dframe_id_p (fi->this_id.value)frame_id get_frame_id(frame_info*)fi->this_id.p != frame_id_status::COMPUTINGfi->level == 0stashedgeneration=%dreinit_frame_cacheget_prev_frame_raw -> nullptr // this frame has same IDget_prev_frame_if_no_cycleget_prev_frame_always_1frame_info* get_prev_frame_always_1(frame_info*) -> %s // cached -> nullptr // %s__morestack -> nullptr // this frame ID is inner -> nullptr // no saved PCNo stack.No memory.frame_info* get_current_frame()current_frame != NULLCORE_ADDR frame_unwind_caller_pc(frame_info*)gdbarch* frame_unwind_caller_arch(frame_info*)unwind_stop_reason get_frame_unwind_stop_reason(frame_info*)get_prev_frameframe_info* get_prev_frame(frame_info*)bool inside_main_func(frame_info*)block != nullptrinside main funcbacktrace limit exceededinside entry funczero PCCannot pop the initial frame.Cannot find the caller frame.void lookup_selected_frame(frame_id, int)frame_level > 0Couldn't restore frame #%d in current thread. Bottom (innermost) frame selected:frame_info* get_selected_frame(const char*)selected_frame != NULLSet backtrace specific variables. Configure backtrace variables such as the backtrace limitbacktraceShow backtrace specific variables. Show backtrace variables such as the backtrace limit.No more than the specified number of frames can be displayed or examined. Literal "unlimited" or zero means no limit.Show the upper bound on the number of backtrace levels.Set an upper bound on the number of backtrace levels.When non-zero, frame specific internal debugging is enabled.Show frame debugging.Set frame debugging.past-mainSet whether backtraces should continue past "main".Show whether backtraces should continue past "main".Normally the caller of "main" is not of interest, so GDB will terminate the backtrace at "main". Set this if you need to see the rest of the stack trace.past-entrySet whether backtraces should continue past the entry point of a program.Show whether backtraces should continue past the entry point of a program.Normally there are no callers beyond the entry point of a program, so GDB will terminate the backtrace there. Set this if you need to see the rest of the stack trace.no reasonunwinder did not report frame IDoutermostnot enough registers or memory available to unwind furtherprevious frame inner to this frame (corrupt stack?)previous frame identical to this frame (corrupt stack?)frame did not save the PCmemory error while unwindingUNWIND_NO_REASONUNWIND_NULL_IDUNWIND_OUTERMOSTUNWIND_UNAVAILABLEUNWIND_INNER_IDUNWIND_SAME_IDUNWIND_NO_SAVED_PCUNWIND_MEMORY_ERRORNORMAL_FRAMETAILCALL_FRAMESIGTRAMP_FRAMEARCH_FRAMESENTINEL_FRAMEvoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {target_ops*}]FvP10target_opsEl^+M17readable_regcache^+MP26readonly_detached_regcache^+M+MPFvP10target_opsE^(,M+M+Mdy!y!Px!x!,Mf fdy!y!Px!x!pe)M$)ME)MO)M)M)M)M*M*MNfQ*M*M*M*M-*M>*MM*M^*Mq*M*M*M*Mvoid gcore_elf_collect_regset_section_cb(const char*, int, int, const regset*, const char*, void*)../../gdb/gcore-elf.cvariable_size_section || supply_size == collect_sizeregset != nullptr && regset->collect_regset != nullptrIgnore segment, %s bytes at %s Couldn't make gcore segment: %sSave segment, %s bytes at %s _sbrkbfd_vma call_target_sbrk(int)../../gdb/gcore.ctarget_sbrk_argSave a core file with the current state of the debugged process. Usage: generate-core-file [FILENAME] Argument is optional filename. Default filename is 'core.PROCESS_ID'.generate-core-filegcoreFailed to open '%s' for output.Can't find bfd architecture for corefile (need execfile).note0Target does not support core file generation.Failed to create 'note' section for corefile: %sgcore: failed to get corefile memory sections from target.Memory read failed for corefile section, %s bytes at %s.Failed to write corefile contents (%s).writing note section (%s)core.%dOpening corefile '%s' for output. Saved corefile %s The current C++ demangling style is "%s". Demangling of C++/ObjC names in disassembly listings is %s. Demangling of encoded C++/ObjC names when displaying symbols is %s. void set_demangling_command(const char*, int, cmd_list_element*)../../gdb/gdb-demangle.cdem->demangling_style != unknown_demanglingUsage: demangle [-l LANGUAGE] [--] NAMEUnknown language "%s"Can't demangle "%s"Show demangling of encoded C++/ObjC names when displaying symbols.Set demangling of encoded C++/ObjC names when displaying symbols.asm-demangleShow demangling of C++/ObjC names in disassembly listings.Set demangling of C++/ObjC names in disassembly listings.demangle-styleUse `set demangle-style' without arguments for a list of demangling styles.Show the current C++ demangling style.Set the current C++ demangling style.Demangle a mangled name. Usage: demangle [-l LANGUAGE] [--] NAME If LANGUAGE is not specified, NAME is demangled in the current language.cannot close "%s": %sProblem reading "%s" for CRC: %sBFD cache debugging is %s. BFD sharing is %s. void gdb_bfd_init_data(bfd*, stat*)../../gdb/gdb_bfd.cbfd_usrdata (abfd) == nullptrslot && !*slotrefcountvoid* gdb_bfd_iovec_fileio_open(bfd*, void*)is_target_filename (filename)Increase reference count on bfd %s (%s)gdb_bfd_refbfd-cacheconst gdb_byte* gdb_bfd_map_section(asection*, bfd_size_type*)(sectp->flags & SEC_RELOC) == 0Can't read data for section '%s' in file '%s'descriptor->data != NULLgdb_bfd_ref_ptr gdb_bfd_open(const char*, const char*, int, bool)fd == -1Could not stat %s - not cachinggdb_bfd_openReusing cached bfd %s for %sCreating new bfd %s for %svoid gdb_bfd_mark_parent(bfd*, bfd*)gdata->archive_bfd == parentList the BFDs that are currently open.bfdsbfd-sharingWhen enabled gdb will reuse existing bfds rather than reopening the same file. To decide if two files are the same then gdb compares the filename, file size, file modification time, and file inode.Show whether gdb will share bfds that appear to be the same file.Set whether gdb will share bfds that appear to be the same file.When non-zero, bfd cache specific debugging is enabled.Show bfd cache debugging.Set bfd cache debugging.RefcountFilenamevoid gdb_bfd_unref(bfd*)gdata->refc >= 1Decrease reference count on bfd %s (%s)gdb_bfd_unrefDelete final reference count on bfd %s (%s) &$compiled_regex::compiled_regex(const char*, int, const char*)../../gdb/gdb_regex.cregex != NULLmessage != NULLArchitecture debugging is %s. const char* pstring_list(const char* const*)../../gdb/gdbarch.coffset - 2 < sizeof (ret)void gdbarch_free(gdbarch*)!arch->initialized_pgdbarch_tdep called const bfd_arch_info* gdbarch_bfd_arch_info(gdbarch*)gdbarch_bfd_arch_info called bfd_endian gdbarch_byte_order(gdbarch*)gdbarch_byte_order called bfd_endian gdbarch_byte_order_for_code(gdbarch*)gdbarch_byte_order_for_code called gdb_osabi gdbarch_osabi(gdbarch*)gdbarch_osabi called const target_desc* gdbarch_target_desc(gdbarch*)gdbarch_target_desc called int gdbarch_short_bit(gdbarch*)gdbarch_short_bit called int gdbarch_int_bit(gdbarch*)gdbarch_int_bit called int gdbarch_long_bit(gdbarch*)gdbarch_long_bit called int gdbarch_long_long_bit(gdbarch*)gdbarch_long_long_bit called int gdbarch_bfloat16_bit(gdbarch*)gdbarch_bfloat16_bit called const floatformat** gdbarch_bfloat16_format(gdbarch*)gdbarch_bfloat16_format called int gdbarch_half_bit(gdbarch*)gdbarch_half_bit called const floatformat** gdbarch_half_format(gdbarch*)gdbarch_half_format called int gdbarch_float_bit(gdbarch*)gdbarch_float_bit called const floatformat** gdbarch_float_format(gdbarch*)gdbarch_float_format called int gdbarch_double_bit(gdbarch*)gdbarch_double_bit called const floatformat** gdbarch_double_format(gdbarch*)gdbarch_double_format called int gdbarch_long_double_bit(gdbarch*)gdbarch_long_double_bit called const floatformat** gdbarch_long_double_format(gdbarch*)gdbarch_long_double_format called int gdbarch_wchar_bit(gdbarch*)gdbarch_wchar_bit called int gdbarch_wchar_signed(gdbarch*)gdbarch->wchar_signed != -1gdbarch_wchar_signed called const floatformat** gdbarch_floatformat_for_type(gdbarch*, const char*, int)gdbarch->floatformat_for_type != NULLgdbarch_floatformat_for_type called int gdbarch_ptr_bit(gdbarch*)gdbarch_ptr_bit called int gdbarch_addr_bit(gdbarch*)gdbarch->addr_bit != 0gdbarch_addr_bit called int gdbarch_dwarf2_addr_size(gdbarch*)gdbarch->dwarf2_addr_size != 0gdbarch_dwarf2_addr_size called int gdbarch_char_signed(gdbarch*)gdbarch->char_signed != -1gdbarch_char_signed called bool gdbarch_read_pc_p(gdbarch*)CORE_ADDR gdbarch_read_pc(gdbarch*, readable_regcache*)gdbarch->read_pc != NULLgdbarch_read_pc called bool gdbarch_write_pc_p(gdbarch*)void gdbarch_write_pc(gdbarch*, regcache*, CORE_ADDR)gdbarch->write_pc != NULLgdbarch_write_pc called void gdbarch_virtual_frame_pointer(gdbarch*, CORE_ADDR, int*, LONGEST*)gdbarch->virtual_frame_pointer != NULLgdbarch_virtual_frame_pointer called bool gdbarch_pseudo_register_read_p(gdbarch*)register_status gdbarch_pseudo_register_read(gdbarch*, readable_regcache*, int, gdb_byte*)gdbarch->pseudo_register_read != NULLgdbarch_pseudo_register_read called bool gdbarch_pseudo_register_read_value_p(gdbarch*)value* gdbarch_pseudo_register_read_value(gdbarch*, readable_regcache*, int)gdbarch->pseudo_register_read_value != NULLgdbarch_pseudo_register_read_value called bool gdbarch_pseudo_register_write_p(gdbarch*)void gdbarch_pseudo_register_write(gdbarch*, regcache*, int, const gdb_byte*)gdbarch->pseudo_register_write != NULLgdbarch_pseudo_register_write called int gdbarch_num_regs(gdbarch*)gdbarch->num_regs != -1gdbarch_num_regs called int gdbarch_num_pseudo_regs(gdbarch*)gdbarch_num_pseudo_regs called bool gdbarch_ax_pseudo_register_collect_p(gdbarch*)int gdbarch_ax_pseudo_register_collect(gdbarch*, agent_expr*, int)gdbarch->ax_pseudo_register_collect != NULLgdbarch_ax_pseudo_register_collect called bool gdbarch_ax_pseudo_register_push_stack_p(gdbarch*)int gdbarch_ax_pseudo_register_push_stack(gdbarch*, agent_expr*, int)gdbarch->ax_pseudo_register_push_stack != NULLgdbarch_ax_pseudo_register_push_stack called bool gdbarch_report_signal_info_p(gdbarch*)void gdbarch_report_signal_info(gdbarch*, ui_out*, gdb_signal)gdbarch->report_signal_info != NULLgdbarch_report_signal_info called int gdbarch_sp_regnum(gdbarch*)gdbarch_sp_regnum called int gdbarch_pc_regnum(gdbarch*)gdbarch_pc_regnum called int gdbarch_ps_regnum(gdbarch*)gdbarch_ps_regnum called int gdbarch_fp0_regnum(gdbarch*)gdbarch_fp0_regnum called int gdbarch_stab_reg_to_regnum(gdbarch*, int)gdbarch->stab_reg_to_regnum != NULLgdbarch_stab_reg_to_regnum called int gdbarch_ecoff_reg_to_regnum(gdbarch*, int)gdbarch->ecoff_reg_to_regnum != NULLgdbarch_ecoff_reg_to_regnum called int gdbarch_sdb_reg_to_regnum(gdbarch*, int)gdbarch->sdb_reg_to_regnum != NULLgdbarch_sdb_reg_to_regnum called int gdbarch_dwarf2_reg_to_regnum(gdbarch*, int)gdbarch->dwarf2_reg_to_regnum != NULLgdbarch_dwarf2_reg_to_regnum called const char* gdbarch_register_name(gdbarch*, int)gdbarch->register_name != NULLgdbarch_register_name called bool gdbarch_register_type_p(gdbarch*)type* gdbarch_register_type(gdbarch*, int)gdbarch->register_type != NULLgdbarch_register_type called frame_id gdbarch_dummy_id(gdbarch*, frame_info*)gdbarch->dummy_id != NULLgdbarch_dummy_id called int gdbarch_deprecated_fp_regnum(gdbarch*)gdbarch_deprecated_fp_regnum called bool gdbarch_push_dummy_call_p(gdbarch*)CORE_ADDR gdbarch_push_dummy_call(gdbarch*, value*, regcache*, CORE_ADDR, int, value**, CORE_ADDR, function_call_return_method, CORE_ADDR)gdbarch->push_dummy_call != NULLgdbarch_push_dummy_call called int gdbarch_call_dummy_location(gdbarch*)gdbarch_call_dummy_location called bool gdbarch_push_dummy_code_p(gdbarch*)CORE_ADDR gdbarch_push_dummy_code(gdbarch*, CORE_ADDR, CORE_ADDR, value**, int, type*, CORE_ADDR*, CORE_ADDR*, regcache*)gdbarch->push_dummy_code != NULLgdbarch_push_dummy_code called int gdbarch_code_of_frame_writable(gdbarch*, frame_info*)gdbarch->code_of_frame_writable != NULLgdbarch_code_of_frame_writable called void gdbarch_print_registers_info(gdbarch*, ui_file*, frame_info*, int, int)gdbarch->print_registers_info != NULLgdbarch_print_registers_info called void gdbarch_print_float_info(gdbarch*, ui_file*, frame_info*, const char*)gdbarch->print_float_info != NULLgdbarch_print_float_info called bool gdbarch_print_vector_info_p(gdbarch*)void gdbarch_print_vector_info(gdbarch*, ui_file*, frame_info*, const char*)gdbarch->print_vector_info != NULLgdbarch_print_vector_info called int gdbarch_register_sim_regno(gdbarch*, int)gdbarch->register_sim_regno != NULLgdbarch_register_sim_regno called int gdbarch_cannot_fetch_register(gdbarch*, int)gdbarch->cannot_fetch_register != NULLgdbarch_cannot_fetch_register called int gdbarch_cannot_store_register(gdbarch*, int)gdbarch->cannot_store_register != NULLgdbarch_cannot_store_register called bool gdbarch_get_longjmp_target_p(gdbarch*)int gdbarch_get_longjmp_target(gdbarch*, frame_info*, CORE_ADDR*)gdbarch->get_longjmp_target != NULLgdbarch_get_longjmp_target called int gdbarch_believe_pcc_promotion(gdbarch*)gdbarch_believe_pcc_promotion called int gdbarch_convert_register_p(gdbarch*, int, type*)gdbarch->convert_register_p != NULLgdbarch_convert_register_p called int gdbarch_register_to_value(gdbarch*, frame_info*, int, type*, gdb_byte*, int*, int*)gdbarch->register_to_value != NULLgdbarch_register_to_value called void gdbarch_value_to_register(gdbarch*, frame_info*, int, type*, const gdb_byte*)gdbarch->value_to_register != NULLgdbarch_value_to_register called value* gdbarch_value_from_register(gdbarch*, type*, int, frame_id)gdbarch->value_from_register != NULLgdbarch_value_from_register called CORE_ADDR gdbarch_pointer_to_address(gdbarch*, type*, const gdb_byte*)gdbarch->pointer_to_address != NULLgdbarch_pointer_to_address called void gdbarch_address_to_pointer(gdbarch*, type*, gdb_byte*, CORE_ADDR)gdbarch->address_to_pointer != NULLgdbarch_address_to_pointer called bool gdbarch_integer_to_address_p(gdbarch*)CORE_ADDR gdbarch_integer_to_address(gdbarch*, type*, const gdb_byte*)gdbarch->integer_to_address != NULLgdbarch_integer_to_address called bool gdbarch_return_value_p(gdbarch*)return_value_convention gdbarch_return_value(gdbarch*, value*, type*, regcache*, gdb_byte*, const gdb_byte*)gdbarch->return_value != NULLgdbarch_return_value called int gdbarch_return_in_first_hidden_param_p(gdbarch*, type*)gdbarch->return_in_first_hidden_param_p != NULLgdbarch_return_in_first_hidden_param_p called CORE_ADDR gdbarch_skip_prologue(gdbarch*, CORE_ADDR)gdbarch->skip_prologue != NULLgdbarch_skip_prologue called bool gdbarch_skip_main_prologue_p(gdbarch*)CORE_ADDR gdbarch_skip_main_prologue(gdbarch*, CORE_ADDR)gdbarch->skip_main_prologue != NULLgdbarch_skip_main_prologue called bool gdbarch_skip_entrypoint_p(gdbarch*)CORE_ADDR gdbarch_skip_entrypoint(gdbarch*, CORE_ADDR)gdbarch->skip_entrypoint != NULLgdbarch_skip_entrypoint called int gdbarch_inner_than(gdbarch*, CORE_ADDR, CORE_ADDR)gdbarch->inner_than != NULLgdbarch_inner_than called const gdb_byte* gdbarch_breakpoint_from_pc(gdbarch*, CORE_ADDR*, int*)gdbarch->breakpoint_from_pc != NULLgdbarch_breakpoint_from_pc called int gdbarch_breakpoint_kind_from_pc(gdbarch*, CORE_ADDR*)gdbarch->breakpoint_kind_from_pc != NULLgdbarch_breakpoint_kind_from_pc called const gdb_byte* gdbarch_sw_breakpoint_from_kind(gdbarch*, int, int*)gdbarch->sw_breakpoint_from_kind != NULLgdbarch_sw_breakpoint_from_kind called int gdbarch_breakpoint_kind_from_current_state(gdbarch*, regcache*, CORE_ADDR*)gdbarch->breakpoint_kind_from_current_state != NULLgdbarch_breakpoint_kind_from_current_state called bool gdbarch_adjust_breakpoint_address_p(gdbarch*)CORE_ADDR gdbarch_adjust_breakpoint_address(gdbarch*, CORE_ADDR)gdbarch->adjust_breakpoint_address != NULLgdbarch_adjust_breakpoint_address called int gdbarch_memory_insert_breakpoint(gdbarch*, bp_target_info*)gdbarch->memory_insert_breakpoint != NULLgdbarch_memory_insert_breakpoint called int gdbarch_memory_remove_breakpoint(gdbarch*, bp_target_info*)gdbarch->memory_remove_breakpoint != NULLgdbarch_memory_remove_breakpoint called CORE_ADDR gdbarch_decr_pc_after_break(gdbarch*)gdbarch_decr_pc_after_break called CORE_ADDR gdbarch_deprecated_function_start_offset(gdbarch*)gdbarch_deprecated_function_start_offset called int gdbarch_remote_register_number(gdbarch*, int)gdbarch->remote_register_number != NULLgdbarch_remote_register_number called bool gdbarch_fetch_tls_load_module_address_p(gdbarch*)CORE_ADDR gdbarch_fetch_tls_load_module_address(gdbarch*, objfile*)gdbarch->fetch_tls_load_module_address != NULLgdbarch_fetch_tls_load_module_address called bool gdbarch_get_thread_local_address_p(gdbarch*)CORE_ADDR gdbarch_get_thread_local_address(gdbarch*, ptid_t, CORE_ADDR, CORE_ADDR)gdbarch->get_thread_local_address != NULLgdbarch_get_thread_local_address called CORE_ADDR gdbarch_frame_args_skip(gdbarch*)gdbarch_frame_args_skip called CORE_ADDR gdbarch_unwind_pc(gdbarch*, frame_info*)gdbarch->unwind_pc != NULLgdbarch_unwind_pc called CORE_ADDR gdbarch_unwind_sp(gdbarch*, frame_info*)gdbarch->unwind_sp != NULLgdbarch_unwind_sp called bool gdbarch_frame_num_args_p(gdbarch*)int gdbarch_frame_num_args(gdbarch*, frame_info*)gdbarch->frame_num_args != NULLgdbarch_frame_num_args called bool gdbarch_frame_align_p(gdbarch*)CORE_ADDR gdbarch_frame_align(gdbarch*, CORE_ADDR)gdbarch->frame_align != NULLgdbarch_frame_align called int gdbarch_stabs_argument_has_addr(gdbarch*, type*)gdbarch->stabs_argument_has_addr != NULLgdbarch_stabs_argument_has_addr called int gdbarch_frame_red_zone_size(gdbarch*)gdbarch_frame_red_zone_size called CORE_ADDR gdbarch_convert_from_func_ptr_addr(gdbarch*, CORE_ADDR, target_ops*)gdbarch->convert_from_func_ptr_addr != NULLgdbarch_convert_from_func_ptr_addr called CORE_ADDR gdbarch_addr_bits_remove(gdbarch*, CORE_ADDR)gdbarch->addr_bits_remove != NULLgdbarch_addr_bits_remove called int gdbarch_significant_addr_bit(gdbarch*)gdbarch_significant_addr_bit called std::string gdbarch_memtag_to_string(gdbarch*, value*)gdbarch->memtag_to_string != NULLgdbarch_memtag_to_string called bool gdbarch_tagged_address_p(gdbarch*, value*)gdbarch->tagged_address_p != NULLgdbarch_tagged_address_p called bool gdbarch_memtag_matches_p(gdbarch*, value*)gdbarch->memtag_matches_p != NULLgdbarch_memtag_matches_p called bool gdbarch_set_memtags(gdbarch*, value*, size_t, const byte_vector&, memtag_type)gdbarch->set_memtags != NULLgdbarch_set_memtags called value* gdbarch_get_memtag(gdbarch*, value*, memtag_type)gdbarch->get_memtag != NULLgdbarch_get_memtag called CORE_ADDR gdbarch_memtag_granule_size(gdbarch*)gdbarch_memtag_granule_size called bool gdbarch_software_single_step_p(gdbarch*)std::vector gdbarch_software_single_step(gdbarch*, regcache*)gdbarch->software_single_step != NULLgdbarch_software_single_step called bool gdbarch_single_step_through_delay_p(gdbarch*)int gdbarch_single_step_through_delay(gdbarch*, frame_info*)gdbarch->single_step_through_delay != NULLgdbarch_single_step_through_delay called int gdbarch_print_insn(gdbarch*, bfd_vma, disassemble_info*)gdbarch->print_insn != NULLgdbarch_print_insn called CORE_ADDR gdbarch_skip_trampoline_code(gdbarch*, frame_info*, CORE_ADDR)gdbarch->skip_trampoline_code != NULLgdbarch_skip_trampoline_code called CORE_ADDR gdbarch_skip_solib_resolver(gdbarch*, CORE_ADDR)gdbarch->skip_solib_resolver != NULLgdbarch_skip_solib_resolver called int gdbarch_in_solib_return_trampoline(gdbarch*, CORE_ADDR, const char*)gdbarch->in_solib_return_trampoline != NULLgdbarch_in_solib_return_trampoline called bool gdbarch_in_indirect_branch_thunk(gdbarch*, CORE_ADDR)gdbarch->in_indirect_branch_thunk != NULLgdbarch_in_indirect_branch_thunk called int gdbarch_stack_frame_destroyed_p(gdbarch*, CORE_ADDR)gdbarch->stack_frame_destroyed_p != NULLgdbarch_stack_frame_destroyed_p called bool gdbarch_elf_make_msymbol_special_p(gdbarch*)void gdbarch_elf_make_msymbol_special(gdbarch*, asymbol*, minimal_symbol*)gdbarch->elf_make_msymbol_special != NULLgdbarch_elf_make_msymbol_special called void gdbarch_coff_make_msymbol_special(gdbarch*, int, minimal_symbol*)gdbarch->coff_make_msymbol_special != NULLgdbarch_coff_make_msymbol_special called void gdbarch_make_symbol_special(gdbarch*, symbol*, objfile*)gdbarch->make_symbol_special != NULLgdbarch_make_symbol_special called CORE_ADDR gdbarch_adjust_dwarf2_addr(gdbarch*, CORE_ADDR)gdbarch->adjust_dwarf2_addr != NULLgdbarch_adjust_dwarf2_addr called CORE_ADDR gdbarch_adjust_dwarf2_line(gdbarch*, CORE_ADDR, int)gdbarch->adjust_dwarf2_line != NULLgdbarch_adjust_dwarf2_line called int gdbarch_cannot_step_breakpoint(gdbarch*)gdbarch_cannot_step_breakpoint called int gdbarch_have_nonsteppable_watchpoint(gdbarch*)gdbarch_have_nonsteppable_watchpoint called bool gdbarch_address_class_type_flags_p(gdbarch*)type_instance_flags gdbarch_address_class_type_flags(gdbarch*, int, int)gdbarch->address_class_type_flags != NULLgdbarch_address_class_type_flags called bool gdbarch_address_class_type_flags_to_name_p(gdbarch*)const char* gdbarch_address_class_type_flags_to_name(gdbarch*, type_instance_flags)gdbarch->address_class_type_flags_to_name != NULLgdbarch_address_class_type_flags_to_name called bool gdbarch_execute_dwarf_cfa_vendor_op(gdbarch*, gdb_byte, dwarf2_frame_state*)gdbarch->execute_dwarf_cfa_vendor_op != NULLgdbarch_execute_dwarf_cfa_vendor_op called bool gdbarch_address_class_name_to_type_flags_p(gdbarch*)bool gdbarch_address_class_name_to_type_flags(gdbarch*, const char*, type_instance_flags*)gdbarch->address_class_name_to_type_flags != NULLgdbarch_address_class_name_to_type_flags called int gdbarch_register_reggroup_p(gdbarch*, int, reggroup*)gdbarch->register_reggroup_p != NULLgdbarch_register_reggroup_p called bool gdbarch_fetch_pointer_argument_p(gdbarch*)CORE_ADDR gdbarch_fetch_pointer_argument(gdbarch*, frame_info*, int, type*)gdbarch->fetch_pointer_argument != NULLgdbarch_fetch_pointer_argument called bool gdbarch_iterate_over_regset_sections_p(gdbarch*)void gdbarch_iterate_over_regset_sections(gdbarch*, void (*)(const char*, int, int, const regset*, const char*, void*), void*, const regcache*)gdbarch->iterate_over_regset_sections != NULLgdbarch_iterate_over_regset_sections called bool gdbarch_make_corefile_notes_p(gdbarch*)gdb::unique_xmalloc_ptr gdbarch_make_corefile_notes(gdbarch*, bfd*, int*)gdbarch->make_corefile_notes != NULLgdbarch_make_corefile_notes called bool gdbarch_find_memory_regions_p(gdbarch*)int gdbarch_find_memory_regions(gdbarch*, find_memory_region_ftype, void*)gdbarch->find_memory_regions != NULLgdbarch_find_memory_regions called bool gdbarch_core_xfer_shared_libraries_p(gdbarch*)ULONGEST gdbarch_core_xfer_shared_libraries(gdbarch*, gdb_byte*, ULONGEST, ULONGEST)gdbarch->core_xfer_shared_libraries != NULLgdbarch_core_xfer_shared_libraries called bool gdbarch_core_xfer_shared_libraries_aix_p(gdbarch*)ULONGEST gdbarch_core_xfer_shared_libraries_aix(gdbarch*, gdb_byte*, ULONGEST, ULONGEST)gdbarch->core_xfer_shared_libraries_aix != NULLgdbarch_core_xfer_shared_libraries_aix called bool gdbarch_core_pid_to_str_p(gdbarch*)std::string gdbarch_core_pid_to_str(gdbarch*, ptid_t)gdbarch->core_pid_to_str != NULLgdbarch_core_pid_to_str called bool gdbarch_core_thread_name_p(gdbarch*)const char* gdbarch_core_thread_name(gdbarch*, thread_info*)gdbarch->core_thread_name != NULLgdbarch_core_thread_name called bool gdbarch_core_xfer_siginfo_p(gdbarch*)LONGEST gdbarch_core_xfer_siginfo(gdbarch*, gdb_byte*, ULONGEST, ULONGEST)gdbarch->core_xfer_siginfo != NULLgdbarch_core_xfer_siginfo called bool gdbarch_gcore_bfd_target_p(gdbarch*)const char* gdbarch_gcore_bfd_target(gdbarch*)gdbarch->gcore_bfd_target != 0gdbarch_gcore_bfd_target called int gdbarch_vtable_function_descriptors(gdbarch*)gdbarch_vtable_function_descriptors called int gdbarch_vbit_in_delta(gdbarch*)gdbarch_vbit_in_delta called void gdbarch_skip_permanent_breakpoint(gdbarch*, regcache*)gdbarch->skip_permanent_breakpoint != NULLgdbarch_skip_permanent_breakpoint called bool gdbarch_max_insn_length_p(gdbarch*)ULONGEST gdbarch_max_insn_length(gdbarch*)gdbarch->max_insn_length != 0gdbarch_max_insn_length called bool gdbarch_displaced_step_copy_insn_p(gdbarch*)displaced_step_copy_insn_closure_up gdbarch_displaced_step_copy_insn(gdbarch*, CORE_ADDR, CORE_ADDR, regcache*)gdbarch->displaced_step_copy_insn != NULLgdbarch_displaced_step_copy_insn called bool gdbarch_displaced_step_hw_singlestep(gdbarch*)gdbarch->displaced_step_hw_singlestep != NULLgdbarch_displaced_step_hw_singlestep called bool gdbarch_displaced_step_fixup_p(gdbarch*)void gdbarch_displaced_step_fixup(gdbarch*, displaced_step_copy_insn_closure*, CORE_ADDR, CORE_ADDR, regcache*)gdbarch->displaced_step_fixup != NULLgdbarch_displaced_step_fixup called bool gdbarch_displaced_step_prepare_p(gdbarch*)displaced_step_prepare_status gdbarch_displaced_step_prepare(gdbarch*, thread_info*, CORE_ADDR&)gdbarch->displaced_step_prepare != NULLgdbarch_displaced_step_prepare called displaced_step_finish_status gdbarch_displaced_step_finish(gdbarch*, thread_info*, gdb_signal)gdbarch->displaced_step_finish != NULLgdbarch_displaced_step_finish called bool gdbarch_displaced_step_copy_insn_closure_by_addr_p(gdbarch*)const displaced_step_copy_insn_closure* gdbarch_displaced_step_copy_insn_closure_by_addr(gdbarch*, inferior*, CORE_ADDR)gdbarch->displaced_step_copy_insn_closure_by_addr != NULLgdbarch_displaced_step_copy_insn_closure_by_addr called void gdbarch_displaced_step_restore_all_in_ptid(gdbarch*, inferior*, ptid_t)gdbarch->displaced_step_restore_all_in_ptid != NULLgdbarch_displaced_step_restore_all_in_ptid called bool gdbarch_relocate_instruction_p(gdbarch*)void gdbarch_relocate_instruction(gdbarch*, CORE_ADDR*, CORE_ADDR)gdbarch->relocate_instruction != NULLgdbarch_relocate_instruction called bool gdbarch_overlay_update_p(gdbarch*)void gdbarch_overlay_update(gdbarch*, obj_section*)gdbarch->overlay_update != NULLgdbarch_overlay_update called bool gdbarch_core_read_description_p(gdbarch*)const target_desc* gdbarch_core_read_description(gdbarch*, target_ops*, bfd*)gdbarch->core_read_description != NULLgdbarch_core_read_description called int gdbarch_sofun_address_maybe_missing(gdbarch*)gdbarch_sofun_address_maybe_missing called bool gdbarch_process_record_p(gdbarch*)int gdbarch_process_record(gdbarch*, regcache*, CORE_ADDR)gdbarch->process_record != NULLgdbarch_process_record called bool gdbarch_process_record_signal_p(gdbarch*)int gdbarch_process_record_signal(gdbarch*, regcache*, gdb_signal)gdbarch->process_record_signal != NULLgdbarch_process_record_signal called bool gdbarch_gdb_signal_from_target_p(gdbarch*)gdb_signal gdbarch_gdb_signal_from_target(gdbarch*, int)gdbarch->gdb_signal_from_target != NULLgdbarch_gdb_signal_from_target called bool gdbarch_gdb_signal_to_target_p(gdbarch*)int gdbarch_gdb_signal_to_target(gdbarch*, gdb_signal)gdbarch->gdb_signal_to_target != NULLgdbarch_gdb_signal_to_target called bool gdbarch_get_siginfo_type_p(gdbarch*)type* gdbarch_get_siginfo_type(gdbarch*)gdbarch->get_siginfo_type != NULLgdbarch_get_siginfo_type called bool gdbarch_record_special_symbol_p(gdbarch*)void gdbarch_record_special_symbol(gdbarch*, objfile*, asymbol*)gdbarch->record_special_symbol != NULLgdbarch_record_special_symbol called bool gdbarch_get_syscall_number_p(gdbarch*)LONGEST gdbarch_get_syscall_number(gdbarch*, thread_info*)gdbarch->get_syscall_number != NULLgdbarch_get_syscall_number called const char* gdbarch_xml_syscall_file(gdbarch*)gdbarch_xml_syscall_file called syscalls_info* gdbarch_syscalls_info(gdbarch*)gdbarch_syscalls_info called const char* const* gdbarch_stap_integer_prefixes(gdbarch*)gdbarch_stap_integer_prefixes called const char* const* gdbarch_stap_integer_suffixes(gdbarch*)gdbarch_stap_integer_suffixes called const char* const* gdbarch_stap_register_prefixes(gdbarch*)gdbarch_stap_register_prefixes called const char* const* gdbarch_stap_register_suffixes(gdbarch*)gdbarch_stap_register_suffixes called const char* const* gdbarch_stap_register_indirection_prefixes(gdbarch*)gdbarch_stap_register_indirection_prefixes called const char* const* gdbarch_stap_register_indirection_suffixes(gdbarch*)gdbarch_stap_register_indirection_suffixes called const char* gdbarch_stap_gdb_register_prefix(gdbarch*)gdbarch_stap_gdb_register_prefix called const char* gdbarch_stap_gdb_register_suffix(gdbarch*)gdbarch_stap_gdb_register_suffix called bool gdbarch_stap_is_single_operand_p(gdbarch*)int gdbarch_stap_is_single_operand(gdbarch*, const char*)gdbarch->stap_is_single_operand != NULLgdbarch_stap_is_single_operand called bool gdbarch_stap_parse_special_token_p(gdbarch*)expr::operation_up gdbarch_stap_parse_special_token(gdbarch*, stap_parse_info*)gdbarch->stap_parse_special_token != NULLgdbarch_stap_parse_special_token called bool gdbarch_stap_adjust_register_p(gdbarch*)std::string gdbarch_stap_adjust_register(gdbarch*, stap_parse_info*, const string&, int)gdbarch->stap_adjust_register != NULLgdbarch_stap_adjust_register called bool gdbarch_dtrace_parse_probe_argument_p(gdbarch*)expr::operation_up gdbarch_dtrace_parse_probe_argument(gdbarch*, int)gdbarch->dtrace_parse_probe_argument != NULLgdbarch_dtrace_parse_probe_argument called bool gdbarch_dtrace_probe_is_enabled_p(gdbarch*)int gdbarch_dtrace_probe_is_enabled(gdbarch*, CORE_ADDR)gdbarch->dtrace_probe_is_enabled != NULLgdbarch_dtrace_probe_is_enabled called bool gdbarch_dtrace_enable_probe_p(gdbarch*)void gdbarch_dtrace_enable_probe(gdbarch*, CORE_ADDR)gdbarch->dtrace_enable_probe != NULLgdbarch_dtrace_enable_probe called bool gdbarch_dtrace_disable_probe_p(gdbarch*)void gdbarch_dtrace_disable_probe(gdbarch*, CORE_ADDR)gdbarch->dtrace_disable_probe != NULLgdbarch_dtrace_disable_probe called int gdbarch_has_global_solist(gdbarch*)gdbarch_has_global_solist called int gdbarch_has_global_breakpoints(gdbarch*)gdbarch_has_global_breakpoints called int gdbarch_has_shared_address_space(gdbarch*)gdbarch->has_shared_address_space != NULLgdbarch_has_shared_address_space called int gdbarch_fast_tracepoint_valid_at(gdbarch*, CORE_ADDR, std::string*)gdbarch->fast_tracepoint_valid_at != NULLgdbarch_fast_tracepoint_valid_at called void gdbarch_guess_tracepoint_registers(gdbarch*, regcache*, CORE_ADDR)gdbarch->guess_tracepoint_registers != NULLgdbarch_guess_tracepoint_registers called const char* gdbarch_auto_charset(gdbarch*)gdbarch->auto_charset != NULLgdbarch_auto_charset called const char* gdbarch_auto_wide_charset(gdbarch*)gdbarch->auto_wide_charset != NULLgdbarch_auto_wide_charset called const char* gdbarch_solib_symbols_extension(gdbarch*)gdbarch_solib_symbols_extension called int gdbarch_has_dos_based_file_system(gdbarch*)gdbarch_has_dos_based_file_system called void gdbarch_gen_return_address(gdbarch*, agent_expr*, axs_value*, CORE_ADDR)gdbarch->gen_return_address != NULLgdbarch_gen_return_address called bool gdbarch_info_proc_p(gdbarch*)void gdbarch_info_proc(gdbarch*, const char*, info_proc_what)gdbarch->info_proc != NULLgdbarch_info_proc called bool gdbarch_core_info_proc_p(gdbarch*)void gdbarch_core_info_proc(gdbarch*, const char*, info_proc_what)gdbarch->core_info_proc != NULLgdbarch_core_info_proc called void gdbarch_iterate_over_objfiles_in_search_order(gdbarch*, int (*)(objfile*, void*), void*, objfile*)gdbarch->iterate_over_objfiles_in_search_order != NULLgdbarch_iterate_over_objfiles_in_search_order called ravenscar_arch_ops* gdbarch_ravenscar_ops(gdbarch*)gdbarch_ravenscar_ops called int gdbarch_insn_is_call(gdbarch*, CORE_ADDR)gdbarch->insn_is_call != NULLgdbarch_insn_is_call called int gdbarch_insn_is_ret(gdbarch*, CORE_ADDR)gdbarch->insn_is_ret != NULLgdbarch_insn_is_ret called int gdbarch_insn_is_jump(gdbarch*, CORE_ADDR)gdbarch->insn_is_jump != NULLgdbarch_insn_is_jump called bool gdbarch_program_breakpoint_here_p(gdbarch*, CORE_ADDR)gdbarch->program_breakpoint_here_p != NULLgdbarch_program_breakpoint_here_p called bool gdbarch_auxv_parse_p(gdbarch*)config/nm-linux.hgdbarch_dump: GDB_NM_FILE = %s gdbarch_dump: addr_bit = %s gdbarch_dump: addr_bits_remove = <%s> gdbarch_dump: gdbarch_address_class_name_to_type_flags_p() = %d gdbarch_dump: address_class_name_to_type_flags = <%s> gdbarch_dump: gdbarch_address_class_type_flags_p() = %d gdbarch_dump: address_class_type_flags = <%s> gdbarch_dump: gdbarch_address_class_type_flags_to_name_p() = %d gdbarch_dump: address_class_type_flags_to_name = <%s> gdbarch_dump: address_to_pointer = <%s> gdbarch_dump: addressable_memory_unit_size = <%s> gdbarch_dump: gdbarch_adjust_breakpoint_address_p() = %d gdbarch_dump: adjust_breakpoint_address = <%s> gdbarch_dump: adjust_dwarf2_addr = <%s> gdbarch_dump: adjust_dwarf2_line = <%s> gdbarch_dump: auto_charset = <%s> gdbarch_dump: auto_wide_charset = <%s> gdbarch_dump: gdbarch_auxv_parse_p() = %d gdbarch_dump: auxv_parse = <%s> gdbarch_dump: gdbarch_ax_pseudo_register_collect_p() = %d gdbarch_dump: ax_pseudo_register_collect = <%s> gdbarch_dump: gdbarch_ax_pseudo_register_push_stack_p() = %d gdbarch_dump: ax_pseudo_register_push_stack = <%s> gdbarch_dump: believe_pcc_promotion = %s gdbarch_dump: bfd_arch_info = %s gdbarch_dump: bfloat16_bit = %s gdbarch_dump: bfloat16_format = %s gdbarch_dump: breakpoint_from_pc = <%s> gdbarch_dump: breakpoint_kind_from_current_state = <%s> gdbarch_dump: breakpoint_kind_from_pc = <%s> gdbarch_dump: byte_order = %s gdbarch_dump: byte_order_for_code = %s gdbarch_dump: call_dummy_location = %s gdbarch_dump: cannot_fetch_register = <%s> gdbarch_dump: cannot_step_breakpoint = %s gdbarch_dump: cannot_store_register = <%s> gdbarch_dump: char_signed = %s gdbarch_dump: code_of_frame_writable = <%s> gdbarch_dump: coff_make_msymbol_special = <%s> gdbarch_dump: convert_from_func_ptr_addr = <%s> gdbarch_dump: convert_register_p = <%s> gdbarch_dump: gdbarch_core_info_proc_p() = %d gdbarch_dump: core_info_proc = <%s> gdbarch_dump: gdbarch_core_pid_to_str_p() = %d gdbarch_dump: core_pid_to_str = <%s> gdbarch_dump: gdbarch_core_read_description_p() = %d gdbarch_dump: core_read_description = <%s> gdbarch_dump: gdbarch_core_thread_name_p() = %d gdbarch_dump: core_thread_name = <%s> gdbarch_dump: gdbarch_core_xfer_shared_libraries_p() = %d gdbarch_dump: core_xfer_shared_libraries = <%s> gdbarch_dump: gdbarch_core_xfer_shared_libraries_aix_p() = %d gdbarch_dump: core_xfer_shared_libraries_aix = <%s> gdbarch_dump: gdbarch_core_xfer_siginfo_p() = %d gdbarch_dump: core_xfer_siginfo = <%s> gdbarch_dump: decr_pc_after_break = %s gdbarch_dump: deprecated_fp_regnum = %s gdbarch_dump: deprecated_function_start_offset = %s gdbarch_dump: disassembler_options = %s gdbarch_dump: disassembler_options_implicit = %s gdbarch_dump: gdbarch_displaced_step_copy_insn_p() = %d gdbarch_dump: displaced_step_copy_insn = <%s> gdbarch_dump: gdbarch_displaced_step_copy_insn_closure_by_addr_p() = %d gdbarch_dump: displaced_step_copy_insn_closure_by_addr = <%s> gdbarch_dump: displaced_step_finish = <%s> gdbarch_dump: gdbarch_displaced_step_fixup_p() = %d gdbarch_dump: displaced_step_fixup = <%s> gdbarch_dump: displaced_step_hw_singlestep = <%s> gdbarch_dump: gdbarch_displaced_step_prepare_p() = %d gdbarch_dump: displaced_step_prepare = <%s> gdbarch_dump: displaced_step_restore_all_in_ptid = <%s> gdbarch_dump: double_bit = %s gdbarch_dump: double_format = %s gdbarch_dump: gdbarch_dtrace_disable_probe_p() = %d gdbarch_dump: dtrace_disable_probe = <%s> gdbarch_dump: gdbarch_dtrace_enable_probe_p() = %d gdbarch_dump: dtrace_enable_probe = <%s> gdbarch_dump: gdbarch_dtrace_parse_probe_argument_p() = %d gdbarch_dump: dtrace_parse_probe_argument = <%s> gdbarch_dump: gdbarch_dtrace_probe_is_enabled_p() = %d gdbarch_dump: dtrace_probe_is_enabled = <%s> gdbarch_dump: dummy_id = <%s> gdbarch_dump: dwarf2_addr_size = %s gdbarch_dump: dwarf2_reg_to_regnum = <%s> gdbarch_dump: ecoff_reg_to_regnum = <%s> gdbarch_dump: gdbarch_elf_make_msymbol_special_p() = %d gdbarch_dump: elf_make_msymbol_special = <%s> gdbarch_dump: execute_dwarf_cfa_vendor_op = <%s> gdbarch_dump: fast_tracepoint_valid_at = <%s> gdbarch_dump: gdbarch_fetch_pointer_argument_p() = %d gdbarch_dump: fetch_pointer_argument = <%s> gdbarch_dump: gdbarch_fetch_tls_load_module_address_p() = %d gdbarch_dump: fetch_tls_load_module_address = <%s> gdbarch_dump: gdbarch_find_memory_regions_p() = %d gdbarch_dump: find_memory_regions = <%s> gdbarch_dump: float_bit = %s gdbarch_dump: float_format = %s gdbarch_dump: floatformat_for_type = <%s> gdbarch_dump: fp0_regnum = %s gdbarch_dump: gdbarch_frame_align_p() = %d gdbarch_dump: frame_align = <%s> gdbarch_dump: frame_args_skip = %s gdbarch_dump: gdbarch_frame_num_args_p() = %d gdbarch_dump: frame_num_args = <%s> gdbarch_dump: frame_red_zone_size = %s gdbarch_dump: gcc_target_options = <%s> gdbarch_dump: gdbarch_gcore_bfd_target_p() = %d gdbarch_dump: gcore_bfd_target = %s gdbarch_dump: gdbarch_gdb_signal_from_target_p() = %d gdbarch_dump: gdb_signal_from_target = <%s> gdbarch_dump: gdbarch_gdb_signal_to_target_p() = %d gdbarch_dump: gdb_signal_to_target = <%s> gdbarch_dump: gen_return_address = <%s> gdbarch_dump: gdbarch_get_longjmp_target_p() = %d gdbarch_dump: get_longjmp_target = <%s> gdbarch_dump: get_memtag = <%s> gdbarch_dump: get_pc_address_flags = <%s> gdbarch_dump: gdbarch_get_siginfo_type_p() = %d gdbarch_dump: get_siginfo_type = <%s> gdbarch_dump: gdbarch_get_syscall_number_p() = %d gdbarch_dump: get_syscall_number = <%s> gdbarch_dump: gdbarch_get_thread_local_address_p() = %d gdbarch_dump: get_thread_local_address = <%s> gdbarch_dump: gnu_triplet_regexp = <%s> gdbarch_dump: guess_tracepoint_registers = <%s> gdbarch_dump: half_bit = %s gdbarch_dump: half_format = %s gdbarch_dump: has_dos_based_file_system = %s gdbarch_dump: has_global_breakpoints = %s gdbarch_dump: has_global_solist = %s gdbarch_dump: has_shared_address_space = <%s> gdbarch_dump: have_nonsteppable_watchpoint = %s gdbarch_dump: in_indirect_branch_thunk = <%s> gdbarch_dump: in_solib_return_trampoline = <%s> gdbarch_dump: infcall_mmap = <%s> gdbarch_dump: infcall_munmap = <%s> gdbarch_dump: gdbarch_info_proc_p() = %d gdbarch_dump: info_proc = <%s> gdbarch_dump: inner_than = <%s> gdbarch_dump: insn_is_call = <%s> gdbarch_dump: insn_is_jump = <%s> gdbarch_dump: insn_is_ret = <%s> gdbarch_dump: int_bit = %s gdbarch_dump: gdbarch_integer_to_address_p() = %d gdbarch_dump: integer_to_address = <%s> gdbarch_dump: iterate_over_objfiles_in_search_order = <%s> gdbarch_dump: gdbarch_iterate_over_regset_sections_p() = %d gdbarch_dump: iterate_over_regset_sections = <%s> gdbarch_dump: long_bit = %s gdbarch_dump: long_double_bit = %s gdbarch_dump: long_double_format = %s gdbarch_dump: long_long_bit = %s gdbarch_dump: gdbarch_make_corefile_notes_p() = %d gdbarch_dump: make_corefile_notes = <%s> gdbarch_dump: make_symbol_special = <%s> gdbarch_dump: gdbarch_max_insn_length_p() = %d gdbarch_dump: max_insn_length = %s gdbarch_dump: memory_insert_breakpoint = <%s> gdbarch_dump: memory_remove_breakpoint = <%s> gdbarch_dump: memtag_granule_size = %s gdbarch_dump: memtag_matches_p = <%s> gdbarch_dump: memtag_to_string = <%s> gdbarch_dump: num_pseudo_regs = %s gdbarch_dump: num_regs = %s gdbarch_dump: osabi = %s gdbarch_dump: gdbarch_overlay_update_p() = %d gdbarch_dump: overlay_update = <%s> gdbarch_dump: pc_regnum = %s gdbarch_dump: pointer_to_address = <%s> gdbarch_dump: print_auxv_entry = <%s> gdbarch_dump: print_float_info = <%s> gdbarch_dump: print_insn = <%s> gdbarch_dump: print_registers_info = <%s> gdbarch_dump: gdbarch_print_vector_info_p() = %d gdbarch_dump: print_vector_info = <%s> gdbarch_dump: gdbarch_process_record_p() = %d gdbarch_dump: process_record = <%s> gdbarch_dump: gdbarch_process_record_signal_p() = %d gdbarch_dump: process_record_signal = <%s> gdbarch_dump: program_breakpoint_here_p = <%s> gdbarch_dump: ps_regnum = %s gdbarch_dump: gdbarch_pseudo_register_read_p() = %d gdbarch_dump: pseudo_register_read = <%s> gdbarch_dump: gdbarch_pseudo_register_read_value_p() = %d gdbarch_dump: pseudo_register_read_value = <%s> gdbarch_dump: gdbarch_pseudo_register_write_p() = %d gdbarch_dump: pseudo_register_write = <%s> gdbarch_dump: ptr_bit = %s gdbarch_dump: gdbarch_push_dummy_call_p() = %d gdbarch_dump: push_dummy_call = <%s> gdbarch_dump: gdbarch_push_dummy_code_p() = %d gdbarch_dump: push_dummy_code = <%s> gdbarch_dump: ravenscar_ops = %s gdbarch_dump: read_core_file_mappings = <%s> gdbarch_dump: gdbarch_read_pc_p() = %d gdbarch_dump: read_pc = <%s> gdbarch_dump: gdbarch_record_special_symbol_p() = %d gdbarch_dump: record_special_symbol = <%s> gdbarch_dump: register_name = <%s> gdbarch_dump: register_reggroup_p = <%s> gdbarch_dump: register_sim_regno = <%s> gdbarch_dump: register_to_value = <%s> gdbarch_dump: gdbarch_register_type_p() = %d gdbarch_dump: register_type = <%s> gdbarch_dump: gdbarch_relocate_instruction_p() = %d gdbarch_dump: relocate_instruction = <%s> gdbarch_dump: remote_register_number = <%s> gdbarch_dump: gdbarch_report_signal_info_p() = %d gdbarch_dump: report_signal_info = <%s> gdbarch_dump: return_in_first_hidden_param_p = <%s> gdbarch_dump: gdbarch_return_value_p() = %d gdbarch_dump: return_value = <%s> gdbarch_dump: sdb_reg_to_regnum = <%s> gdbarch_dump: set_memtags = <%s> gdbarch_dump: short_bit = %s gdbarch_dump: significant_addr_bit = %s gdbarch_dump: gdbarch_single_step_through_delay_p() = %d gdbarch_dump: single_step_through_delay = <%s> gdbarch_dump: gdbarch_skip_entrypoint_p() = %d gdbarch_dump: skip_entrypoint = <%s> gdbarch_dump: gdbarch_skip_main_prologue_p() = %d gdbarch_dump: skip_main_prologue = <%s> gdbarch_dump: skip_permanent_breakpoint = <%s> gdbarch_dump: skip_prologue = <%s> gdbarch_dump: skip_solib_resolver = <%s> gdbarch_dump: skip_trampoline_code = <%s> gdbarch_dump: gdbarch_software_single_step_p() = %d gdbarch_dump: software_single_step = <%s> gdbarch_dump: sofun_address_maybe_missing = %s gdbarch_dump: solib_symbols_extension = %s gdbarch_dump: sp_regnum = %s gdbarch_dump: stab_reg_to_regnum = <%s> gdbarch_dump: stabs_argument_has_addr = <%s> gdbarch_dump: stack_frame_destroyed_p = <%s> gdbarch_dump: gdbarch_stap_adjust_register_p() = %d gdbarch_dump: stap_adjust_register = <%s> gdbarch_dump: stap_gdb_register_prefix = %s gdbarch_dump: stap_gdb_register_suffix = %s gdbarch_dump: stap_integer_prefixes = %s gdbarch_dump: stap_integer_suffixes = %s gdbarch_dump: gdbarch_stap_is_single_operand_p() = %d gdbarch_dump: stap_is_single_operand = <%s> gdbarch_dump: gdbarch_stap_parse_special_token_p() = %d gdbarch_dump: stap_parse_special_token = <%s> gdbarch_dump: stap_register_indirection_prefixes = %s gdbarch_dump: stap_register_indirection_suffixes = %s gdbarch_dump: stap_register_prefixes = %s gdbarch_dump: stap_register_suffixes = %s gdbarch_dump: sw_breakpoint_from_kind = <%s> gdbarch_dump: syscalls_info = %s gdbarch_dump: tagged_address_p = <%s> gdbarch_dump: target_desc = %s gdbarch_dump: type_align = <%s> gdbarch_dump: unwind_pc = <%s> gdbarch_dump: unwind_sp = <%s> gdbarch_dump: valid_disassembler_options = %s gdbarch_dump: value_from_register = <%s> gdbarch_dump: value_to_register = <%s> gdbarch_dump: vbit_in_delta = %s gdbarch_dump: virtual_frame_pointer = <%s> gdbarch_dump: vsyscall_range = <%s> gdbarch_dump: vtable_function_descriptors = %s gdbarch_dump: wchar_bit = %s gdbarch_dump: wchar_signed = %s gdbarch_dump: gdbarch_write_pc_p() = %d gdbarch_dump: write_pc = <%s> gdbarch_dump: xml_syscall_file = %s int gdbarch_auxv_parse(gdbarch*, gdb_byte**, gdb_byte*, CORE_ADDR*, CORE_ADDR*)gdbarch->auxv_parse != NULLgdbarch_auxv_parse called void gdbarch_print_auxv_entry(gdbarch*, ui_file*, CORE_ADDR, CORE_ADDR)gdbarch->print_auxv_entry != NULLgdbarch_print_auxv_entry called int gdbarch_vsyscall_range(gdbarch*, mem_range*)gdbarch->vsyscall_range != NULLgdbarch_vsyscall_range called CORE_ADDR gdbarch_infcall_mmap(gdbarch*, CORE_ADDR, unsigned int)gdbarch->infcall_mmap != NULLgdbarch_infcall_mmap called void gdbarch_infcall_munmap(gdbarch*, CORE_ADDR, CORE_ADDR)gdbarch->infcall_munmap != NULLgdbarch_infcall_munmap called std::string gdbarch_gcc_target_options(gdbarch*)gdbarch->gcc_target_options != NULLgdbarch_gcc_target_options called const char* gdbarch_gnu_triplet_regexp(gdbarch*)gdbarch->gnu_triplet_regexp != NULLgdbarch_gnu_triplet_regexp called int gdbarch_addressable_memory_unit_size(gdbarch*)gdbarch->addressable_memory_unit_size != NULLgdbarch_addressable_memory_unit_size called const char* gdbarch_disassembler_options_implicit(gdbarch*)gdbarch_disassembler_options_implicit called char** gdbarch_disassembler_options(gdbarch*)gdbarch_disassembler_options called const disasm_options_and_args_t* gdbarch_valid_disassembler_options(gdbarch*)gdbarch_valid_disassembler_options called ULONGEST gdbarch_type_align(gdbarch*, type*)gdbarch->type_align != NULLgdbarch_type_align called std::string gdbarch_get_pc_address_flags(gdbarch*, frame_info*, CORE_ADDR)gdbarch->get_pc_address_flags != NULLgdbarch_get_pc_address_flags called void gdbarch_read_core_file_mappings(gdbarch*, bfd*, gdb::function_view, gdb::function_view)gdbarch->read_core_file_mappings != NULLgdbarch_read_core_file_mappings called void* gdbarch_data(gdbarch*, gdbarch_data*)data->index < gdbarch->nr_datadata->init_pgdbarch post-init data field can only be used after gdbarch is fully initialisedgdbarch->data[data->index] != NULLgdbarch_architecture_names: multi-arch unknowngdbarch: Attempt to register unknown architecture (%d)gdbarch: Duplicate registration of architecture (%s)register_gdbarch_init (%s, %s) gdbarch* gdbarch_find_by_info(gdbarch_info)info.bfd_arch_info != NULLgdbarch_find_by_info: info.bfd_arch_info %s gdbarch_find_by_info: info.byte_order %d (%s) gdbarch_find_by_info: info.osabi %d (%s) gdbarch_find_by_info: info.abfd %s gdbarch_find_by_info: No matching architecture gdbarch_find_by_info: Target rejected architecture gdbarch_find_by_info: Previous architecture %s (%s) selected (*list) != NULL && (*list)->gdbarch == new_gdbarchgdbarch_find_by_info: New architecture %s (%s) selected byte-order bfd_arch_info num_regs register_name skip_prologue inner_than breakpoint_kind_from_pc displaced_step_finishverify_gdbarch: the following are invalid ...%sWhen non-zero, architecture debugging is enabled.Show architecture debugging.Set architecture debugging.void set_target_gdbarch(gdbarch*)new_gdbarch != NULLnew_gdbarch->initialized_pint verify_floatformat(int, const floatformat*)../../gdb/gdbtypes.cfloatformat != NULLbit >= 0bit >= floatformat->totalsizestub type has NULL nameStrict type checking is %s. Resolution of opaque struct/class/union types (if set before loading symbols) is %s. Debugging of C++ overloading is %s. type* dynamic_prop::original_type() constm_kind == PROP_TYPE(undefined)(dynamic)void dump_dynamic_prop(const dynamic_prop&)unhandled prop kindtype* make_qualified_type(type*, type_instance_flags, type*)type->objfile_owner () == storage->objfile_owner ()type* alloc_type(objfile*)objfile != NULLtype* alloc_type_arch(gdbarch*)gdbarch* type::arch() consttype* make_reference_type(type*, type**, type_code)refcode == TYPE_CODE_REF || refcode == TYPE_CODE_RVALUE_REFUnknown address space specifier: "%s"type* make_cv_type(int, int, type*, type**)(*typeptr)->objfile_owner () == type->objfile_owner ()void replace_type(type*, type*)ntype->objfile_owner () == type->objfile_owner ()TYPE_ADDRESS_CLASS_ALL (chain) == 0ntype->instance_flags () == type->instance_flags ()bool operator==(const dynamic_prop&, const dynamic_prop&)unhandled dynamic_prop kindtype* internal_type_self_type(type*)TYPE_SPECIFIC_FIELD (type) == TYPE_SPECIFIC_SELF_TYPEvoid set_type_self_type(type*, type*)No type named %s.No struct type named %s.This context has class, union or enum %s, not a struct.No union type named %s.This context has class, struct or enum %s, not a union.No enum type named %s.This context has class, struct or union %s, not an enum.No template type named %s.void type::add_dyn_prop(dynamic_prop_node_kind, dynamic_prop)this->is_objfile_owned ()const floatformat* floatformat_from_type(const type*)type->code () == TYPE_CODE_FLTTYPE_FLOATFORMAT (type)type* init_complex_type(const char*, type*)can_create_complex_type (target_type)bool set_type_align(type*, ULONGEST)(align & (align - 1)) == 0bfd_endian type_byte_order(const type*)byteorder == BFD_ENDIAN_LITTLEtype* copy_type(const type*)void append_flags_type_field(type*, int, int, type*, const char*)type->code () == TYPE_CODE_FLAGStype->num_fields () + 1 <= type_bitsizestart_bitpos >= 0 && start_bitpos < type_bitsizenr_bits >= 1 && nr_bits <= type_bitsizeInternal: Cannot demangle mangled name `%s'.(void)overloadWhen enabled, ranking of the functions is displayed.Show debugging of C++ overloading.Set debugging of C++ overloading.opaque-type-resolutionShow resolution of opaque struct/class/union types (if set before loading symbols).Set resolution of opaque struct/class/union types (if set before loading symbols).Show strict type checking.Set strict type checking.bool update_static_array_size(type*)type* check_typedef(type*)type* lookup_function_type_with_arguments(type*, int, type**)nparams == 0type* create_range_type(type*, type*, const dynamic_prop*, const dynamic_prop*, LONGEST)index_type->code () != TYPE_CODE_VOIDTYPE_LENGTH (index_type) > 0type* create_range_type_with_stride(type*, type*, const dynamic_prop*, const dynamic_prop*, LONGEST, const dynamic_prop*, bool)stride != nullptrInvalid anonymous type %s [in module %s], GCC PR debug/47510 bug?void get_unsigned_type_max(type*, ULONGEST*)type->code () == TYPE_CODE_INT && type->is_unsigned ()TYPE_LENGTH (type) <= sizeof (ULONGEST)void get_signed_type_minmax(type*, LONGEST*, LONGEST*)type->code () == TYPE_CODE_INT && !type->is_unsigned ()TYPE_LENGTH (type) <= sizeof (LONGEST)int internal_type_vptr_fieldno(type*)void set_type_vptr_fieldno(type*, int)type* internal_type_vptr_basetype(type*)TYPE_SPECIFIC_FIELD (type) == TYPE_SPECIFIC_CPLUS_STUFFvoid set_type_vptr_basetype(type*, type*)int is_dynamic_type_internal(type*, int)type->num_fields () == 1------ Arg is %s [%d], parm is %s [%d] type* type::fixed_point_type_base_type()type->code () == TYPE_CODE_FIXED_POINT%*stype node %*sname '%s' (%*scode 0x%x (TYPE_CODE_UNDEF)(TYPE_CODE_PTR)(TYPE_CODE_ARRAY)(TYPE_CODE_STRUCT)(TYPE_CODE_UNION)(TYPE_CODE_ENUM)(TYPE_CODE_FLAGS)(TYPE_CODE_FUNC)(TYPE_CODE_INT)(TYPE_CODE_FLT)(TYPE_CODE_VOID)(TYPE_CODE_SET)(TYPE_CODE_RANGE)(TYPE_CODE_STRING)(TYPE_CODE_ERROR)(TYPE_CODE_MEMBERPTR)(TYPE_CODE_METHODPTR)(TYPE_CODE_METHOD)(TYPE_CODE_REF)(TYPE_CODE_CHAR)(TYPE_CODE_BOOL)(TYPE_CODE_COMPLEX)(TYPE_CODE_TYPEDEF)(TYPE_CODE_NAMESPACE)(TYPE_CODE_FIXED_POINT)(UNKNOWN TYPE CODE)%*slength %s %*sobjfile %*sgdbarch %*starget_type %*spointer_type %*sreference_type %*stype_chain %*sinstance_flags 0x%x TYPE_CONST TYPE_VOLATILE TYPE_CODE_SPACE TYPE_DATA_SPACE TYPE_ADDRESS_CLASS_1 TYPE_ADDRESS_CLASS_2 TYPE_RESTRICT TYPE_ATOMIC%*sflags TYPE_UNSIGNED TYPE_NOSIGN TYPE_ENDIANITY_NOT_DEFAULT TYPE_STUB TYPE_TARGET_STUB TYPE_PROTOTYPED TYPE_VARARGS TYPE_VECTOR TYPE_FIXED_INSTANCE TYPE_STUB_SUPPORTED TYPE_NOTTEXT%*snfields %d associated allocated %*s[%d] enumval %s type %*s[%d] bitpos %s bitsize %d type %*slow high %*scplus_stuff %*svptr_fieldno %d %*svptr_basetype %*sn_baseclasses %d %*snfn_fields %d %*svirtual_field_bits (%d bits at *%*sprivate_field_bits (%d bits at *%*sprotected_field_bits (%d bits at *%*scalling_convention %d %*sfn_fieldlists %*s[%d] name '%s' () length %d %*s[%d] physname '%s' (%*stype %*sargs %*sfcontext %*sis_const %d %*sis_volatile %d %*sis_private %d %*sis_protected %d %*sis_stub %d %*sdefaulted %d %*sis_deleted %d %*svoffset %u %*s[%d] name '%s' %*sgnat_stuff %*sno descriptive type %*sdescriptive type %*sfloatformat %*sself_type %*sfixed_point_info %Qd%*sscaling factor: %s %*s bit size = %u, bit offset = %u Type %s is not a structure or union type.Type %s has no component named %s.Cannot determine struct field location (invalid location kind)type* resolve_dynamic_struct(type*, property_addr_info*)TYPE_FIELD_LOC_KIND (resolved_type, i) == FIELD_LOC_KIND_BITPOStype* resolve_dynamic_range(type*, property_addr_info*, bool)dyn_range_type->code () == TYPE_CODE_RANGEbit strides that are not a multiple of the byte size are currently not supportedtype* resolve_dynamic_array_or_string(type*, property_addr_info*, bool)type->code () == TYPE_CODE_ARRAY || type->code () == TYPE_CODE_STRINGcannot determine array stride for type %sbool types_deeply_equal(type*, type*)type1 != NULL && type2 != NULLUnsupported field kind %d by check_types_equalvoid type::set_fixed_point_info(fixed_point_type_info*) consttype* init_type(objfile*, type_code, int, const char*)(bit % TARGET_CHAR_BIT) == 0__CORE_ADDRtype* arch_type(gdbarch*, type_code, int, const char*)type* arch_composite_type(gdbarch*, const char*, type_code)code == TYPE_CODE_STRUCT || code == TYPE_CODE_UNIONdouble complex_Decimal32_Decimal64_Decimal128true characterint0_tuint8_tuint16_tuint24_tuint32_tuint64_tuint128_ttype* copy_type_recursive(objfile*, type*, htab_t)type->objfile_owner () == objfileUnexpected type field location kind: %dbad type_specific_kindconst gdb::array_view* dynamic_prop::variant_parts() constm_kind == PROP_VARIANT_PARTSvoid type::set_owner(objfile*)void type::set_owner(gdbarch*)arch != nullptrdd d_dl_fixupvoid gdb_mpz::safe_export(gdb::array_view, int, bool) const../../gdb/gmp-utils.cbuf.size () > 0%ZdCannot export value %s as %zu-bits %s integer (must be between %s and %s)word_countp == 1Virtual baseclass pointer is not availableBaseclass offset not foundI'm confused: virtual function table has bad typeQt__ct____dt__gnu-v2GNU G++ Version 2 ABIint gnuv3_dynamic_class(type*)../../gdb/gnu-v3-abi.cvalue* gnuv3_get_vtable(gdbarch*, type*, CORE_ADDR)container_type->code () == TYPE_CODE_STRUCTvalue* gnuv3_get_virtual_fn(gdbarch*, value*, type*, int)vtable != NULLOnly classes can have virtual functions.&virtual , this adjustment &virtual table offset Expected a negative vbase offset (old compiler?)Misaligned vbase offset.int gnuv3_baseclass_offset(type*, int, const bfd_byte*, LONGEST, CORE_ADDR, const value*)_ZTVcan't find linker symbol for virtual table for `%s' value found `%s' insteadptrdiff_tvcall_and_vbase_offsetsoffset_to_topvirtual_functionsvoid* build_gdb_vtable_type(gdbarch*)field == (field_list + 4)gdb_gnu_v3_abi_vtablestd::type_infolanguage_pass_by_ref_info gnuv3_pass_by_reference(type*)dtor_def == DOES_NOT_EXIST_IN_SOURCE_vptr.type_info__namevoid* build_std_type_info_type(gdbarch*)field == (field_list + 2)gdb_gnu_v3_type_infognu-v3GNU G++ Version 3 ABIcould not find minimal symbol for typeinfo address %stypeinfo symbol '%s' has unexpected namecannot find typeinfo for unnamed typecannot find typeinfo for object of type '%s'could not find typeinfo symbol for '%s'void compute_vtable_size(htab_t, std::vector*, value*)This object does not have a virtual function table vtable for '%s' @ %s (subobject @ %s): [%d]: unsafeSizeofUnknown function in `unsafe' package: %sint go_yyparse()go-exp.ygo with `this' fieldvirtual int go_language::parser(parser_state*) constnilchancapiota<-RAW_STRINGTYPE_KEYWORDCHAN_KEYWORDLEN_KEYWORDCAP_KEYWORDNEW_KEYWORDIOTA_KEYWORDNIL_KEYWORDBYTE_KEYWORDANDNOTLEFT_ARROWygIugIIfgIigIlgIogIrgIgI }gI K I)7EJ*CN+4gI 7gI+gI&3N'.gI"1gI#vgI$zgI%jG O 1NRbQ -PڙK5NS~L:NgI>NNLGY\LG6'=@423;5C+!,"1<?&A%B  #$()*-./0789:  12345689;<=89=;<=)*+,-./0123456789:;<=>?  H C2==@B B&'gj?4o234@@w=>AE!"#$%&')*+,-./012345689;<=C!"#$%&')*+,-./012345689;<=@!"#$%&')*+,-./012345689;<=@!"#$%&')*+,-./012345689;<="#$%&')*+,-./012345689;<=$%&')*+,-./012345689;<=%&')*+,-./012345689;<=&')*+,-./012345689;<=')*+,-./012345689;<=)*+,-./012345689;<=+,-./012345689;<=/012345689;<=2345689;<=45689;<=!"#$'d:;<=>?&@AJBCD@ABCD(MNOPQRSTUVWXYZ[\]^_`abcl f))G %)wHH niF IkKpe rtqEvLxy*h+,-./0123456789:;<=>?@ABCD*o+,-./0123456789:;<=>?@ABCD*m+,-./0123456789:;<=>?@ABCD*u+,-./0123456789:;<=>?@ABCD,-./0123456789:;<=>?@ABCD./0123456789:;<=>?@ABCD/0123456789:;<=>?@ABCD0123456789:;<=>?@ABCD123456789:;<=>?@ABCD23456789:;<=>?@ABCD456789:;<=>?@ABCD89:;<=>?@ABCD;<=>?@ABCD=>?@ABCD36;4EC5>?D8=7A  B  @21/.-,+%&)*'(#$!" B<:90 "%)-18?EIMQUY]aeimquy}  .[]dq &'234=>AEFGHJMNOP=HOHHHHOGH!"#$%&')*+,-./012345689;<=4O2=HO@HHHHHHHHHHHHHHHHHHHHHHH PGIOBLH@@C ?HKH@H@HDEEFGGHHHHHHHHHHHHIHJKKKLHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHMMHHHNNOOOP3gsj Gofloat32float64complex64complex128void unpack_package_and_object(char*, const char**, const char**)../../gdb/go-lang.clast_dot != NULL__go_init_mainmain.mainlibgo_char* unpack_mangled_go_symbol(const char*, const char**, const char**, const char**, const char**, int*)p[-1] == 'p'(*__data__lengthchar* go_symbol_package_name(const symbol*)sym->language () == language_gomain.mainN,8 x) $/, wP+hDly)) &xy$ ry yztp *| *l(*0*8*@*ww11go_language^NNUnable to read string addressUnable to read string lengthguile-repl currently does not take any arguments.Guile scripting is not supported in this copy of GDB.Start a Guile interactive prompt. Guile scripting is not supported in this copy of GDB. This command is only a placeholder.guile-replgrEvaluate a Guile expression. Guile scripting is not supported in this copy of GDB. This command is only a placeholder.guPrefix command for Guile preference settings.Prefix command for Guile info displays.print-stacknone == no stack or message will be printed. full == a message and a stack will be printed. message == an error message without a stack will be printed.Show the mode of Guile exception printing on error.Set mode for Guile exception printing on error.Guile-gdb.scmINDN<NmJNNNmessagefullnonevoid inf_child_open_target(const char*, int)../../gdb/inf-child.cdynamic_cast (target) != NULLDone. Use the "run" command to start a process. Argument given to "disconnect".Native processNative process (started by the "run" command).24memory_breakpoint_targetI22process_stratum_targetE^SN($''@?( @((A(0B(8C(@D(TE(\F(la (H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(p` p` p` p` ` U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b(c(Xf(8g(g(h(\i(0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wUXN$N^NN16inf_child_targetNw((D((L((HwDw,( ( (!("(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(048<@L=(0>( @((A(0B(8C(@D(TE(\F((((I(J(@K(K(L(M(TO(O(DHQ((S(T(p` p` p` p` ` U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b(c(Xf(8g(g(h(\i(0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(ȉ`8h'{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T(((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wEvent type not recognized. ptraceChild process unexpectedly missing: %s. Using the running image of %s %s. I refuse to debug myself!Attaching to program: %s, %s Attaching to %s Nw`H( HHwDw,( ( (!("(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(048<@L̏0>(0 @((A(0B(8C(@D(TE(\F((<(( J(K(L(M(TO(O(DHQ((S(T(p` p` p` p` ` U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b((Xf(8g(g(h(\i(0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(ȉ`8h'{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T(((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(w17inf_ptrace_target^NNvirtual async_reply_reason thread_fsm::do_async_reply_reason()../../gdb/thread-fsm.hshould not call async_reply_reason hereUnwind stack if a C++ exception is unhandled while in a call dummy is %s. Unwinding of stack if a signal is received while in a call dummy is %s. Coercion of floats to doubles when calling functions is %s. Permission to call functions in the program is %s. value* get_call_return_value(call_return_meta_info*)../../gdb/infcall.cretval != NULLat 0x%sconst char* get_function_name(CORE_ADDR, char*, int)tmp.length () + 1 <= buf_sizeInvalid data type for function to be called.'%s' has unknown return type; cast the call to its declared return typefunction has unknown return type; cast the call to its declared return typemay-call-functionsWhen this permission is on, GDB may call functions in the program. Otherwise, any sort of attempt to call a function in the program will result in an error.Show permission to call functions in the program.Set permission to call functions in the program.coerce-float-to-doubleVariables of type float should generally be converted to doubles before calling an unprototyped function, and left alone when calling a prototyped function. However, some older debug info formats do not provide enough information to determine that a function is prototyped. If this flag is set, GDB will perform the conversion for a function it considers unprototyped. The default is to perform the conversion.Show coercion of floats to doubles when calling functions.Set coercion of floats to doubles when calling functions.unwindonsignalThe unwindonsignal lets the user determine what gdb should do if a signal is received while in a function called from gdb (call dummy). If set, gdb unwinds the stack and restore the context to what as it was before the call. The default is to stop in the frame where the signal was received.Show unwinding of stack if a signal is received while in a call dummy.Set unwinding of stack if a signal is received while in a call dummy.unwind-on-terminating-exceptionThe unwind on terminating exception flag lets the user determine what gdb should do if a std::terminate() call is made from the default exception handler. If set, gdb unwinds the stack and restores the context to what it was before the call. If unset, gdb allows the std::terminate call to proceed. The default is to unwind the frame.Show unwinding of stack if std::terminate() is called while in a call dummy.Set unwinding of stack if std::terminate is called while in call dummy.Cannot call functions in the program: may-call-functions is off.May not call functions while looking at trace frames.Cannot call functions in reverse mode.This target does not support function calls.Too few arguments in function call.value* call_function_by_hand_dummy(value*, type*, gdb::array_view, void (*)(void*, int), void*)sp == gdbarch_frame_align (gdbarch, sp)sp >= lastval_addrsp <= lastval_addrCORE_ADDR push_dummy_code(gdbarch*, CORE_ADDR, CORE_ADDR, gdb::array_view, type*, CORE_ADDR*, CORE_ADDR*, regcache*)gdbarch_push_dummy_code_p (gdbarch)expression cannot be evaluated because the type '%s' is not copy constructibleexpression cannot be evaluated because the type '%s' is not destructibleexpression cannot be evaluated because a copy constructor for the type '%s' could not be found (maybe inlined?)expression cannot be evaluated because a destructor for the type '%s' could not be found (maybe inlined?)bpt->related_breakpoint == bptcall_thread->thread_fsm == sm%s An error occurred while in a function called from GDB. Evaluation of the expression containing the function (%s) will be abandoned. When the function is done executing, GDB will silently stop.The program being debugged exited while in a function called from GDB. Evaluation of the expression containing the function (%s) will be abandoned.The program received a signal in another thread while making a function call from GDB. Evaluation of the expression containing the function (%s) will be abandoned. When the function is done executing, GDB will silently stop.The program stopped in another thread while making a function call from GDB. Evaluation of the expression containing the function (%s) will be abandoned. When the function is done executing, GDB will silently stop.The program being debugged was signaled while in a function called from GDB. GDB has restored the context to what it was before the call. To change this behavior use "set unwindonsignal off". Evaluation of the expression containing the function (%s) will be abandoned.The program being debugged was signaled while in a function called from GDB. GDB remains in the frame where the signal was received. To change this behavior use "set unwindonsignal on". Evaluation of the expression containing the function (%s) will be abandoned. When the function is done executing, GDB will silently stop.The program being debugged entered a std::terminate call, most likely caused by an unhandled C++ exception. GDB blocked this call in order to prevent the program from being terminated, and has restored the context to its original state before the call. To change this behaviour use "set unwind-on-terminating-exception off". Evaluation of the expression containing the function (%s) will be abandoned.The program being debugged stopped while in a function called from GDB. Evaluation of the expression containing the function (%s) will be abandoned. When the function is done executing, GDB will silently stop.... should not be hereFailed to restore inferior state: %s3NXT S\15call_thread_fsm^3NBICannot execute this command while the selected thread is running.Cannot execute this command while looking at trace frames.Printing of return value after `finish' is %s. The program has no registers now.No vector information Executable and object file path: Environment variable "" not defined. Terminal for future runs of program being debugged is "%s". Delete all environment variables? Not supported on this target.environment variable and valueenvironment variable to setSetting environment variable "%s" to null value. Cannot execute this command without a live selected thread.The program is not being run.signal numberSignal handling set to not pass this signal to the program.void set_step_frame(thread_info*)../../gdb/infcmd.cinferior_ptid == tp->ptidThe program being debugged is not being run. No selected thread.Invalid selected thread.Selected thread is running.Program stopped at %s. It stopped after being stepped. It stopped at a breakpoint that has since been deleted. It stopped at breakpoint %d. It stopped with signal %s, %s. Type "info stack" or "info registers" for more information. process_stratum_target* as_process_stratum_target(target_ops*)../../gdb/process-stratum-target.htarget->stratum () == process_stratumKill the program being debugged? [Inferior %d (%s) killed] (raw int prepare_one_step(thread_info*, step_command_fsm*)Cannot find bounds of current functionSingle stepping until exit from function %s, which has no line number information. You have not set the inferior's current working directory. The inferior will inherit GDB's cwd if native debugging, or the remote server's cwd if remote debugging. Current working directory that will be used when starting the inferior is "%s". Asynchronous execution not supported on this target.value* get_return_value(value*, type*)value_type->code () != TYPE_CODE_VOIDfinish_command: function has no target typeValue returned is $%dgdb-result-varreturn-valueValue returned has type: return-type Cannot determine contents Missing register nameInvalid register `%.*s'interrupting-a is meaningless in all-stop mode.No floating-point info available for this processor. inferior-ttyUsage: set inferior-tty [TTY] If TTY is omitted, the default behavior of using the same terminal as GDB is restored.Show terminal for future runs of program being debugged.Set terminal for future runs of program being debugged.void _initialize_infcmd()Follow this command with any number of args, to be passed to the program.Show argument list to give program being debugged when it is started.Set argument list to give program being debugged when it is started.Use this command to change the current working directory that will be used when the inferior is started. This setting does not affect GDB's current working directory.Show the current working directory that is used when the inferior is started.Set the current working directory to be used when the inferior is started. Changing this setting does not have any effect on inferiors that are already running.The environment to give the program, or one variable's value. With an argument VAR, prints the value of environment variable VAR to give the program being debugged. With no arguments, prints the entire environment to be given to the program.Complement to certain "set" commands.Cancel environment variable VAR for the program. This does not affect the program until the next "run" command.Set environment variable value to give the program. Arguments are VAR VALUE where VAR is variable name and VALUE is value. VALUES of environment variables are uninterpreted strings. This does not affect the program until the next "run" command.Add directory DIR(s) to beginning of search path for object files. $cwd in the path means the current working directory. This path is equivalent to the $PATH shell variable. It is a list of directories, separated by colons. These directories are searched to find fully linked executable files and separately compiled object files as needed.Current search path for finding object files. $cwd in the path means the current working directory. This path is equivalent to the $PATH shell variable. It is a list of directories, separated by colons. These directories are searched to find fully linked executable files and separately compiled object files as needed.Kill execution of program being debugged.Attach to a process or file outside of GDB. This command attaches to another target, of the same type as your last "target" command ("info files" will show your target stack). The command may take as argument a process id or a device file. For a process id, you must have permission to send the process a signal, and it must have the same effective uid as the debugger. When using "attach" with a process id, the debugger finds the program running in the process, looking first in the current working directory, or (if not found there) using the source file search path (see the "directory" command). You can also use the "file" command to specify the program, and to load its symbol table.Detach a process or file previously attached. If a process, it is no longer traced, and it continues its execution. If you were debugging a file, the file is closed and gdb no longer accesses it.Disconnect from a target. The target will wait for another debugger to connect. Not available for all targets.Continue program with the specified signal. Usage: signal SIGNAL The SIGNAL argument is processed the same as the handle command. An argument of "0" means continue the program without sending it a signal. This is useful in cases where the program stopped because of a signal, and you want to resume the program while discarding the signal. In a multi-threaded program the signal is delivered to, or discarded from, the current thread only.Queue a signal to be delivered to the current thread when it is resumed. Usage: queue-signal SIGNAL The SIGNAL argument is processed the same as the handle command. It is an error if the handling state of SIGNAL is "nopass". An argument of "0" means remove any currently queued signal from the current thread. This is useful in cases where the program stopped because of a signal, and you want to resume it while discarding the signal. In a multi-threaded program the signal is queued with, or discarded from, the current thread only.queue-signalStep one instruction exactly. Usage: stepi [N] Argument N means step N times (or till program stops for another reason).Step one instruction, but proceed through subroutine calls. Usage: nexti [N] Argument N means step N times (or till program stops for another reason).Execute until selected stack frame returns. Usage: finish Upon return, the value returned is printed and put in the value history.finStep program, proceeding through subroutine calls. Usage: next [N] Unlike "step", if the current source line calls a subroutine, this command does not enter the subroutine, but instead steps over the call, in effect treating it as a single source line.Step program until it reaches a different source line. Usage: step [N] Argument N means step N times (or till program stops for another reason).Execute until past the current line or past a LOCATION. Execute until the program reaches a source line greater than the current or a specified location (same args as break command) within the current frame.Continue the program up to the given location (same form as args for break command). Execution will also stop upon exit from the current stack frame.advanceContinue program being debugged at specified line or address. Usage: jump LOCATION Give as argument either LINENUM or *ADDR, where ADDR is an expression for an address to start at.Continue program being debugged, after signal or breakpoint. Usage: continue [N] If proceeding from breakpoint, a number N may be used as an argument, which means to set the ignore count of that breakpoint to N - 1 (so that the breakpoint won't break until the Nth time it is reached). If non-stop mode is enabled, continue only the current thread, otherwise all the threads in the program are continued. To continue all stopped threads in non-stop mode, use the -a option. Specifying -a and an ignore count simultaneously is an error.fgStart debugged program. You may specify arguments to give it. Args may include "*", or "[...]"; they are expanded using the shell that will start the program (specified by the "$SHELL" environment variable). Input and output redirection with ">", "<", or ">>" are also allowed. With no arguments, uses arguments last specified (with "run" or "set args"). To cancel previous arguments and run with no arguments, use "set args" without arguments. To start the inferior without using a shell, use "set startup-with-shell off".Start the debugged program stopping at the beginning of the main procedure. You may specify arguments to give it. Args may include "*", or "[...]"; they are expanded using the shell that will start the program (specified by the "$SHELL" environment variable). Input and output redirection with ">", "<", or ">>" are also allowed. With no arguments, uses arguments last specified (with "run" or "set args"). To cancel previous arguments and run with no arguments, use "set args" without arguments. To start the inferior without using a shell, use "set startup-with-shell off".Start the debugged program stopping at the first instruction. You may specify arguments to give it. Args may include "*", or "[...]"; they are expanded using the shell that will start the program (specified by the "$SHELL" environment variable). Input and output redirection with ">", "<", or ">>" are also allowed. With no arguments, uses arguments last specified (with "run" or "set args"). To cancel previous arguments and run with no arguments, use "set args" without arguments. To start the inferior without using a shell, use "set startup-with-shell off".startiInterrupt the execution of the debugged program. If non-stop mode is enabled, interrupt only the current thread, otherwise all the threads in the program are stopped. To interrupt all running threads in non-stop mode, use the -a option.List of integer registers and their contents, for selected stack frame. One or more register names as argument means describe the given registers. One or more register group names as argument means describe the registers in the named register groups.List of all registers and their contents, for selected stack frame. One or more register names as argument means describe the given registers. One or more register group names as argument means describe the registers in the named register groups.all-registersExecution status of the program.Print the status of the floating point unit.Print the status of the vector unit.Show additional information about a process. Specify any process id, or use the program being debugged by default.List memory regions mapped by the specified process.List process info from /proc/PID/stat.List process info from /proc/PID/status.List current working directory of the specified process.List command line arguments of the specified process.List absolute filename for executable of the specified process.List files opened by the specified process.List all available info about the specified process.Show whether `finish' prints the return value.Set whether `finish' prints the return value.`-a' is meaningless in all-stop mode.Can't resume all threads and specify proceed count simultaneously.Not stopped at any breakpoint; argument ignored. Continuing. a locationThe "finish" command does not take any arguments.No selected frame."finish" not meaningful in the outermost frame.Run till exit from Run back to call of warning: Function %s does not return normally. Try to finish anyway? Execution is not within a known function.platform-specific solib_create_inferior_hook did not load initial shared libraries.void set_inferior_cwd(const char*)The program being debugged has been started already. Start it from the beginning? Program not restarted.The target does not support running in non-stop mode.-qualified %sStarting programexecfileinfargsNo symbol table loaded. Use the "file" command.Note: Thread %s previously stopped with signal %s, %s. Continuing thread %s (the current thread) with specified signal will still deliver the signals noted above to their respective threads. Continue anyway? Continuing with no signal. Continuing with signal %s. starting addressUnreasonable jump requestNo source file has been specified.Line %d is not in `%s'. Jump anyway? WARNING!!! Destination is in unmapped overlay! Jump anyway? Continuing at A program is being debugged already. Kill it? Not killed.Cannot attach to this target in non-stop modePATH^IgN^,gN gN,SfNtSSfNpx$SS16step_command_fsm^fNBI14until_next_fsm^fNBI18finish_command_fsm^gNBI*Z14attach_commandPKciEUlvE_*Z19notice_new_inferiorP11thread_infobiEUlvE_Printing of inferior events is %s. %d (%s %s)void set_current_inferior(inferior*)../../gdb/inferior.cRequires argument (inferior id(s) to kill)Inferior ID %d not known.Inferior ID %d is not running.Inferior ID %d has no threads.Requires argument (inferior id(s) to detach)inferior* find_inferior_pid(process_stratum_target*, int)Added inferior %d on connection %d (%s %s) Added inferior %d on connection %d (%s) Added inferior %d [Switching to inferior %d [%s] (%s)] No inferiors. target-idDescriptionconnection-idConnectionExecutable is vfork child of inferior vfork-parent is vfork parent of inferior vfork-child[Inferior %d (%s) detached] void inferior_command(const char*, int)inf != nullptr[Current inferior is %d [%s] (%s)] Inferior has no threads.Requires an argument (inferior id(s) to remove)Can not remove current inferior %d.Can not remove active inferior %d.[New inferior %d (%s)] [New inferior %d] inferior* add_inferior_with_spaces()inf->gdbarch != NULLNo argument to -copies-no-connectionNo argument to -execInvalid argumentInvalid copies numberPrint a list of inferiors being managed. Usage: info inferiors [ID]... If IDs are specified, the list is limited to just those inferiors. By default all inferiors are displayed.Add a new inferior. Usage: add-inferior [-copies N] [-exec FILENAME] [-no-connection] N is the optional number of inferiors to add, default is 1. FILENAME is the file name of the executable to use as main program. By default, the new inferior inherits the current inferior's connection. If -no-connection is specified, the new inferior begins with no target connection yet.add-inferiorRemove inferior ID (or list of IDs). Usage: remove-inferiors ID...remove-inferiorsClone inferior ID. Usage: clone-inferior [-copies N] [-no-connection] [ID] Add N copies of inferior ID. The new inferiors have the same executable loaded as the copied inferior. If -copies is not specified, adds 1 copy. If ID is not specified, it is the current inferior that is cloned. By default, the new inferiors inherit the copied inferior's connection. If -no-connection is specified, the new inferiors begin with no target connection yet.clone-inferiorDetach from inferior ID (or list of IDS). Usage; detach inferiors ID...Kill inferior ID (or list of IDs). Usage: kill inferiors ID...Use this command to switch between inferiors. Usage: inferior ID The new inferior ID must be currently known.inferior-eventsShow printing of inferior events (such as inferior start and exit).Set printing of inferior events (such as inferior start and exit).D/proc/%d/fd/0fcntl F_SETFL[%s failed in terminal_inferior: %s] setting tty statevoid child_pass_ctrlc(target_ops*)../../gdb/inflow.c!target_terminal::is_ours ()no inferior resumed in the fg foundThis GDB does not control a terminal. Inferior's terminal status (currently saved by GDB): File descriptor flags = O_RDONLYO_WRONLYO_RDWR | O_NONBLOCK | O_APPEND | 0x%xProcess group = %d /dev/ttydup'ing tty into fd 1dup'ing tty into fd 0dup'ing tty into fd 2GDB: Failed to set controlling terminal: %sFailed to create new terminal session: setsid: %sPrint inferior's saved terminal status.inflowclearing step over infoclear_step_over_infoObserver mode is %s. Forward. Reverse. bogus execution_direction value: %d../../gdb/infrun.cMode of the step operation is %s. Resuming the execution of threads of all processes is %s. Mode for locking scheduler during execution is "%s". Follow exec mode is "%s". Debugger response to a program call of fork or vfork is "%s". Stopping for shared library events is %s. Controlling the inferior in non-stop mode is %s. Inferior debugging is %s. step-over queue now emptyoperator()putting back %d threads to step in global queueCannot change this setting while the inferior is running.Observer mode is now %s. Unable to write siginfoUnable to read siginfoDisabling randomization of debuggee's virtual address space is unsupported on this platform.Disabling randomization of debuggee's virtual address space is %s. Disabling randomization of debuggee's virtual address space is unsupported on this platform. %*.*s %s clear_proceed_status_threadpending event of %s was a finished step. Discarding.thread %s has pending wait status %s (currently_stepping=%d).Debugger's willingness to use displaced stepping to step over breakpoints is %s (currently %s). Debugger's willingness to use displaced stepping to step over breakpoints is %s. stop_kind get_inferior_stop_soon(execution_control_state*)Target does not support this operation.Target '%s' cannot support this command.void do_target_resume(ptid_t, bool, gdb_signal)!tp->stop_requesteddisplaced_step_finish_status displaced_step_finish(thread_info*, gdb_signal)event_thread->inf->displaced_step_state.in_progress_count > 0Switching context from %s to %scontext_switchenable=%dinfrun_asyncprepare_to_wait[Detaching vfork parent %s after child exec] [Detaching vfork parent %s after child exit] void handle_vfork_child_exec_or_exit(int)current_program_space == inf->pspaceresuming vfork parent process %dhandle_vfork_child_exec_or_exittarget_wait (%d.%ld.%ld [%s], status) =print_target_wait_results %d.%ld.%ld [%s],void set_step_info(thread_info*, frame_info*, symtab_and_line) Program terminated with signal signal-namesignal-meaningThe program no longer exists. 0%oexit-code[Inferior %s (%s) exited with code %pF] [Inferior %s (%s) exited normally] Thread Program received signal No more reverse-execution history. Unknown value.Cannot remove breakpoints because program is no longer writable. Further execution is probably impossible. Only signals 1-15 are valid as numeric signals. Use "info signals" for a list of symbolic signals.Signal Stop Print Pass to program Description Use the "handle" command to change these tables. signal to handlenostopnoignorenoprintnopassUnrecognized or ambiguous flag word: "%s".%s is used by the debugger. Are you sure you want to change it? Not confirmed, unchanged. Can not resume the parent process over vfork in the foreground while holding the child stopped. Try "set detach-on-fork" or "set schedule-multiple". [Detaching after %s from child %s] [Attaching after %s %s to child %s] bool follow_fork_inferior(bool, bool)child_inf->vfork_parent == NULLparent_inf->vfork_child == NULL[Detaching after fork from parent %s] Not resuming: switched threads before following fork child.Unexpected pending_follow.kind %d stop_all_threadsvoid insert_step_resume_breakpoint_at_sal_1(gdbarch*, symtab_and_line, frame_id, bptype)inserting step-resume breakpoint at %sinsert_step_resume_breakpoint_at_sal_1void insert_hp_step_resume_breakpoint_at_frame(frame_info*)return_frame != NULLvoid insert_step_resume_breakpoint_at_caller(frame_info*)frame_id_p (frame_unwind_caller_id (next_frame))[Switching to %s] No unwaited-for children left. int normal_stop()get_frame_type (frame) == DUMMY_FRAMEError while running hook_stop: reason=%s~scoped_enable_commit_resumedscoped_enable_commit_resumed::~scoped_enable_commit_resumed()not requesting commit-resumed for target %s, no resumed threadsmaybe_set_commit_resumed_all_targetsnot requesting commit-resumed for target %s, a thread has a pending waitstatusnot requesting commit-resumed for target %s, target has pending eventsenabling commit-resumed for target %svoid scoped_disable_commit_resumed::reset()!enable_commit_resumed!proc_target->commit_resumed_statescoped_disable_commit_resumedscoped_disable_commit_resumed::scoped_disable_commit_resumed(const char*)calling commit_resumed for target %smaybe_call_commit_resumed_all_targetsFound %d events, selecting #%drandom_pending_event_threadthread_info* random_pending_event_thread(inferior*, ptid_t)event thread not foundWaiting for specific thread %s.do_target_wait_1ptid_t do_target_wait_1(inferior*, ptid_t, target_waitstatus*, target_wait_flags)PC of %s changed. was=%s, now=%sprevious breakpoint of %s, at %s gonepending event of %s cancelled.Using pending wait status %s for %s.saving status %s for %d.%ld.%ldsave_waitstatushandle_onebool handle_one(const wait_one_event&)using %sdisplaced-step of %s canceledtarget_wait %s, saving status for %d.%ld.%ldsaved stop_pc=%s for %s (currently_stepping=%d)void stop_all_threads()exists_non_stop_target ()startingpass=%d, iterations=%d %s executing, need stop %s executing, already stopping %s not executinginterruptible_selectvoid resume_1(gdb_signal)!thread_is_in_step_over_chain (tp)resume_1Couldn't deliver signal %s to %s.resume : clear stepstep=%d, signal=%s, trap_expected=%d, current thread [%s] at %sresume: skipping permanent breakpoint, deliver signal firsttp->control.step_resume_breakpoint->loc->permanentskipping permanent breakpoint!step_over_info_valid_p ()displaced_step_prepare_status displaced_step_prepare_throw(thread_info*)gdbarch_supports_displaced_stepping (gdbarch)tp->control.trap_expected!disp_step_thread_state.in_progress ()displaced_step_prepare_throwdisplaced-stepping %s nowfailed to prepare (%s)not enough resources available, deferring step of %sstatus == DISPLACED_STEP_PREPARE_STATUS_OKprepared successfully thread=%s, original_pc=%s, displaced_pc=%scaught exception, disabling displaced stepping: %sdisplaced_step_prepareGot placed in step-over queue!(thread_has_single_step_breakpoints_set (tp) && step)resume: [%s] stepped breakpointrun %s: %spc_in_thread_step_range (pc, tp)stop_waitingvoid keep_going_pass_signal(execution_control_state*)ecs->event_thread->ptid == inferior_ptid!ecs->event_thread->resumed%s has trap_expected set, resuming to collect trapkeep_going_pass_signalstep-over already in progress: step-over for %s deferredstep-over in progress: resume of %s deferredstart_step_overstealing global queue of threads to step, length = %dbool start_step_over()[%s] has inconsistent state: trap_expected=%d, resumed=%d, executing=%d resuming [%s] for step-overCommand aborted.[%s] was resumed.[%s] was NOT resumed.tp->control.trap_expected || tp->step_after_step_resume_breakpointvoid proceed(CORE_ADDR, gdb_signal)!thread_is_in_step_over_chain (cur_thr)Connection %d (%s) does not support multi-target resumption.addr=%s, signal=%sneed to step-over [%s] firstproceedingresuming threads, all-stop-on-top-of-non-stop[%s] target has no executiontp->executing || tp->suspend.waitstatus_pending_presuming %sresuming vfork parent thread %sproceed_after_vfork_doneresuming previously stepped threadkeep_going_stepped_threadexpected thread advanced also (%s -> %s)expected thread still hasn't advancednot resuming previously stepped thread, it has vanishedswitching back to stepped thread (step-over)restart_stepped_threadswitching back to stepped thread (stepping)need to finish step-over of [%s]switch_back_to_stepped_threadneed to step [%s] over single-step breakpointthread [%s] still needs step-overBPSTAT_WHAT_SET_LONGJMP_RESUMEprocess_event_stop_testBPSTAT_WHAT_SET_LONGJMP_RESUME (!gdbarch_get_longjmp_target)void insert_longjmp_resume_breakpoint(gdbarch*, CORE_ADDR)inferior_thread ()->control.exception_resume_breakpoint == NULLinserting longjmp-resume breakpoint at %sinsert_longjmp_resume_breakpointexception resume at %sinsert_exception_resume_from_probeexception resume at %lxinsert_exception_resume_breakpointBPSTAT_WHAT_CLEAR_LONGJMP_RESUMEvoid process_event_stop_test(execution_control_state*)ecs->event_thread->control.exception_resume_breakpoint != NULLBPSTAT_WHAT_SINGLEBPSTAT_WHAT_STEP_RESUMEBPSTAT_WHAT_STOP_NOISYBPSTAT_WHAT_STOP_SILENTBPSTAT_WHAT_HP_STEP_RESUMEstepped permanent breakpoint, stopped in handlerstep-resume breakpoint is insertedno stepping, continuestepping inside range [%s-%s]stepped into dynsym resolve codestepped into indirect branch thunkstepped into signal trampolinestepped into solib return trampstepped into subroutinestepped into undebuggable functionstepi/nextiline number infostepped into inlined functionstepping through inlined functionstepped to a different linestepped to a different line, but it's not the start of a statementstepped to a different frame, but it's not the start of a statementrestart threads: [%s] inferior detachingrestart_threadsrestart threads: [%s] is event threadrestart threads: [%s] not meant to be runningrestart threads: [%s] resumedvoid restart_threads(thread_info*)restart threads: [%s] needs step-over!tp->resumedrestart threads: [%s] has pending statusthread [%s] needs a step-over, but not in step-over queue restart threads: [%s] was steppingrestart threads: [%s] continuinginline step-over in-process while detachingprepare_for_detachdisplaced-stepping in-process while detachingvoid handle_signal_stop(execution_control_state*)ecs->ws.kind == TARGET_WAITKIND_STOPPEDint finish_step_over(execution_control_state*)ecs->event_thread->control.trap_expectedfound resumed threads with pending events, saving statusfinish_step_overpending != tp!tp->executingstop_pc=%shandle_signal_stopstopped by watchpointstopped data address=%s(no data address available)quietly stopped[%s] hit another thread's single-step breakpoint[%s] hit its single-step breakpointstep through delayno user watchpoint explains watchpoint SIGTRAP, ignoringdelayed software breakpoint trap, ignoringdelayed hardware breakpoint/watchpoint trap, ignoringuser-requested stoprandom signal (%s)signal arrived while stepping over breakpointsignal may take us out of single-step rangerandom signal, keep goingsyscall number=%dhandle_syscall_eventhandle_inferior_eventTARGET_WAITKIND_NO_RESUMED (ignoring: bg)handle_no_resumedTARGET_WAITKIND_NO_RESUMED (ignoring: found resumed)Treating signal as SIGTRAPunhandled stop_soon: %dCannot fill $_exitsignal with the correct signal number.bool displaced_step_in_progress_thread(thread_info*)thread != NULLwrite child pc from %s to %s%s is executing new program: %s Could not load symbols for executable %s. Do you need "set sysroot"?void follow_exec(ptid_t, const char*)current_inferior () == inffetch_inferior_eventhandling eventFound %d inferiors, starting at #%ddo_target_waitdo_target_wait returned no eventvoid fetch_inferior_event()ecs->ws.kind != TARGET_WAITKIND_IGNOREcompleted. wait_for_inferior ()wait_for_inferiorWhat debugger does when program gets various signals. Specify a signal as argument to print info on that signal only.Specify how to handle signals. Usage: handle SIGNAL [ACTIONS] Args are signals and actions to apply to those signals. If no actions are specified, the current settings for the specified signals will be displayed instead. Symbolic signals (e.g. SIGSEGV) are recommended but numeric signals from 1-15 are allowed for compatibility with old versions of GDB. Numeric ranges may be specified with the form LOW-HIGH (e.g. 1-5). The special arg "all" is recognized to mean all signals except those used by the debugger, typically SIGTRAP and SIGINT. Recognized actions include "stop", "nostop", "print", "noprint", "pass", "nopass", "ignore", or "noignore". Stop means reenter debugger if this signal happens (implies print). Print means print a message if this signal happens. Pass means let program see this signal; otherwise program doesn't know. Ignore is a synonym for nopass and noignore is a synonym for pass. Pass and Stop may be combined. Multiple signals may be specified. Signal numbers and signal names may be interspersed with actions, with the actions being performed for all signals cumulatively specified.There is no `stop' command, but you can set a hook on `stop'. This allows you to set a list of commands to be run each time execution of the program stops.When non-zero, inferior specific debugging is enabled.Show inferior debugging.Set inferior debugging.When debugging a multi-threaded program and this setting is off (the default, also called all-stop mode), when one thread stops (for a breakpoint, watchpoint, exception, or similar events), GDB stops all other threads in the program while you interact with the thread of interest. When you continue or step a thread, you can allow the other threads to run, or have them remain stopped, but while you inspect any thread's state, all threads stop. In non-stop mode, when one thread stops, other threads can continue to run freely. You'll be able to step each thread independently, leave it stopped or free to run as needed.Show whether gdb controls the inferior in non-stop mode.Set whether gdb controls the inferior in non-stop mode.stop-on-solib-eventsIf nonzero, gdb will give control to the user when the dynamic linker notifies gdb of shared library events. The most common event of interest to the user would be loading/unloading of a new library.Show stopping for shared library events.Set stopping for shared library events.follow-fork-modeA fork or vfork creates a new process. follow-fork-mode can be: parent - the original process is debugged after a fork child - the new process is debugged after a fork The unfollowed process will continue to run. By default, the debugger will follow the parent process.Show debugger response to a program call of fork or vfork.Set debugger response to a program call of fork or vfork.follow-exec-modeAn exec call replaces the program image of a process. follow-exec-mode can be: new - the debugger creates a new inferior and rebinds the process to this new inferior. The program the process was running before the exec call can be restarted afterwards by restarting the original inferior. same - the debugger keeps the process bound to the same inferior. The new executable image replaces the previous executable loaded in the inferior. Restarting the inferior after the exec call restarts the executable the process was running after the exec call. By default, the debugger will use the same inferior.Show debugger response to a program call of exec.Set debugger response to a program call of exec.scheduler-lockingoff == no locking (threads may preempt at any time) on == full locking (no thread except the current thread may run) This applies to both normal execution and replay mode. step == scheduler locked during stepping commands (step, next, stepi, nexti). In this mode, other threads may run during other commands. This applies to both normal execution and replay mode. replay == scheduler locked in replay mode and unlocked during normal execution.Show mode for locking scheduler during execution.Set mode for locking scheduler during execution.schedule-multipleWhen on, execution commands (such as 'continue' or 'next') resume all threads of all processes. When off (which is the default), execution commands only resume the threads of the current process. The set of threads that are resumed is further refined by the scheduler-locking mode (see help set scheduler-locking).Show mode for resuming threads of all processes.Set mode for resuming threads of all processes.step-modeWhen set, doing a step over a function without debug line information will stop at the first instruction of that function. Otherwise, the function is skipped and the step command stops at a different source line.Show mode of the step operation.Set mode of the step operation.displaced-steppingIf on, gdb will use displaced stepping to step over breakpoints if it is supported by the target architecture. If off, gdb will not use displaced stepping to step over breakpoints, even if such is supported by the target architecture. If auto (which is the default), gdb will use displaced stepping if the target architecture supports it and non-stop mode is active, but will not use it in all-stop mode (see help set non-stop).Show debugger's willingness to use displaced stepping.Set debugger's willingness to use displaced stepping.exec-directionTells gdb whether to execute forward or backward.Show direction of execution (forward/reverse).Set direction of execution. Options are 'forward' or 'reverse'.detach-on-forkTells gdb whether to detach the child of a fork.Show whether gdb will detach the child of a fork.Set whether gdb will detach the child of a fork.disable-randomizationWhen this mode is on (which is the default), randomization of the virtual address space is disabled. Standalone programs run with the randomization enabled by default on some platforms.Show disabling of debuggee's virtual address space randomization.Set disabling of debuggee's virtual address space randomization._siginfoIn observer mode, GDB can get data from the inferior, but not affect its execution. Registers and memory may not be changed, breakpoints may not be set, and the program cannot be interrupted or signalled.Show whether gdb controls the inferior in observer mode.Set whether gdb controls the inferior in observer mode.void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {process_stratum_target*, ptid_t, ptid_t}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {ptid_t}]FvP22process_stratum_target6ptid_tS1_El^MNFv6ptid_tEl^|NPFvP22process_stratum_target6ptid_tS1_E^NtNPFv6ptid_tE^ȻNNRĈN~NJ~N~N~N~N~Nonstepreplayforwardreverseoff\BAchildnewLNNRNN+N NNNN#NPsameparentvoid inline_frame_this_id(frame_info*, void**, frame_id*)../../gdb/inline-frame.cframe_id_p (*this_id)int inline_frame_sniffer(const frame_unwind*, frame_info*, void**)depth >= state->skipped_framesvoid step_into_inline_frame(thread_info*)state != NULL && state->skipped_frames > 0symbol* inline_skipped_symbol(thread_info*)state->skipped_frames <= state->skipped_symbols.size ()void clear_inline_frame_state(process_stratum_target*, ptid_t)void skip_inline_frames(thread_info*, bpstat)find_inline_frame_state (thread) == NULLT unordered_remove(std::vector&, typename std::vector::iterator) [with T = inline_state; typename std::vector::iterator = std::vector::iterator]jV338void interp_add(ui*, interp*)../../gdb/interps.cinterp_lookup_existing (ui, interp->name ()) == NULLvoid interp_pre_command_loop(interp*)interp != NULLvoid interp_set(interp*, bool)!top_level || !ui_interp->current_interpreter!top_level || !ui_interp->top_level_interpreterInterpreter `%s' unrecognizedExecute a command in an interpreter. Usage: interpreter-exec INTERPRETER COMMAND... The first argument is the name of the interpreter to use. The following arguments are the commands to execute. A command can have arguments, separated by spaces. These spaces must be escaped using \ or the command and its arguments must be enclosed in double quotes.interpreter-exec commandUsage: interpreter-exec INTERPRETER COMMAND...Could not find interpreter "%s".error in command: "%s".interpreter factory already registered: "%s" XcJ LLbool jit_read_descriptor(gdbarch*, jit_descriptor*, objfile*)../../gdb/jit.cjiter != nullptrobjf_data != nullptrdescriptor_addr = %sjit_read_descriptorjitUnable to read JIT descriptor from remote memory Unable to read JIT code entry from remote memory!Could not recognize DWARF regnum %djit_unwind_reg_set_implvoid jit_frame_this_id(frame_info*, void**, frame_id*)loaded_jit_readerJIT debugging is %s. void jit_dealloc_cache(frame_info*, void*)priv_data->regcache != NULLint jit_frame_sniffer(const frame_unwind*, frame_info*, void**)!*cacheSuccessfully unwound frame using JIT reader.jit_frame_snifferCould not unwind frame using JIT reader.void add_objfile_entry(objfile*, CORE_ADDR)objfile->jited_data == nullptrbreakpoint_addr = %sjit_breakpoint_re_set_internal<< JIT compiled code >>No JIT reader loaded.symfile_addr = %s, symfile_size = %sjit_register_codeCould not read symtab using the loaded JIT reader.jit_reader_try_read_symtabjit_bfd_try_read_symtabError opening JITed symbol file, ignoring it. JITed symbol file is not an object file, ignoring it. JITed object file architecture %s is not compatible with target architecture %s.void jit_event_handler(gdbarch*, objfile*)jiter->jiter_data != nullptrUnable to find JITed code entry at address: %s Unknown action_flag value in JIT descriptor!jit_inferior_initUnsupported JIT protocol version %ld in descriptor (expected 1) No reader name provided.JIT reader already loaded. Run jit-reader-unload first.Opening shared object %sjit_reader_loadCould not locate initialization function: %s.plugin_is_GPL_compatibleReader not GPL compatible.Reader version does not match GDB version./usr/lib/gdbWhen set, JIT debugging is enabled.Show JIT debugging.Set JIT debugging.Load FILE as debug info reader and unwinder for JIT compiled code. Usage: jit-reader-load FILE Try to load file FILE as a debug info reader (and unwinder) for JIT compiled code. The file is loaded from /usr/lib/gdb, relocated relative to the GDB executable if required.jit-reader-loadUnload the currently loaded JIT debug info reader. Usage: jit-reader-unload Do "help jit-reader-load" for info on loading debug info readers.jit-reader-unload17detached_regcache^N+MNttdy!y!Px!x!t__jit_debug_register_code__jit_debug_descriptorNSRUTgdb_init_reader !@#$%^&*()+=|~`}{[]"';:?/>.<,-AutoUnknownThe current source language is "auto; currently %s". The current source language is "%s". * (%s *) %sUnrecognized case-sensitive setting.../../gdb/language.cCase sensitivity in name search is "auto; currently %s". Case sensitivity in name search is "%s". the current case sensitivity setting does not match the language. Range checking is "auto; currently %s". Unrecognized range check setting.Range checking is "%s". the current range check setting does not match the language. Unrecognized case-sensitive setting: "%s"Unrecognized range check setting: "%s"void* language_gdbarch_post_init(gdbarch*)lang != nullptrCurrent language: %s const language_defn* language_def(language)Couldn't find language `%s' in known languages list.static symbol* language_arch_info::type_and_symbol::alloc_type_symbol(language, type*)!type->is_objfile_owned ()language_lookup_primitive_type_as_symbol (%s, %s, %s)Set the status of the type/range checker.Show the status of the type/range checker.Show range checking (on/warn/off/auto).Set range checking (on/warn/off/auto).case-sensitiveFor Fortran the default is off; for other languages the default is on.Show case sensitivity in name search (on/off/auto).Set case sensitivity in name search (on/off/auto).Set the current source language. The currently understood settings are: local or auto Automatic setting based on source file %-16s Use the %s languageShow the current source language.print typedef not implemented for language "%s"print string not implemented for language "%s"print character not implemented for language "%s"emit character not implemented for language "%s"expression parsing not implemented for language "%s"inner value printing not implemented for language "%s"type printing not implemented for language "%s"24auto_or_unknown_language^NN13auto_language^NN16unknown_language^NNNp| x)$/, wP+h\ )) &xtT4Ԍp d| * (*0*8*@*wwN x)$/, wP+h\ )) &xtT4Ԍp d| *(*0*8*@*wwWarning: the current language does not match this frame.2QL,HN x)$/, wP+h\ h )) &xyyyy yzzp *| * (*0*8*@*ww,H2QLkG,H2QkG13language_defn^tNNo label "%s" defined in function "%s".No label "%s" defined in current function.Undefined convenience variable or function "%s" not defined in "%s".Undefined convenience variable or function "%s" not defined.Function "%s" not defined in "%s".Function "%s" not defined.History values used in line specs must have integer values.Convenience variables used in line specs must have integer values.unmatched quote[abilinespec_token linespec_lexer_lex_string(linespec_parser*)../../gdb/linespec.c*(PARSER_STREAM (parser)) != '\0'linespec_token linespec_lexer_consume_token(linespec_parser*)parser->lexer.current.type != LSTOKEN_EOIparser->lexer.current.type == LSTOKEN_STRINGmalformed line offset: "%s"cannot evaluate expressions while program space is in startupmalformed linespec error: unexpected %s, "%s"malformed linespec error: unexpected %sNo source file named %s.void add_matching_symbols_to_info(const char*, symbol_name_match_type, search_domain, collect_info*, program_space*)!SYMTAB_PSPACE (elt)->executing_startupstd::vector decode_digits_ordinary(linespec_state*, linespec*, int, linetable_entry**)elt != NULLstd::vector lookup_prefix_sym(linespec_state*, std::vector*, const char*)void find_method(linespec_state*, std::vector*, const char*, const char*, std::vector*, std::vector*, std::vector*)!pspace->executing_startupsee caller, this text doesn't matterstd::vector decode_digits_list_mode(linespec_state*, linespec*, symtab_and_line)No line %d in the current file.void canonicalize_linespec(linespec_state*, const linespec*)!ls->labels.function_symbols->empty () && (ls->labels.function_symbols->size () == 1)std::vector event_location_to_sals(linespec_parser*, const event_location*)attempt to decode probe locationunhandled event location typeEmpty line specification.Junk at end of line specification: %svoid decode_line_full(event_location*, int, program_space*, symtab*, int, linespec_result*, const char*, const char*)filter == NULL || select_mode == multiple_symbols_allselect_mode == NULL || select_mode == multiple_symbols_all || select_mode == multiple_symbols_ask || select_mode == multiple_symbols_cancel(flags & DECODE_LINE_LIST_MODE) == 0Location %s not availableresult.size () == 1 || canonical->pre_expandedstate->canonical_names[i].suffix != NULLvoid decode_line_2(linespec_state*, std::vector*, const char*)self->canonical != NULL!result->empty ()canonical->suffix != NULL[0] cancel [1] all [%d] %s No choice number %d. duplicate request for %d ignored. coloncommaend of input28symbol_searcher_collect_info^'NNHNSKOH"'GN$XHONNNt12collect_info^N(long) lseek (%d, %ld, %d)/proc/%ld/fdRequires argument (checkpoint id to restart)Not found: checkpoint id %svoid linux_fork_context(fork_info*, int)../../gdb/linux-fork.coldfp != NULLSwitching to %s (main process), file %s, line %d, <%s>No checkpoint number %d. No checkpoints. Requires argument (checkpoint id to detach)No such checkpoint id, %sPlease switch to another checkpoint before detaching the current oneUnable to detach %sDetached %s checkpoint: can't checkpoint multiple threads.checkpoint: can't find fork function in inferior.checkpoint: call_function_by_hand returned null.checkpoint %d: fork returned pid %ld. gdb says parent = %ld. Failed to find new forkvoid linux_fork_mourn_inferior()!fork_list.empty ()void linux_fork_detach(int)Requires argument (checkpoint id to delete)Please switch to another checkpoint before deleting the current oneUnable to kill pid %svoid delete_checkpoint_command(const char*, int)Killed %s scoped_switch_fork_info::scoped_switch_fork_info(ptid_t)m_oldfp != nullptrnewfp != nullptr_waitpidUnable to wait pid %sFork a duplicate process (experimental).checkpointRestore program context from a checkpoint. Usage: restart N Argument N is checkpoint ID, as displayed by 'info checkpoints'.Delete a checkpoint (experimental).Detach from a checkpoint (experimental).IDs of currently known checkpoints.checkpointsCouldn't restore checkpoint state in %s: %stkillkill (SIGKILL) %ld, 0, 0 (%s)kill_one_lwplinux-natPTRACE_KILL %ld, 0, 0 (%s)wait %ld received unknown.kill_wait_one_lwpvoid kill_wait_one_lwp(pid_t)../../gdb/linux-nat.cres == -1 && errno == ECHILDERRNO-OKkill %s ****stop_callbacklwp kill %d %sint stop_callback(lwp_info*)running -> suspending %slinux_nat_stop_lwpalready stopping LWP %ld at GDB's requestalready stopped/stop_requested %salready stopped/no stop_requested yet %slwp %s has no pending signalget_detach_signallwp %s had signal %s but it is in no pass statelwp %s has pending signal %sCould not parse signal set: %ssigchld Debugging of GNU/Linux lwp module is %s. virtual bool linux_nat_target::stopped_by_watchpoint()virtual bool linux_nat_target::stopped_data_address(CORE_ADDR*)virtual bool linux_nat_target::stopped_by_sw_breakpoint()virtual bool linux_nat_target::stopped_by_hw_breakpoint()int check_ptrace_stopped_lwp_gone(lwp_info*)status_callbackvirtual address_space* linux_nat_target::thread_address_space(ptid_t)about to sigsuspendwait_for_signalclosing fd %d for /proc/%d/task/%ld/mem /proc/%d/task/%ld/memopening %s failed: %s (%d) linux_proc_xfer_memory_partial_pidopened fd %d for %s accessing fd %d for pid %ld failed: %s (%d) accessing fd %d for pid %ld got EOF lwp_info* add_initial_lwp(ptid_t)void lwp_lwpid_htab_add_lwp(lwp_info*)slot != NULL && *slot == NULLCannot attach to lwp %d: %sCannot attach to lwp %d: thread is gone (%d: %s)attach_proc_task_lwp_callbackPTRACE_ATTACH %s, 0, 0 (OK)Attaching to a stopped processlinux_nat_post_attach_waitint linux_nat_post_attach_wait(ptid_t, int*)pid == new_pidFailed to stop %d: %sReceived %s after attachingUnable to attach: program exited normally.Unable to attach: program exited with code %d.Unable to attach: program terminated with signal %s, %s.unexpected status %d for PID %ldwaitpid %ld, saving status %swarning: %s %swaiting for new childwait returned unexpected PID %dwait returned unexpected status 0x%xGot clone event from LWP %d, new child is LWP %ldlinux_handle_extended_waitint linux_handle_extended_wait(lwp_info*, int)new_lp->status == 0waitpid of new LWP %ld, saving status %sGot exec event from LWP %ldGot expected PTRACE_EVENT_VFORK_DONE from LWP %ld: stoppingGot PTRACE_EVENT_VFORK_DONE from LWP %ld: ignoringunknown ptrace event %dint select_event_lwp_callback(lwp_info*, int*)selector != NULLint count_events_callback(lwp_info*, int*)count != NULLNot resuming %s (vfork parent)resume_lwpResuming sibling %s, %s, %sNot resuming sibling %s (has pending)Not resuming sibling %s (not stopped)void delete_lwp(ptid_t)[%s exited] int wait_lwp(lwp_info*)!lp->stoppedwait_lwpThread group leader %s vanished.pid == lp->ptid.lwp ()waitpid %s received %sLWP %d exited.%s exited.WIFSTOPPED (status)ignoring syscall %d for LWP %ld (stopping threads), resuming with PTRACE_CONT for SIGSTOPlinux_handle_syscall_trapHandling extended status 0x%06xvoid detach_one_lwp(lwp_info*, int*)lp->status == 0 || WIFSTOPPED (lp->status)Pending %s for %s on detach.detach_one_lwpSending SIGCONT to %sCouldn't reap LWP %d while detaching: %sReaping LWP %d while detaching returned unexpected status 0x%xCan't detach %s: %sPTRACE_DETACH (%s, %s, 0) (OK)creating event pipe failed.target_xfer_status linux_xfer_siginfo(target_object, const char*, gdb_byte*, const gdb_byte*, ULONGEST, ULONGEST, ULONGEST*)NOT resuming LWP %s, not stoppedresume_stopped_resumed_lwpsNOT resuming LWP %s, not resumedNOT resuming LWP %s, has pending statusresuming stopped-resumed LWP %s at %s: step=%dvirtual void linux_nat_target::detach(inferior*, int)num_lwps (pid) == 1PTRACE_SINGLESTEPPTRACE_CONTPreparing to %s %s, %s, inferior_ptid %svirtual void linux_nat_target::resume(ptid_t, int, gdb_signal)Not short circuiting for ignored status 0x%xsigno == GDB_SIGNAL_0Short circuiting for status 0x%x%s %s, %s (resume event thread)/proc/%d/statusCould not open %sSigPnd: ShdPnd: SigBlk: SigIgn: Clearing bogus flag for %smaybe_clear_ignore_sigintptid_t current_lwp_ptid()inferior_ptid.lwp_p ()lin-lwpEnables printf debugging output.Show debugging of GNU/Linux lwp module.Set debugging of GNU/Linux lwp module.linux-namespacesShow debugging of GNU/Linux namespaces module.Set debugging of GNU/Linux namespaces module.int lin_thread_get_thread_signal(unsigned int)i < lin_thread_get_thread_signal_num ()Couldn't do single stepCouldn't wait vfork processvirtual void linux_nat_target::follow_fork(bool, bool)linux_supports_tracefork () >= 0waiting for VFORK_DONE on %dfollow_forkno VFORK_DONE support, sleeping a bitvoid save_stop_reason(lwp_info*)lp->stop_reason == TARGET_STOPPED_BY_NO_REASONlp->status != 0%s stopped by tracesave_stop_reason%s stopped by software breakpoint%s stopped by hardware breakpoint%s stopped by hardware watchpointPTRACE_CONT %s, 0, 0 (%s) (discarding SIGINT)stop_wait_callbackPending event %s in %sint stop_wait_callback(lwp_info*)lp->signalledExpected SIGSTOP caught for %s.[%s], [%s]linux_nat_wait_1waitpid(-1, ...) returned %d, %swaitpid %ld received %sRe-adding thread group leader LWP %d.linux_nat_filter_eventsaving LWP %ld status %s in stopped_pids liststopping for %s of syscall %d for LWP %ldignoring %s of syscall %d for LWP %ldcaught syscall event with no syscall catchpoints. %d for LWP %ld, ignoringLWP %ld exited (resumed=%d)resume_stop SIGSTOP caught for %s.%s %s, 0, 0 (discard delayed SIGSTOP)void linux_nat_filter_event(int, int)lp->resumedDelayed SIGINT caught for %s.%s %s, 0, 0 (discard SIGINT)%s %s, %s (preempt 'handle')Thread group leader %d zombie (it exited, or another thread execd).check_zombie_leadersThread group leader %d vanished.exit (no resumed LWP)exit (ignore)Select single-step %sselect_event_lwpvoid select_event_lwp(ptid_t, lwp_info**, int*)num_events > 0trap ptid is %s.qTfSTMqTsSTMvirtual void linux_nat_target::low_delete_thread(arch_lwp_info*)../../gdb/linux-nat.hlp == NULLLOw<|HlTlgh(0|HHwDw?/@/"(@$(%(\&('(|)(X+(-(>/(T?t1( 3(4(`6(7(048<@L0>((2/$0h.$0h.\s$0h.1]1(0::K(;M(TO(8gDHQ(8S(T(p` p` p` p` ` w`V(//^/Z(///^(T_(_( a(b(_Xf(8g(g(h(\i(0j(l(m(o(p(/r(/Dt($u(v(v(w(a 4B<,=ȉ`8h>S'{(D|( }(}(~(|(D((|((($(<(((((P((((((0D((T((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wx(w0w4P88w<@disp_step_bufs.has_value ()sigval_tsival_intsival_ptr__pid_t__uid_t__clock_t_padsi_pidsi_uid_killsi_tidsi_overrunsi_sigval_timer_rtsi_statussi_utimesi_stime_sigchldsi_addr_addr_lsb_lower_upper_addr_bnd_sigfaultsi_bandsi_fd_sigpollsi_signosi_errnosi_code_sifieldsCannot find AT_ENTRY auxiliary vector entry./proc/%ld/task/%ld/mapsunable to open /proc file '%s'.note.linuxcore.filemalformed core note - too short for headercould not get core note contentsmalformed note - does not end with \0malformed note - too short for supplied file countmalformed note - filename area is too smallmalformed note - filename area is too bigexe = '%s' unable to find command name in core fileunable to handle requestNo current process: you must name one.Can't determine the current process's PID: you must name one.Too many parameters: %sprocess %ld /proc/%ld/cmdlinecmdline = '%s' /proc/%ld/cwdcwd = '%s' unable to read link '%s'/proc/%ld/exe/proc/%ld/maps/proc/%ld/status/proc/%ld/statProcess: %s Exec file: %.*s State: %c Parent process: %s Process group: %s Session id: %s TTY: %s TTY owner process group: %s Flags: %s Minor faults (no memory page): %s Minor faults, children: %s Major faults (memory page faults): %s Major faults, children: %s utime: %s stime: %s utime, children: %s stime, children: %s jiffies remaining in current time slice: %s 'nice' value: %s jiffies until next timeout: %s jiffies until next SIGALRM: %s start time (jiffies since system boot): %s Virtual memory size: %s Resident set size: %s rlim: %s Start of text: %s End of text: %s Start of stack: %s std::vector parse_smaps_data(const char*, std::string)Could not compile regex to match /dev/zero filename^/dev/zero\( (deleted)\)\?$Could not compile regex to match shmem filenames^/\?SYSV[0-9a-fA-F]\{8\}\( (deleted)\)\?$Could not compile regex to match ' (deleted)' (deleted)$%64sError parsing {s,}maps file '%s'Anonymous:VmFlags:ioAnonHugePages:%*s%luError parsing {s,}maps file '%s' number (deleted)/proc/%d/smaps/proc/%d/coredump_filter/proc/%d/maps/proc/%d/cmdline/proc/%d/stat%c%d%d%d%*d%*d%u%*s%*s%*s%*s%*s%*s%*s%*s%*s%ldUid:Gid:RSDTZWdisplaced_step_prepare_status linux_displaced_step_prepare(gdbarch*, thread_info*, CORE_ADDR&)gdbarch_data->num_disp_step_buffers > 0displaced_step_buffers::displaced_step_buffers(gdb::array_view)../../gdb/displaced-stepping.hbuffer_addrs.size () > 0linux-tdepuse-coredump-filterUse this command to set whether gcore should consider the contents of /proc/PID/coredump_filter when generating the corefile. For more information about this file, refer to the manpage of core(5).Show whether gcore should consider /proc/PID/coredump_filter.Set whether gcore should consider /proc/PID/coredump_filter.dump-excluded-mappingsUse this command to set whether gcore should dump mappings marked with the VM_DONTDUMP flag ("dd" in /proc/PID/smaps) when generating the corefile. For more information about this file, refer to the manpage of proc(5) and core(5).Show whether gcore should dump mappings marked with the VM_DONTDUMP flag.Set whether gcore should dump mappings marked with the VM_DONTDUMP flag.Exitingint find_new_threads_once(thread_db_info*, int, td_err_e*)../../gdb/linux-thread-db.cinfo->td_ta_thr_iter_p != NULLFound %d new threads in iteration %d. Warning: find_new_threads_once: Thread 0x%lx (LWP %ld)$sdir:$pdirAuto-loading of inferior specific libthread_db is %s. libthread-db debugging is %s. unknown thread_db error '%d'Cannot deregister process %d from libthread_db: %sCannot find new threads: %spthread_createSymbol "%s" not found in libthread_db: %sRunning libthread_db integrity checks: td_ta_thr_iterbool check_thread_db(thread_db_info*, bool)tdb_testinfo == NULLtd_ta_thr_iter failed: %sno threads seenlibthread_db integrity checks passed. libthread_db integrity checks failed: No libthread_db loadedthread_info* thread_from_lwp(thread_info*, ptid_t)ptid.lwp () != 0Cannot find user-level thread for LWP %ld: %sthread_get_info_callback: cannot get thread info: %sNo TLS library supportTLS load module not foundTLS not allocated yetvirtual CORE_ADDR thread_db_target::get_thread_local_address(ptid_t, CORE_ADDR, CORE_ADDR)current_program_space->exec_bfd ()find_new_threads_callback: cannot get thread info: %sthread_db: skipping exited and joined thread (0x%lx) libthread_db.so.1Trying host libthread_db library: %s. Loading libthread-db library "%s" from explicit directory.try_thread_db_loaddlopen failed: %s. td_initHost %s resolved to: %s. Cannot initialize libthread_db: %std_ta_newtd_ta_new failed: %s td_ta_new failed: %std_ta_map_lwp2thrtd_thr_get_infotd_thr_tls_get_addrtd_thr_tlsbasetd_ta_deleteWarning: thread_db_find_new_threads_silently: nptl_versionWarning: couldn't activate thread debugging using libthread_db: [Thread debugging using libthread_db enabled] Using host libthread_db library "%ps". Warning: While trying to load libthread_db: Expected absolute pathname for libpthread in the inferior, but got %ps.bool try_thread_db_load_from_pdir_1(objfile*, const char*)cp != std::string::nposint check_thread_db_callback(const td_thrhandle_t*, void*)tdb_testinfo != NULL Got thread ... FAIL! th != NULL(%s) == falsearg == (void *) tdb_testinfoth->th_ta_p == tdb_testinfo->info->thread_agent => %dti.ti_ta_p == th->th_ta_pti.ti_tid == (thread_t) th->th_unique; can't map_lwp2thrmemcmp (th, &th2, sizeof (td_thrhandle_t)) == 0; errno(int) errno ... OK $sdirthread_db_load_search returning %d Unable to find libthread_db matching inferior's thread library, thread debugging will not be available.Target and debugger are in different PID namespaces; thread lists and other data are likely unreliable. Connect to gdbserver inside the container.Thread handle size mismatch: %d vs %zu (from libthread_db)'info auto-load libthread-db' does not accept any parametersLinuxThreadDbTablePIDsPidspidsNo auto-loaded libthread-db. libthread-db-search-pathThis path is used to search for libthread_db to be loaded into gdb itself. Its value is a colon (':') separate list of directories to search. Setting the search path to an empty list resets it to its default value.Show the current search path or libthread_db.Set search path for libthread_db.When non-zero, libthread-db debugging is enabled.Show libthread-db debugging.Set libthread-db debugging.If enabled, libthread_db will be searched in 'set libthread-db-search-path' locations to load libthread_db compatible with the inferior. Standard system libthread_db still gets loaded even with this option off. This option has security implications for untrusted inferiors.Show whether auto-loading inferior specific libthread_db is enabled.Enable or disable auto-loading of inferior specific libthread_db.Print the list of loaded inferior specific libthread_db. Usage: info auto-load libthread-dbRun integrity checks on the current inferior's libthread_db.check-libthread-dbIf enabled GDB will run integrity checks on inferior specific libthread_db as they are loaded.Show whether to check libthread_db at load time.Set whether to check libthread_db at load time.linux-thread-dbgeneric 'call succeeded'generic errorno thread to satisfy queryno sync handle to satisfy queryno LWP to satisfy queryinvalid process handleinvalid thread handleinvalid synchronization handleinvalid thread agentinvalid keyno event message for getmsgFPU register set not availableapplication not linked with libthreadrequested event is not supportedcapability not availabledebugger service failedoperation not applicable tono thread-specific data for this threadonly part of register set was written/readX register set not available for this threadthread has not yet allocated TLS for given moduleversions of libpthread and libthread_db do not matchthere is no TLS segment in the given modulemulti-threadmulti-threaded child process.Threads and pthreads support.19private_thread_info^Y(O21thread_db_thread_info^x(Op(O(OdMM(O(O;(OG%O`%On%O%O%O%O%O%O &O"&O.&OJ&Oi&O&O&O&O&O&OmTS%'OP'O}'O'O'O16thread_db_target^)OTR,)O@MHMLM4M '$''\(,4(H(h'((((\((,( ( (!("(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(8(x9(:(:(L;(;(<(=(0>($''@?( @((A(0B(8C(@D(TE(\F(-($'((I(@, @L(T@+O(P(8Q(Q(R(S(T(y yyy$yU(`V(@W( X(Y(Y(Z([(P\(0](^(T_(_( a(\(c(Xf(8g(g(h(\i(dl(m(o(p(q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(Unmatched quote, %s.-source -qualified -function -label -line const linespec_location* get_linespec_location(const event_location*)../../gdb/location.cEL_TYPE (location) == LINESPEC_LOCATIONCORE_ADDR get_address_location(const event_location*)EL_TYPE (location) == ADDRESS_LOCATIONconst char* get_address_string_location(const event_location*)const char* get_probe_location(const event_location*)EL_TYPE (location) == PROBE_LOCATIONexplicit_location* get_explicit_location(event_location*)EL_TYPE (location) == EXPLICIT_LOCATIONconst explicit_location* get_explicit_location_const(const event_location*)event_location_up copy_event_location(const event_location*)unknown event location typevoid event_location_deleter::operator()(event_location*) constconst char* event_location_to_string(event_location*)int event_location_empty_p(const event_location*)invalid explicit location argument, "%s"missing argument for "%s"Source filename requires function, label, or line offset.Floating point numbers must be base 10.Invalid digit '%c' in number.Invalid digit '%c' in octal number.Overflow on numeric constant -- number too large.internal: Undefined class in m2lex()internal: Unforseen case in m2lex()unhandled token in m2lex()Unterminated string or character constant.CAP function is not implementedORD function is not implementedABS function is not implementedMIN function is not implementedMAX function is not implementedFLOAT function is not implementedVAL function is not implementedCHR function is not implementedODD function is not implementedTRUNC function is not implementedSets are not implemented.int m2_yyparse()m2-exp.ypstate->arglist_len > 0strings are not implementedvirtual int m2_language::parser(parser_state*) constHEXUINTM2_TRUEM2_FALSEIDENTVARNAMEMIN_FUNCMAX_FUNCFLOAT_FUNCCHRODDTRUNCINCEXCLQIDnot_expnon_empty_arglistfblockN4expr22m2_unop_high_operationE^3OPGN4expr15binop_operationIL10exp_opcode30EXadL_Z14eval_op_binaryP4typeP10expression6nosideS1_P5valueS8_EEEE^3OTPG3OąDȕd@`H4O8Dȕd@H`NLGY\LG@$$$$=_=/0 2345678=:;<=BC ""A=DCC=&==AB=,B/012B5789:;<=>=@:;<==FGHIJKLM=OPQRSTUVW"=====^===, $AAN34B6s0u2345678:;<=N2345678:;<=  !#345678:;<=34=>?B  !#5678:;<=34=>?$B&'()*+,-./02345678:;<=$A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=A&'()*+,-./02345678:;<=$A&'()*+,-./02345678:;<=$&'()*+,-./02345678:;<=&'()*+,-./02345678:;<=&'()*+,-./02345678:;<=% sss/0OP-QRSTUVW^XYZ[_u]?A1t^\2^_3A_Eabcd~g+ijklmnop4qXYZ[5vwxyz{|}6D789:;<=>` ef_hPQRSTUVWXYZ[QRSTUVWXYZ[ RSTUVWXYZ[ !" TUVWXYZ[, !"FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[rFGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[FGHIJKLMNOPQRSTUVWXYZ[GHIJKLMNOPQRSTUVWXYZ[CDABEFIPKQN (MG)$& (/"@<=:;789(?>0561234(OLH *-+.#%' !, !+'96CFJOTY`gosw{#3  !#34=>?BFGHJKPQRS=HS================HIHHNS&'()*+,-./02345678:;<=H"=BSHHHHSSHSHHHHHHHHHA$CCHHHHHHHHBKSHHHHHHHHH LM HNAAAAAAAA$AAAA$A$A$$HHHONACHHHHH$DAAAAAAHEFFGHIHHHJJHHHHHHHHHHHHHHHHHHHHHHKKLHMHNNNOOHHHHHHHHHHHHHHHHHHHHHHHHHHHHHPQQRRRRS6#$B@&'C()*.modula-2Modula-2\n\b\t\f\r\e\aINTEGERCARDINALREALBOOLEAN _m2_highunbounded structure missing _m2_high fieldinternal error: unbounded array structure is unknown_m2_contentsunbounded structure missing _m2_contents fieldPKODP x)$/, wP+h\ h )) &xy̤TPdtp *\d l0*8*@*ww11m2_language^@KONTYPE = long_set failed to find discrete bounds for its subtypeexpecting long_setSET [SET OF SET OF ARRAY OF RECORD ... END CASE ... END RECORD CASE OF %*sEND ARRAY [] OF [...] : POINTER TO PROCEDURE ) : %s }bit test is out of range, HIGH = %d} * I!gYILOY Ld L W.WsLOmacro define %s included at Defined at #define %s-D%sPrefix for commands dealing with C preprocessor macros.Fully expand any C/C++ preprocessor macro invocations in EXPRESSION. Show the expanded expression.Expand C/C++ preprocessor macro invocations appearing directly in EXPRESSION. Show the expanded expression. This command differs from `macro expand' in that it only expands macro invocations that appear directly in EXPRESSION; if expanding a macro introduces further macro invocations, those are left unexpanded. `macro expand-once' helps you see how a particular macro expands, whereas `macro expand' shows you how all the macros involved in an expression work together to yield a pre-processed expression.expand-onceShow the definition of MACRO, and it's source location. Usage: info macro [-a|-all] [--] MACRO Options: -a, --all Output all definitions of MACRO in the current compilation unit. -- Specify the end of arguments and the beginning of the MACRO.Show the definitions of all macros at LINESPEC, or the current source location. Usage: info macros [LINESPEC]Define a new C/C++ preprocessor macro. The GDB command `macro define DEFINITION' is equivalent to placing a preprocessor directive of the form `#define DEFINITION' such that the definition is visible in all the inferior's source files. For example: (gdb) macro define PI (3.1415926) (gdb) macro define MIN(x,y) ((x) < (y) ? (x) : (y))Remove the definition of the C/C++ preprocessor macro with the given name.List all the macros defined using the `macro define' command.usage: macro undef NAMEInvalid macro name.usage: macro define NAME[(ARGUMENT-LIST)] [REPLACEMENT-LIST]Macro is missing an argument.Two macro arguments with identical names.',' or ')' expected at end of macro arguments.You must follow the `macro expand-once' command with the expression you want to expand.expands to: GDB has no preprocessor macro information for that code. You must follow the `macro expand' command with the expression you want to expand.info macroYou must follow the `info macro' command with the name of the macro whose definition you want to see.The symbol `%s' has no definition as a C/C++ preprocessor macro at gdb::unique_xmalloc_ptr growable_macro_buffer::release()../../gdb/macroexp.cUnterminated comment in macro expansion.eEpPint get_character_constant(shared_macro_buffer*, const char*, const char*)unexpected character constantA character constant must contain at least one character.int get_string_literal(shared_macro_buffer*, const char*, const char*)Newline characters may not appear in string constants.void append_tokens_without_splicing(growable_macro_buffer*, shared_macro_buffer*)src->last_token != -1dest->last_token != -1unable to avoid splicing tokens during macro expansionExpand-once not implemented yet.__VA_ARGS__Malformed argument list for macro `%s'.Wrong number of arguments to macro `%s' (expected %d, got %d).__VA_OPT__ cannot appear inside __VA_OPT____VA_OPT__ must be followed by an open parenthesis__VA_OPT__ is only valid in a variadic macroStringification operator requires an argument.Argument to stringification operator must name a macro parameter.Stray splicing operatorSplicing operator at end of macroUnterminated __VA_OPT__%>%:%:##:><:<%mJScK}M.WsLOJrU:S6MSI$QM7EJigIiJIfgIIlgIFM1gIYX4gI}gI5gIogI*)SYOYOYOrgI5SKHSYODVYOz7R7gIgILugI+gIvgIYOYONIygI3NzgIV.gISsymtab found for `%s', but that file is not covered in the compilation unit's macro informationint compare_locations(macro_source_file*, int, macro_source_file*, int)../../gdb/macrotab.cfile1 && file2! included1 || ! included2macro_source_file* macro_set_main(macro_table*, const char*)! t->main_sourcemacro_source_file* macro_main(macro_table*)void macro_allow_redefinitions(macro_table*)! t->obstackboth `%s' and `%s' allegedly #included at %s:%dmacro `%s' redefined at %s:%d; original definition at %s:%d__FILE____LINE__macro '%s' is #undefined twice, at %s:%d and %s:%d%s: '--readnow' and '--readnever' cannot be specified simultaneouslyWarning: %ps is not a directory..gdbearlyinitfatal error: libbfd ABI mismatch%s: warning: error finding working directory/usr/lib/debug%s: TUI mode is not supported%s: empty path for `--data-directory'could not set baud rate to `%s'.could not set timeout limit to `%s'.Use `%s --help' for a complete list of options.%s: `--args' specified but no program specifiedExcess command line arguments ignored. (%s%s) This is the GNU debugger. Usage: gdb [options] [executable-file [core-file or process-id]] gdb [options] --args executable-file [inferior-arguments ...] Selection of debuggee and its files: --args Arguments after executable-file are passed to inferior. --core=COREFILE Analyze the core dump COREFILE. --exec=EXECFILE Use EXECFILE as the executable. --pid=PID Attach to running process PID. --directory=DIR Search for source files in DIR. --se=FILE Use FILE as symbol file and executable file. --symbols=SYMFILE Read symbols from SYMFILE. --readnow Fully read symbol files on first access. --readnever Do not read symbol files. --write Set writing into executable and core files. Initial commands and command files: --command=FILE, -x Execute GDB commands from FILE. --init-command=FILE, -ix Like -x but execute commands before loading inferior. --eval-command=COMMAND, -ex Execute a single GDB command. May be used multiple times and in conjunction with --command. --init-eval-command=COMMAND, -iex Like -ex but before loading inferior. --nh Do not read ~/.gdbinit. --nx Do not read any .gdbinit files in any directory. Output and user interface control: --fullname Output information used by emacs-GDB interface. --interpreter=INTERP Select a specific interpreter / user interface. --tty=TTY Use TTY for input/output by the program being debugged. -w Use the GUI interface. --nw Do not use the GUI interface. --dbx DBX compatibility mode. -q, --quiet, --silent Do not print version number on startup. Operating modes: --batch Exit after processing options. --batch-silent Like --batch, but suppress all gdb stdout output. --return-child-result GDB exit code will be the child's exit code. --configuration Print details about GDB configuration and then exit. --help Print this message and then exit. --version Print version information and then exit. Remote debugging options: -b BAUDRATE Set serial port baud rate used for remote debugging. -l TIMEOUT Set timeout in seconds for remote debugging. Other options: --cd=DIR Change current directory to DIR. --data-directory=DIR, -D Set GDB's data-directory to DIR. At startup, GDB reads the following early init files and executes their commands: None found. * user-specific early init file: %s At startup, GDB reads the following init files and executes their commands: * system-wide init files: %s * user-specific init file: %s * local init file (see also 'set auto-load local-gdbinit'): ./%s For more information, type "help" from within GDB, or consult the GDB manual (available as on-line info or a printed manual). Report bugs to %s. You can ask GDB-related questions on the GDB users mailing list (gdb@sourceware.org) or on GDB's IRC channel (#gdb on Freenode). mi1 warning: Can't attach to process and specify a core file at the same time.Loading .gdbinit file "%s".captured_main_1tuidbxquietnhnxbatch-silentbatchearly-init-commandearly-init-eval-commandeixeiexdata-directorybaudnwnowindowsreturn-child-result/usr/share/gdb-flag %d -xx1 %d -xx2 %d -bool %d -enum %s -uint %s -zuint-unl %s -string '%s' -- %s 1 0 %s Generic command for testing the options infrastructure.test-optionsCommand used for testing options processing. Usage: maint test-options require-delimiter [[OPTION]... --] [OPERAND]... Options: %OPTIONS% If you specify any command option, you must use a double dash ("--") to mark the end of option processing.Command used for testing options processing. Usage: maint test-options unknown-is-error [OPTION]... [OPERAND]... Options: %OPTIONS%Command used for testing options processing. Usage: maint test-options unknown-is-operand [OPTION]... [OPERAND]... Options: %OPTIONS%require-delimiterunknown-is-errorunknown-is-operandShow maintenance test-options completion result. Shows the results of completing "maint test-options require-delimiter", "maint test-options unknown-is-error", or "maint test-options unknown-is-operand".test-options-completion-resultA flag option.xx1xx2A boolean option.An enum option.A uinteger option.A help doc that spawns multiple lines.zuinteger-unlimitedA zuinteger-unlimited option.A string option.xxxqO4qO0qOzzzyyy/foo/barSet GDB internal variables used for set/show command infrastructure testing.test-settingsShow GDB internal variables used for set/show command infrastructure testing.command used for internal testing.auto-booleanstring-noescapeoptional-filenamezintegerzuintegerhrOdrO`rOzzzyyyxxxInternal profiling is %s. Selftests have been disabled for this build. This command has been moved to "demangle". ../../gdb/maint.cBad value for 'mt set per-command no'.void set_per_command_cmd(const char*, int)maintenance set %s [%d] %-*sShould GDB dump core? bool match_bfd_flags(const char*, flagword)string != nullptrFrom '%s', file type %s: %*sStart: %s, End: %s, Owner token: %p "maintenance time" takes a numeric argument. "maintenance space" takes a numeric argument. Can't find command '%s' to deprecate. "maintenance undeprecate" takes an argument, the command you want to undeprecate. "maintenance deprecate" takes an argument, the command you want to deprecate, and optionally the replacement command enclosed in quotes. requires argument (address or section + address)Unknown section %s.void maintenance_translate_address(const char*, int)sect->the_bfd_section && sect->the_bfd_section->namesect->objfile && objfile_name (sect->objfile)%s + %s in section %s of %s %s + %s in section %s %s + %s no symbol at %s:%s Need to specify section name and address`%s', void maint_print_all_sections(const char*, bfd*, objfile*, const char*)objfile->sections != nullptrExec file: Object file: Core file: %F %H:%M:%S%s.%03d - %s Command execution time: %.6f (cpu), %.6f (wall) Startup time: %.6f (cpu), %.6f (wall) Space used: %ld (%s%ld for this command) Space used: %ld (%s%ld during startup) command finished#symtabs: %d (+%d), #compunits: %d (+%d), #blocks: %d (+%d) command startedCommands for use by GDB maintainers. Includes commands to dump specific internal GDB structures in a human readable form, to cause GDB to deliberately dump core, etc.Commands for showing internal info about the program being debugged.List the BFD sections of the exec and core files. Usage: maintenance info sections [-all-objects] [FILTERS] FILTERS is a list of words, each word is either: + A section name - any section with this name will be printed, or + A section flag - any section with this flag will be printed. The known flags are: ALLOC LOAD RELOC READONLY CODE DATA ROM CONSTRUCTOR HAS_CONTENTS NEVER_LOAD COFF_SHARED_LIBRARY IS_COMMON Sections matching any of the FILTERS will be listed (no FILTERS implies all sections should be printed). Options: %OPTIONS%List GDB's internal section table. Print the current targets section list. This is a sub-set of all sections, from all objects currently loaded. Usually the ALLOC sectoins.target-sectionsMaintenance command for printing GDB internal state.Maintenance command for flushing GDB internal caches.flushSet GDB internal variables used by the GDB maintainer. Configure variables internal to GDB that aid in GDB's maintenanceShow GDB internal variables used by the GDB maintainer. Configure variables internal to GDB that aid in GDB's maintenanceLike "with", but works with "maintenance set" variables. Usage: maintenance with SETTING [VALUE] [-- COMMAND] With no COMMAND, repeats the last executed command. SETTING is any setting you can change with the "maintenance set" subcommands.Get fatal error; make debugger dump its core. GDB sets its handling of SIGQUIT back to SIG_DFL and then sends itself a SIGQUIT signal.dump-meGive GDB an internal error. Cause GDB to behave as if an internal error was detected.internal-errorGive GDB an internal warning. Cause GDB to behave as if an internal warning was reported.internal-warningGive GDB a demangler warning. Cause GDB to behave as if a demangler warning was reported.This command has been moved to "demangle".Per-command statistics settings.per-commandShow per-command statistics settings.If enabled, the execution time for each command will be displayed following the command's output.Show whether to display per-command execution time.Set whether to display per-command execution time.If enabled, the space usage for each command will be displayed following the command's output.Show whether to display per-command space usage.Set whether to display per-command space usage.If enabled, the basic symtab statistics for each command will be displayed following the command's output.Show whether to display per-command symtab statistics.Set whether to display per-command symtab statistics.Set the display of time usage. If nonzero, will cause the execution time for each command to be displayed, following the command's output.Set the display of space usage. If nonzero, will cause the execution space for each command to be displayed, following the command's output.Print a type chain for a given symbol. For each node in a type chain, print the raw data for each member of the type structure, and the interpretation of the data.Print statistics about internal gdb state.Print the internal architecture configuration. Takes an optional file parameter.Commands for checking internal gdb state.Translate a section name and address to a symbol.translate-addressDeprecate a command (for testing purposes). Usage: maintenance deprecate COMMANDNAME ["REPLACEMENT"] This is used by the testsuite to check the command deprecator. You probably shouldn't use this, rather you should use the C function deprecate_cmd().Undeprecate a command (for testing purposes). Usage: maintenance undeprecate COMMANDNAME This is used by the testsuite to check the command deprecator. You probably shouldn't use this.undeprecateRun gdb's unit tests. Usage: maintenance selftest [FILTER] This will run any unit tests that were built in to gdb. If a filter is given, only the tests with that value in their name will ran.selftestList the registered selftests.selftestsWhen enabled GDB is profiled.Show internal profiling.Set internal profiling.worker-threadsGDB may use multiple threads to speed up certain CPU-intensive operations, such as demangling symbol names.Show the number of worker threads GDB can use.Set the number of worker threads GDB can use.all-objectsDisplay information from all loaded object files.maintenance print architectureRELOCREADONLYROMCONSTRUCTORHAS_CONTENTSNEVER_LOADCOFF_SHARED_LIBRARYIS_COMMONIWUφQOOTV O@$O0O=OHO\Ocan't handle PDR for static proc at 0x%lx__GDB_EFI_INFO__PDR for %s, but no symboladr_32fixed decimalfloating decimaladr_64ECOFFbad register number %d (max %d) in symbol %sbad aux index at symbol %scannot map ECOFF basic type 0x%x for %scan't handle TIR fBitfield for %sunable to cross ref btIndirect for %sunexpected type code for %sguessed tag type of %s incorrectlyunable to cross ref btTypedef for %sillegal TIR continued for %sbad rfd entry for %s: file %d, index %dillegal tq0 in forward typedef for %sillegal bt %d in forward typedef for %sillegal array index type for %s, assuming intunknown type qualifier 0x%x../../gdb/mdebugread.c.sdata.sbss.rdata.init.xdata.pdata.fini.rconstunknown symbol type 0x%xdeclaration block contains unhandled symbol type %dstEnd with storage class %d not handledbad ifd for external symbol: %d (max %ld)bad iss for external symbol: %ld (max %ld)unknown external symbol %sbad proc end in aux found from symbol %sbad aux index at block symbol %sunknown local symbol %swith type %dvoid parse_partial_symbols(minimal_symbol_reader&, psymtab_storage*, objfile*)ext_ptr->ifd == f_idxbad file number %ldError reading ECOFF debugging information: %sunknown stabs symbol %sguessed size of linetable for %s incorrectlyWarning: %s `%s' is undefined (in %s) File %s contains %d unresolved references: %4d variables %4d procedures %4d labels xVUnknown memory addresses will be treated as inaccessible. Unknown memory addresses will be treated as RAM. Switching to manual control of memory regions; use "mem auto" to fetch regions from the target again.No memory region number %d. Delete all memory regions? Define attributes for memory region or reset memory region handling to target-based. Usage: mem auto mem LOW HIGH [MODE WIDTH CACHE], where MODE may be rw (read/write), ro (read-only) or wo (write-only), WIDTH may be 8, 16, 32, or 64, and CACHE may be cache or nocacheEnable memory region. Arguments are the IDs of the memory regions to enable. Usage: enable mem [ID]... Do "info mem" to see current list of IDs.Disable memory region. Arguments are the IDs of the memory regions to disable. Usage: disable mem [ID]... Do "info mem" to see current list of IDs.Delete memory region. Arguments are the IDs of the memory regions to delete. Usage: delete mem [ID]... Do "info mem" to see current list of IDs.Memory region attributes.Memory regions settings.inaccessible-by-defaultIf on, and some memory map is defined, debugger will emit errors on accesses to memory not defined in the memory map. If off, accesses to all memory addresses will be allowed.Show handling of unknown memory regions.Set handling of unknown memory regions.0x100000000000000000x100000000Using memory regions provided by the target. Using user-defined memory regions. There are no memory regions defined. Num Enb Low Addr High Addr Attrs %-3d %-3c rw ro wo flash blocksize 0x%x 8 64 nocache No memno lo addressno hi addressrwregion bounds not 16 bit alignedregion bounds not 32 bit alignedregion bounds not 64 bit alignedunknown attribute: %sinvalid memory region: low >= high overlapping memory region Can not parse XML memory map; XML support was disabled at compile time-break-condition-break-condition: Missing the argument-break-watch-break-watch: Missing -break-watch: Garbage following USAGE: %s [ [...]]breakpoint number argument "%s" is not a number.junk at the end of breakpoint number argument "%s".breakpoint %d not found.Usage: tracepoint-number passcountCould not find tracepoint %dmi-cmd-break-break-insert-%s-insert: Missing -dprintf-insert: does not support -h or -a-dprintf-insert: Missing \v\"\%o-break-insert: Garbage following explicit location-break-insert: Garbage following -%s-insert: --source option requires --function, --label, or --line-forceO{TjPZ;RU_Q=TTkY#uYjPHJ vP ]8I J O -catch-load-catch-unload-catch-load/unload: Missing -catch-load/unload: Garbage following the -catch-assertInvalid argument: %s-catch-exception"-e" and "-u" are mutually exclusive-catch-handlersU#uYU{T_Q#uYU_Q#uYTU-P_Q#uYTU-data-disassemble-data-disassemble: Usage: ( [-f filename -l linenum [-n howmany]] | [-s startaddr -e endaddr] | [-a addr] ) [--] mode.-data-disassemble: Mode argument must be in the range 0-5.-data-disassemble: Invalid filename.-data-disassemble: Invalid line number-data-disassemble: No function contains specified addresskY|TWQTjP "-inferior-tty-show-inferior-tty-show: Usage: No argsinferior_tty_terminal-environment-cd: Usage DIRECTORY-environment-path-environment-directorysource-path-environment-pwd: No arguments allowed-environment-pwd: error finding name of working directory: %sPATH{T{T-file-list-exec-source-file-file-list-exec-source-file: Usage: No args-file-list-exec-source-file: No symtabmacro-infoUsage: -file-list-shared-libraries [REGEXP]-file-list-exec-source-files-file-list-exec-source-files: Usage: [--group-by-objfile] [--basename | --dirname] [--] REGEXP-group-by-objfile-basename-dirnameOOOUsage: -info-os [INFOTYPE]Usage: -info-gdb-mi-command MI_COMMAND_NAMEUsage: -info-ada-exceptions [REGEXP]-enable-frame-filters: no arguments allowed-stack-info-depth: Usage: [MAX_DEPTH]-stack-select-frame: Usage: FRAME_SPECframe_info* parse_frame_specification(const char*)../../gdb/mi/mi-cmd-stack.cframe_exp != NULL-stack-info-frame: No arguments allowed-stack-list-frames-stack-list-frames: Usage: [--no-frame-filters] [FRAME_LOW FRAME_HIGH]-stack-list-frames: Not enough frames in stack.void list_arg_or_local(const frame_arg*, what_to_list, print_values, int)!arg->val || !arg->error(values == PRINT_NO_VALUES && arg->val == NULL && arg->error == NULL) || values == PRINT_SIMPLE_VALUES || (values == PRINT_ALL_VALUES && (arg->val != NULL || arg->error != NULL))arg->entry_kind == print_entry_values_no || (arg->entry_kind == print_entry_values_only && (arg->val || arg->error))@entryvoid list_args_or_locals(const frame_print_options&, what_to_list, print_values, frame_info*, int)sym2 != NULL-stack-list-variables-stack-list-variables: Usage: [--no-frame-filters] [--skip-unavailable] PRINT_VALUES-stack-list-args-stack-list-arguments: Usage: [--no-frame-filters] [--skip-unavailable] PRINT_VALUES [FRAME_LOW FRAME_HIGH]-stack-list-arguments: Not enough frames in stack.stack-args-stack-list-locals-stack-list-locals: Usage: [--no-frame-filters] [--skip-unavailable] PRINT_VALUES-no-frame-filters-skip-unavailablemOOsH}$RmOOmOOmOO-target-file-get: Usage: REMOTE_FILE LOCAL_FILE-target-file-put: Usage: LOCAL_FILE REMOTE_FILE-target-file-delete: Usage: REMOTE_FILE-target-file-get-target-file-put-target-file-deleteoctalzero-hexadecimalMust specify the format as: "natural", "binary", "decimal", "hexadecimal", "octal" or "zero-hexadecimal"-var-delete: Usage: [-c] EXPRESSION.-var-delete: Missing required argument after '-c': variable object name-var-delete: Illegal variable object name-var-delete: Invalid option.ndeleted-var-set-format: Usage: NAME FORMAT.Usage: NAME VISUALIZER_FUNCTION.Variable object not found-var-set-format: Usage: NAME FROZEN_FLAG.Invalid flag value-var-show-format: Usage: NAME.-var-info-num-children: Usage: NAME.numchild-var-info-type: Usage: NAME.path_expr-var-info-expression: Usage: NAME.noneditable-var-show-attributes: Usage: NAME.-var-evaluate-expressionCannot specify format more than onceUsage: [-f FORMAT] NAMEGarbage at end of command-var-assign: Usage: NAME EXPRESSION.-var-assign: Variable object is not editable-var-assign: Could not assign expression to variable object-enable-pretty-printing: no arguments allowed-var-set-update-range: Usage: VAROBJ FROM TOdisplayhint-var-create: Usage: NAME FRAME EXPRESSION.-var-create: name of object must begin with a letterName="%s", Frame="%s" (%s), Expression="%s" -var-create: unable to create variable objecthas_morein_scopetype_changednew_typenew_num_childrennew_children-var-update: Usage: [PRINT_VALUES] NAME.changelist-var-list-children: Usage: [PRINT_VALUES] NAME [FROM TO]kYcommand `%s' appears to be duplicated../../gdb/mi/mi-cmds.cada-task-infobreak-afterbreak-commandsbreak-deletedelete breakpointbreak-disabledisable breakpointbreak-enableenable breakpointbreak-infoinfo breakdprintf-insertbreak-listbreak-passcountcatch-throwcatch-rethrowcatch-catchdata-evaluate-expressiondata-list-changed-registersdata-list-register-namesdata-write-memory-bytesdata-write-register-valuesenable-timingsenable-pretty-printingenable-frame-filtersenvironment-cdenvironment-pwdexec-argumentsset argsexec-continueexec-finishexec-jumpexec-interruptexec-nextexec-next-instructionexec-returnexec-stepexec-step-instructionexec-untilfile-exec-and-symbolsfile-exec-filefile-list-shared-librariesfile-symbol-filefix-multi-location-breakpoint-outputgdb-exitgdb-setgdb-showgdb-versionshow versioninferior-tty-setinfo-ada-exceptionsinfo-gdb-mi-commandinfo-oslist-featureslist-target-featuresremove-inferiorstack-info-depthstack-info-framestack-list-argumentsstack-select-framesymbol-list-linestarget-attachtarget-detachtarget-disconnecttarget-downloadtarget-file-deletetarget-file-gettarget-file-puttarget-flash-erasetarget-selectthread-infothread-list-idsthread-selecttrace-define-variabletrace-findtrace-list-variablestrace-starttrace-statustrace-stopvar-assignvar-createvar-deletevar-info-path-expressionvar-info-expressionvar-info-num-childrenvar-info-typevar-list-childrenvar-set-formatvar-set-frozenvar-set-update-rangevar-set-visualizervar-show-attributesvar-show-formatvar-updatebreakpoint-hitread-watchpoint-triggeraccess-watchpoint-triggerfunction-finishedlocation-reachedwatchpoint-scopeend-stepping-rangeexited-signalledexited-normallysignal-receivedsolib-eventsyscall-entrysyscall-returnȴOܴO״OO OO,O=OPOYaOqOO]HQHOOFHvirtual long int ui_file::read(char*, long int)../../gdb/ui-file.hcan't read from this file type7ui_file^[OO-T.p++U$.---,15mi_console_file^OdOmi_getopt_long: oind out of bounds../../gdb/mi/mi-getopt.c%s: Option %s requires an argument%s: Unknown option ``%s''(gdb) virtual void mi_interp::init(bool)../../gdb/mi/mi-interp.cmi->mi_uiout != nullptrthread-group-added,id="i%d"-interpreter-exec: Usage: -interpreter-exec interp command-interpreter-exec: could not find interpreter "%s"thread-selected,id="%d"memory-changedcmd-param-changedbreakpoint-deleted,id="%d"tsv-modifiedinitialtsv-deleted,name="%s"tsv-deletedtsv-created,name="%s",initial="%s"traceframe-changed,num="%d",tracepoint="%d"traceframe-changed,endlibrary-unloadedtarget-namehost-namerecord-started,thread-group="i%d",method="%s",format="%s"record-started,thread-group="i%d",method="%s"record-stopped,thread-group="i%d"thread-group-removed,id="i%d"thread-group-exited,id="i%d",exit-code="%s"thread-group-exited,id="i%d"thread-group-started,id="i%d",pid="%d"thread-exited,id="%d",group-id="i%d"thread-created,id="%d",group-id="i%d"breakpoint-modifiedbreakpoint-createdsymbols-loadedlibrary-loaded*stoppedstopped-threads%s^running *running,thread-id="all" *running,thread-id="%d" mi2mi3mi-interpvoid gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {thread_info*}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {inferior*, int, const char*, const char*}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {int, int}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {const trace_state_variable*}]void gdb::observers::observable::visit_for_sorting(std::vector::observer>&, std::vector::visit_state>&, int) [with T = {const char*, const char*}]FvP11thread_infoEl^eOFvP8inferioriPKcS2_El^OFviiEl^OFvPK20trace_state_variableEl^OFvPKcS0_El^ԿOPFvP11thread_infoE^OxOPFvP8inferioriPKcS2_E^ OOPFviiE^4OOPFvPK20trace_state_variableE^LO̿OPFvPKcS0_E^|OO^OXcJOԁ90181011L9mi_interp^error,msg="unknown error,code="undefined-command"Whether MI is in asynchronous mode is %s. bool register_changed_p(int, readonly_detached_regcache*, readonly_detached_regcache*)../../gdb/mi/mi-main.cprev_value != NULLthis_value != NULLmi continue^exit --reverseAlready in reverse mode.Target %s does not support this command.interrupting all threads of thread groupUsage: -target-detach [pid | thread-group]Invalid syntax of thread-group id '%s'Non-existent thread-group id '%d'Invalid identifier '%s'Thread group is emptyInvalid MI command-data-write-register-values: Usage: -data-write-register-values [ ... ]-data-write-register-values: No registers.-data-write-register-values: No regs and values specified.-data-write-register-values: Regs and vals are not in pairs.bad register number-enable-timings: Usage: %s {yes|no}-add-inferior should be passed no arguments-remove-inferior should be passed a single argumentthe thread group id is syntactically invalidthe specified thread group does not existcannot remove an active inferiorCannot remove last inferior,time={wallclock="%0.5f",user="%0.5f",system="%0.5f"}Usage: -trace-define-variable VARIABLE [VALUE]Name of trace variable should start with '$'-trace-list-variables: no arguments allowed-trace-saveExactly one argument required (file in which to save trace data)Tells GDB whether MI should be in asynchronous mode.Show whether MI asynchronous mode is enabled.Set whether MI asynchronous mode is enabled.target-asyncset mi-asyncshow mi-asyncreverse-nextreverse-nextireverse-stepreverse-stepireverse-finishcli=%s run=%s -exec-run-data-write-memory-data-write-memory: Usage: [-o COLUMN_OFFSET] ADDR FORMAT WORD-SIZE VALUE.Usage: ADDR DATA [COUNT].Hex-encoded '%s' must represent an integral number of addressable memory units.frozen-varobjspending-breakpointsbreakpoint-notificationslanguage-optionundefined-command-error-codeexec-run-start-optiondata-disassemble-a-option-list-features should be passed no arguments-list-target-features should be passed no arguments-data-list-register-values-data-list-register-values: Usage: -data-list-register-values [--skip-unavailable] [...]Usage: -complete COMMANDmax-completions is zero, completion is disabled.matchesmax_completions_reached-data-read-memory-data-read-memory: Usage: ADDR WORD-FORMAT WORD-SIZE NR-ROWS NR-COLS [ASCHAR].-data-read-memory: invalid number of rows.-data-read-memory: invalid number of columns.Unable to read memory.nr-bytestotal-bytesnext-rowprev-rownext-pageprev-pageN/A-data-evaluate-expression: Usage: -data-evaluate-expression expression-data-read-memory-bytesUsage: [ -o OFFSET ] ADDR LENGTH.+downloadsection-sizetotal-sizesection-senttotal-sent-thread-select: USAGE: threadnum.Thread ID %d not known.-thread-list-ids: No arguments required.thread-idscurrent-thread-idnumber-of-threads^connected^done token=`%s' command=`%s' args=`%s' Cannot specify --thread-group together with --allCannot specify --thread together with --allCannot specify --thread together with --thread-groupCannot specify --frame without --threadInvalid thread group for the --thread-group optionInvalid thread id: %dThread id: %d has terminatedInvalid frame id: %dUndefined mi command: (missing implementation)-interpreter-exectrace selection mode is requiredframe-numberframe number is requiredtracepoint-numbertracepoint number is requiredPC is requiredpc-inside-rangeStart and end PC are requiredpc-outside-rangeLine is requiredCould not find the specified lineInvalid mode '%s'-trace-frame-collectedUsage: -trace-frame-collected [--var-print-values PRINT_VALUES] [--comp-print-values PRINT_VALUES] [--registers-format FORMAT][--memory-contents]explicit-variablescomputed-expressionstvars-list-thread-groupsonly '0' and '1' are valid values for the '--recurse' optioninvalid syntax of group id '%s'coresNon-existent thread group id '%d'-var-print-values-comp-print-values-registers-format-memory-contents-available-recurse{T~ROTOTTOOOOOOmi_ui_out* as_mi_ui_out(ui_out*)../../gdb/mi/mi-out.cmi_uiout != NULL%s="nr_rowsnr_colsbodycol_namecolhdrstring_file* mi_ui_out::main_stream()m_streams.size () == 1^0Op9SO Hh    4    \ d   9mi_ui_out--frame--languageUndefined MI command: %s--all --thread-group Duplicate '--thread-group' optionInvalid thread group id--thread Duplicate '--thread' option--frame Duplicate '--frame' option--language Invalid --language argument: %sInvalid value for the '%s' optionProblem parsing arguments: %s %sUnknown value for PRINT_VALUES: must be: 0 or "%s", 1 or "%s", 2 or "%s"--no-values--all-values--simple-valuesinvalid value for --max-results argument-symbol-list-lines: Usage: SOURCE_FILENAME-symbol-list-lines: Unknown source file name.void mi_symbol_info(search_domain, const char*, const char*, bool, size_t)../../gdb/mi/mi-symbol-cmds.csymbols[i].msymbol.minsym != nullptr-symbol-info-functions-symbol-info-variables-symbol-info-modules-symbol-info-types-symbol-info-module-functions-symbol-info-module-variablesmodule_symbol_search_iterator output_module_symbols_in_single_module(ui_out*, module_symbol_search_iterator, module_symbol_search_iterator, search_domain)iter->first.symbol != nullptriter->second.symbol != nullptr-max-results-module-include-nondebugrO HK]OK]OK]OjO HK.gnu_debugdataCannot parse .gnu_debugdata section; LZMA support was disabled at compile timeelf_gnu_ifunc_resolver_return_stop cannot be reached.../../gdb/minsyms.celf_gnu_ifunc_resolver_stop cannot be reached.GDB cannot resolve STT_GNU_IFUNC symbol "%s" without the ELF support compiled in.GDB cannot resolve STT_GNU_IFUNC symbol at address %s without the ELF support compiled in. [clone .coldminimal_symbol_type msym_prefer_to_msym_type(lookup_msym_prefer)unhandled lookup_msym_prefermst_???Recording minsym: %-21s %18s %4d %.*s CORE_ADDR minimal_symbol_upper_bound(bound_minimal_symbol)minsym.minsym != NULLlookup_minimal_symbol (%s, %s, %s) lookup_minimal_symbol (...) = %s (external) lookup_minimal_symbol (...) = %s (file-local) lookup_minimal_symbol (...) = %s (trampoline) lookup_minimal_symbol (...) = NULL Installing %d minimal symbols of objfile %s. bitset::setmst_unknownmst_textmst_text_gnu_ifuncmst_slot_got_pltmst_datamst_bssmst_absmst_solib_trampolinemst_file_textmst_file_datamst_file_bssbitset::test%s: __position (which is %zu) >= _Nb (which is %zu)^OOOO(OOOOO O O.O, void (*)(), const char*, void (*)(const char*, char* const*, char* const*))../../gdb/nat/fork-inferior.cshell_file != NULLCannot exec %sError: %sSETNSUNLINKREADLINKunknown-packet-%d %d %d %d "const char* linux_ns_filename(linux_ns*, int)../../gdb/nat/linux-namespaces.cpid > 0/proc/%d/ns/%slinux_ns* linux_ns_get_namespace(linux_ns_type)type >= 0 && type < NUM_LINUX_NS_TYPESmount namespace helper vanished?unhandled error %dmount namespace helper exited with status %dmount namespace helper killed by signal %dunhandled status %dunknown pid %dmnsh: send: -> %s namespace-helper: recv failed (%s) namespace-helper: recv truncated (%s 0x%x) mnsh: recv: Started mount namespace helper process %d int mnsh_recv_fd(linux_mnsh*, int*, int*)type == MNSH_RET_FDresult < 0int mnsh_recv_int(linux_mnsh*, int*, int*)type == MNSH_RET_INTint linux_mntns_open_cloexec(pid_t, const char*, int, mode_t)access == MNSH_FS_HELPERint linux_mntns_unlink(pid_t, const char*)ssize_t linux_mntns_readlink(pid_t, const char*, char*, size_t)ssize_t mnsh_recv_intstr(linux_mnsh*, int*, int*, void*, int)type == MNSH_RET_INTSTRsize == retipcmntnet %s%s%s LONGEST common_getter(osdata_type*, gdb_byte*, ULONGEST, ULONGEST)../../gdb/nat/linux-osdata.creadbuf/proc/%lld/task/%lld/stat/proc/net/udp/proc/net/udp6/proc/net/tcp6/proc/net/tcp(unknown)STREAMDGRAM%*d: %32[0-9A-F]:%X %32[0-9A-F]:%X %X %*X:%*X %*X:%*X %*X %d %*d %*u %*s %8X%8X%8X%8X%s%s%s%s%s%s%s%s /proc/sysvipc/sem%d %d %o %u %d %d %d %d %lld %lld%d%d%o%u%s%s%s%s%s%s /proc/modules%llx%s%u%d%s%s%llx /proc/cpuinfo%s/proc/%lld/stat%lld %17s /proc/proc/%s/proc/%s/task%lld%s%lld%d /proc/%s/fd%s%s%s%s /proc/sysvipc/shm%d %d %o %d %lld %lld %d %u %u %u %u %lld %lld %lld%d%d%o%d%s%s%d%s%s%s%s%s%s%s /proc/sysvipc/msg%d %d %o %u %u %lld %lld %d %d %d %d %lld %lld %lld%d%d%o%u%u%s%s%s%s%s%s%s%s%s/proc/%lld/cmdline /proc/%lld/proc/%lld/task%lld%s%s%s %lld%s%lld%sESTABLISHEDSYN_SENTSYN_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSINGTypesListing of info os types you can listcpusCPUsListing of all cpus/cores on the systemFile descriptorsListing of all file descriptorsKernel modulesListing of all loaded kernel modulesMessage queuesListing of all message queuesProcessesListing of all processesprocgroupsProcess groupsListing of all process groupsSemaphoresListing of all semaphoresShared-memory regionsListing of all shared-memory regionsSocketsListing of all internet-domain socketsThreadsListing of all threadsOOOOOO OOO$O+OError disabling address space randomization: %sError restoring address space randomization: %s/proc/%ld/task/proc/%d/exe/proc/self/proc is not accessible.TgidCould not open /proc/%ld/task.TracerPidState:T (stopped) /proc/%ld/task/%ld/comm%s: failed to kill child pid %ld %s%s: kill waitpid returned %ld: %s%s: kill status %d is not WIFSIGNALED!process %d is already traced by process %dprocess %d is a zombie - the process has already terminated%s (%d), %s%s (%d)linux_check_ptrace_features: waitpid: unexpected result %d.linux_check_ptrace_features: waitpid: unexpected status %d.linux_test_for_tracefork: failed to resume childlinux_test_for_tracefork: unexpected result from waitpid (%d, status 0x%x)linux_test_for_traceforklinux_check_ptrace_features%s - %s (stopped at syscall)%s - %s (stopped)%s - %s (terminated)%d (exited)objective-cObjective-Cvoid read_objc_methlist_method(gdbarch*, CORE_ADDR, long unsigned int, objc_method*)../../gdb/objc-lang.cnum < read_objc_methlist_nmethods (gdbarch, addr).*]Regexp is too long: %sInvalid regexp (%s): %sBad method name '%s'Selectors matching "%s": No selectors matching "%s" .* Classes matching "%s": No classes matching "%s" internal: compare_classes(1)internal: compare_selectors(1)internal: compare_selectors(2)objc_lookUpClassobjc_lookup_classno way to lookup Objective-C classessel_getUidsel_get_any_uidno way to lookup Objective-C selectors_NSNewStringFromCStringistr+[NSString stringWithCString:]stringWithCString:NSString: internal error -- no way to create new NSStringNXStringUnable to determine target of Objective-C method call (ignoring): All Objective-C selectors, or those matching REGEXP.All Objective-C classes, or those matching REGEXP.Ask an Objective-C object to print itself.print-objectThe 'print-object' command requires an argument (an Objective-C object)_NSPrintForDebuggerUnable to locate _NSPrintForDebugger in child processobject returns null descriptionCan't find selector "%s"const char* find_imps(const char*, std::vector*)symbol_names != NULLvoid find_methods(char, const char*, const char*, const char*, std::vector*)*objc_csym == objfile_csym_objc_msgSend_objc_msgSend_stret_objc_msgSendSuper_objc_msgSendSuper_stret_objc_getClass_objc_getMetaClass.mdO$x)P$/, wP+h(0l) &xyyyy yzzp | * (*0*8*(ww13objc_language^TONbool sort_cmp(const obj_section*, const obj_section*)../../gdb/objfiles.csection not foundobjfile not foundvoid objfile_register_static_link(objfile*, const block*, const dynamic_prop*)const dynamic_prop* objfile_lookup_static_link(objfile*, const block*)entry->block == blockEntry point address is not known.separate_debug_iterator& separate_debug_iterator::operator++()m_objfile != nullptrres != nullptr<>objfile::objfile(bfd*, const char*, objfile_flags)abfd == NULL(flags & OBJF_NOT_FILENAME) != 0objfile::~objfile()void add_separate_debug_objfile(objfile*, objfile*)objfile->separate_debug_objfile_backlink == NULLobjfile->separate_debug_objfile_link == NULLobjfile->separate_debug_objfile == NULLparent->separate_debug_objfile_backlink == NULLparent->separate_debug_objfile_link == NULLvoid objfile_relocate(objfile*, const section_offsets&)debug_objfile->section_offsets.size () == gdb_bfd_count_sections (debug_objfile->obfd)void update_section_map(program_space*, obj_section***, int*)pspace_info->section_map_dirty != 0 || pspace_info->new_objfiles_available != 0obj_section* preferred_obj_section(obj_section*, obj_section*)a->addr () == b->addr ()(a->objfile->separate_debug_objfile == b->objfile) || (b->objfile->separate_debug_objfile == a->objfile)(a->objfile->separate_debug_objfile_backlink == b->objfile) || (b->objfile->separate_debug_objfile_backlink == a->objfile)int filter_debuginfo_sections(obj_section**, int)i == map_size - 1map_size / 2 <= jint filter_overlapping_sections(obj_section**, int)sect1_addr <= sect2_addrunexpected overlap between: (A) section `%s' from `%s' [%s, %s) (B) section `%s' from `%s' [%s, %s). Will ignore section Balloc_size == map_sizeobj_section* find_pc_section(CORE_ADDR)pspace_info->num_sections == 0St15_Sp_counted_ptrIP7objfileLN9__gnu_cxx12_Lock_policyE2EE^PBIPObserver debugging is %s. When non-zero, observer debugging is enabled.Show observer debugging.Set observer debugging.normal_stopsignal_receivedend_stepping_rangesignal_exitedno_historysync_execution_donecommand_errortarget_changedexecutable_changedinferior_createdinferior_execdrecord_changedsolib_loadedsolib_unloadednew_objfilefree_objfilenew_threadthread_exitthread_stop_requestedtarget_resumedabout_to_proceedbreakpoint_createdbreakpoint_deletedbreakpoint_modifiedtraceframe_changedarchitecture_changedthread_ptid_changedinferior_addedinferior_appearedinferior_exitinferior_removedmemory_changedgdb_datadir_changedcommand_param_changedtsv_createdtsv_deletedtsv_modifiedinferior_call_preinferior_call_postregister_changeduser_selected_context_changedsource_styling_changedcurrent_source_symtab_and_line_changedopenclOpenCL CInvalid OpenCL vector size: %dAttempt to perform an unsupported operationCould not determine the vector boundsvoid lval_func_write(value*, value*)../../gdb/opencl-lang.coffset % elsize == 0void lval_func_read(value*)n <= c->nVector operations are not supported on scalar typesCannot perform operation on vectors with different typesCannot perform conditional operation on vectors with different sizesArgument to operation not a number or boolean.Invalid OpenCL vector sizehievenoddInvalid OpenCL vector component accessor %sucharuchar2uchar3uchar4uchar8uchar16ushort2ushort3ushort4ushort8ushort16uint2uint3uint4ulong2ulong3ulong4ulong8ulong16half2half3half4half8half16float2float3float4float8double2double3double4double8double16uintptr_t15opencl_language^m PN P** x),$/, wP+h\ h *)) &xyyyy yzzp *| * (*0*8**ww H0pN4expr25opencl_structop_operationE^l PLN4expr30opencl_logical_binop_operationE^ PRGN4expr28opencl_ternop_cond_operationE^ P,G P++h%DȕdH*@` P+,#Dȕdx*` PP++Dȕd/*,/`int check_note(bfd*, asection*, char*, unsigned int*, const char*, long unsigned int, long unsigned int)../../gdb/osabi.cnotesz <= MAX_NOTESZThe current OS ABI is "auto" (currently "%s"). The current OS ABI is "%s". GNU/LinuxThe default OS ABI is "%s". Updating OS ABI failed.Invalid OS ABI "%s" passed to command handler.gdbarch_register_osabi: An attempt to register a handler for OS ABI "%s" for architecture %s was made. The handler will not be registeredvoid gdbarch_register_osabi(bfd_architecture, long unsigned int, gdb_osabi, void (*)(gdbarch_info, gdbarch*))gdbarch_register_osabi: A handler for OS ABI "%s" has already been registered for architecture %snon-gdbarch_lookup_osabi: invalid OS ABI (%d) from sniffer for architecture %s flavour %dgdbarch_lookup_osabi: multiple %sspecific OS ABI match for architecture %s flavour %d: first match "%s", second match "%s"void gdbarch_init_osabi(gdbarch_info, gdbarch*)info.osabi != GDB_OSABI_UNKNOWNA handler for the OS ABI "%s" is not built into this configuration of GDB. Attempting to continue with the default %s settings. .note.ABI-tagGNUGNU ABI tag value %u unrecognized.FreeBSD.note.netbsd.identNetBSD.note.openbsd.ident.note.netbsdcore.procinfoOpenBSDosabiShow OS ABI of target.Set OS ABI of target.SVR4GNU/HurdSolarislinux(-gnu[^-]*)?WindowsCEDJGPPQNX-NeutrinoCygwinWindowsAIXDICOSDarwinOpenVMSLynxOS178NewlibSDEPikeOSMHPPPPPQPlPPPPP!P(P0P4P:PAPIPSPZP^PTPCan not parse XML OS data; XML support was disabled at compile timeShow OS data ARG.Empty data returned by target. Wrong osdata type?Empty type list returned by target. No type data?Can not fetch data now.Available types of OS data not reported.TitleOSDataTablecol%dOBJECTRECORDSELFvirtual int pascal_language::parser(parser_state*) constp-exp.y:=FIELDNAMEnormal_startfield_expWWghHWTGH!H"GshHGvgIzgIP`Q thisNLGY\LG?@ABCDEFG2321,43Q!"#$&'()PR./01./01kjl {&'()./01%'+,012 !"#$&'()./013 !"#$&'()./013 !"#$&'()./013 !"#$&'()./013 !"#$&'()./01 !"#$&'()./01 !"#$&'()./01 !"#$&'()./01 !"#$&'()()./01./01.014+Q-,r2MN&'(&'(# O36S66m{UVQPXYZ[\]^_`abcdefghi)RW)Tz|oABCDEFGHn5pIJKLIJKLvuw }EFGHIJKL789:;<=>?@ABCDEFGHIJKL7q89:;<=>?@ABCDEFGHIJKL7s89:;<=>?@ABCDEFGHIJKL7t89:;<=>?@ABCDEFGHIJKL7y89:;<=>?@ABCDEFGHIJKL9:;<=>?@ABCDEFGHIJKL:;<=>?@ABCDEFGHIJKL;<=>?@ABCDEFGHIJKL=>?@ABCDEFGHGHIJKLIJKL249LE36:01M5?CBAHJKIFG@ D /.-,&'*+()$% !"#=>87 (31JGXY[_msww  &/3Idw   67 %'+,01289:;G;G3333;:;?343;576889::;;;;;;<;;;;=;>;???;;;@;;;;;;;;;;;;;;;;;;;;;;;;;;;;AABCBBBDEFFFFGGGGHH2klxj !"/$*%pascalPascalCapacity.pas.pp_p__M0_main_programpascal_main_program_p_initialize P FU" P,!Px)$/, wP+h\ h X)) &xԬ {d00p | * (0*8*@*ww15pascal_language^!PNrecord case of %*s %*s _vptr%*sprotected %*sprivate %*spublic %s; constructor destructor procedure function ; virtual%*send := %srecord set of array [%s..%s] void pascal_language::type_print_varspec_prefix(type*, ui_file*, int, int, const type_print_options*) const../../gdb/p-typeprint.cunexpected typevoid pascal_language::type_print_varspec_suffix(type*, ui_file*, int, int, int, const type_print_options*) constPrinting of pascal static members is %s. pascal_static-membersShow printing of pascal static members.Set printing of pascal static members.Invalid pascal type code %d in symbol table.__vtbl_ptr_type!gYILOjGO W.WsLOParser debugging is %s. Expression debugging is %s. void parser_state::mark_struct_expression(expr::structop_base_operation*)../../gdb/parse.cparse_completion && (m_completion_state.expout_tag_completion_type == TYPE_CODE_UNDEF)void parser_state::mark_completion_tag(type_code, const char*, int)parse_completion && (m_completion_state.expout_tag_completion_type == TYPE_CODE_UNDEF) && m_completion_state.expout_completion_name == NULL && m_completion_state.expout_last_op == nullptrtag == TYPE_CODE_UNION || tag == TYPE_CODE_STRUCT || tag == TYPE_CODE_ENUM Unknown FILE used. bool exp_uses_objfile(expression*, objfile*)When non-zero, the internal representation of expressions will be printed.Show expression debugging.Set expression debugging.parserWhen non-zero, expression parser tracing will be enabled.Show parser debugging.Set parser debugging.expression to computeJunk after end of expression.N4expr23tuple_holding_operationIJiEEE^'PpLN4expr14last_operationE^(P(P((P4@XDȕd8,``Memory tagging not supported or disabled by the current architecture.Printing of source filename and line number with is %s. The largest offset that will be printed in form is %s. Address %s not in a region mapped with a memory tagging flag.There are no auto-display expressions now. Auto-display expressions now in effect: Num Enb Expression %d: %c /%d%c%c /%c (cannot be evaluated in the current context)memory-tag void printf_pointer(ui_file*, const char*, value*)../../gdb/printcmd.c*p == 'p' && *(p + 1) == '\0'(nil)one or more display numbersbad display number at or near '%s'No display number %d. Size letters are meaningless in "%s" command.Item count other than 1 is meaningless in "%s" command.Format letter "%c" is meaningless in "%s" command.Argument required.Symbol "" is a field of the local class variable `self' `this' " is at in a file compiled without debugging, -- loaded at in overlay section %s" is a label at address void info_address_command(const char*, int)a variable in register %saddress of an argument in register %san argument at offset %lda local variable at frame offset %lda reference argument at offset %lda typedefa function at address a thread-local variable at offset %s in the thread-local storage for `%s'of unknown (botched) typeunmapped%s + %uvoid info_symbol_command(const char*, int)osect->objfile && objfile_name (osect->objfile)%s in load address range of %s overlay section %s of %s %s in load address range of section %s of %s %s in %s overlay section %s of %s %s in load address range of %s overlay section %s %s in load address range of section %s %s in %s overlay section %s No symbol matches %s. <*%+d*>Disabling display %d to avoid infinite recursion. %*s%ps = Argument required (address or pointer)Logical tag (%s) does not match the allocation tag (%s) for address %s. Memory tags for address %s match (%s). LogicalAllocationaddress or pointer%s tag unavailable. bool should_validate_memtags(value*)value != nullptr && value_type (value) != nullptrLogical tag (%s) does not match the allocation tag (%s). Could not validate memory tag: %s Error parsing length argument.Invalid zero or negative length.Error parsing tags argument. Tags should be 2 digits per byte.Could not update the allocation tag(s). Allocation tag(s) updated successfully.
Error parsing tags argument. The tag should be 2 digits.Could not update the logical tag data. Expression is not an assignment (and might have no effect)void print_scalar_formatted(const gdb_byte*, type*, const value_print_options*, int, ui_file*)options->format != 's'Undefined output size "%c".Undefined output format "%c".Unable to display strings with size '%c', using 'b' instead.No line number information available for address CORE_ADDR find_string_backward(gdbarch*, CORE_ADDR, int, int, const value_print_options*, int*)char_size == 1 || char_size == 2 || char_size == 4Cannot access memory at address %s starting display addressvoid clear_dangling_display_expressions(objfile*)objfile->pspace == pspaceUnable to display "%s": %s%p[%p] format-control string and values to printWrong number of arguments for specified format-stringexpected wchar_t argument for %%lclong long not supported in printfDelete all auto-display expressions? void delete_display(display*)display != NULLiter != all_displays.end ()printcmdDescribe where symbol SYM is stored. Usage: info address SYMDescribe what symbol is at location ADDR. Usage: info symbol ADDR Only for symbols with fixed locations (global or static scope).Examine memory: x/FMT ADDRESS. ADDRESS is an expression for the memory address to examine. FMT is a repeat count followed by a format letter and a size letter. Format letters are o(octal), x(hex), d(decimal), u(unsigned decimal), t(binary), f(float), a(address), i(instruction), c(char), s(string) and z(hex, zero padded on the left). Size letters are b(byte), h(halfword), w(word), g(giant, 8 bytes). The specified number of objects of the specified size are printed according to the format. If a negative number is specified, memory is examined backward from the address. Defaults for format and size letters are those previously used. Default count is 1. Default address is following last thing printed with this command or "print".Expressions to display when program stops, with code numbers. Usage: info displayCancel some expressions to be displayed when program stops. Usage: undisplay [NUM]... Arguments are the code numbers of the expressions to stop displaying. No argument means cancel all automatic-display expressions. "delete display" has the same effect as this command. Do "info display" to see current list of code numbers.undisplayPrint value of expression EXP each time the program stops. Usage: display[/FMT] EXP /FMT may be used before EXP as in the "print" command. /FMT "i" or "s" or including a size-letter is allowed, as in the "x" command, and then EXP is used to get the address to examine and examining is done as in the "x" command. With no argument, display all currently requested auto-display expressions. Use "undisplay" to cancel display requests previously made.Enable some expressions to be displayed when program stops. Usage: enable display [NUM]... Arguments are the code numbers of the expressions to resume displaying. No argument means enable all automatic-display expressions. Do "info display" to see current list of code numbers.Disable some expressions to be displayed when program stops. Usage: disable display [NUM]... Arguments are the code numbers of the expressions to stop displaying. No argument means disable all automatic-display expressions. Do "info display" to see current list of code numbers.Cancel some expressions to be displayed when program stops. Usage: delete display [NUM]... Arguments are the code numbers of the expressions to stop displaying. No argument means cancel all automatic-display expressions. Do "info display" to see current list of code numbers.Formatted printing, like the C "printf" function. Usage: printf "format string", ARG1, ARG2, ARG3, ..., ARGN This supports most C printf format specifications, like %s, %d, etc.Like "print" but don't put in value history and don't print newline. Usage: output EXP This is useful in user-defined commands.Evaluate expression EXP and assign result to variable VAR. Usage: set VAR = EXP This uses assignment syntax appropriate for the current language (VAR = EXP or VAR := EXP for example). VAR may be a debugger "convenience" variable (names starting with $), a register (a few standard names starting with $), or an actual variable in the program being debugged. EXP is any valid expression. Use "set variable" for variables with names identical to set subcommands. With a subcommand, this command modifies parts of the gdb environment. You can see these environment settings with the "show" command.Evaluate expression EXP and assign result to variable VAR. Usage: assign VAR = EXP This uses assignment syntax appropriate for the current language (VAR = EXP or VAR := EXP for example). VAR may be a debugger "convenience" variable (names starting with $), a register (a few standard names starting with $), or an actual variable in the program being debugged. EXP is any valid expression. Use "set variable" for variables with names identical to set subcommands. With a subcommand, this command modifies parts of the gdb environment. You can see these environment settings with the "show" command.Call a function in the program. Usage: call EXP The argument is the function name and arguments, in the notation of the current working language. The result is printed and saved in the value history, if it is not void.Evaluate expression EXP and assign result to variable VAR. Usage: set variable VAR = EXP This uses assignment syntax appropriate for the current language (VAR = EXP or VAR := EXP for example). VAR may be a debugger "convenience" variable (names starting with $), a register (a few standard names starting with $), or an actual variable in the program being debugged. EXP is any valid expression. This may usually be abbreviated to simply "set".Print value of expression EXP. Usage: print [[OPTION]... --] [/FMT] [EXP] Options: %OPTIONS% Note: because this command accepts arbitrary expressions, if you specify any command option, you must use a double dash ("--") to mark the end of option processing. E.g.: "print -o -- myobj". Variables accessible are those of the lexical environment of the selected stack frame, plus all those whose scope is global or an entire file. $NUM gets previous value number NUM. $ and $$ are the last two values. $$NUM refers to NUM'th value back from the last one. Names starting with $ refer to registers (with the values they would have if the program were to return to the stack frame now selected, restoring all registers saved by frames farther in) or else to debugger "convenience" variables (any such name not a known register). Use assignment expressions to give values to convenience variables. {TYPE}ADREXP refers to a datum of data type TYPE, located at address ADREXP. @ is a binary operator for treating consecutive data objects anywhere in memory as an array. FOO@NUM gives an array whose first element is FOO, whose second element is stored in the space following where FOO is stored, etc. FOO must be an expression whose value resides in memory. EXP may be preceded with /FMT, where FMT is a format letter but no count or size letter (see "x" command).inspectmax-symbolic-offsetTell GDB to only display the symbolic form of an address if the offset between the closest earlier symbol and the address is less than the specified maximum offset. The default is "unlimited", which tells GDB to always print the symbolic form of an address if any symbol precedes it. Zero is equivalent to "unlimited".Show the largest offset that will be printed in form.Set the largest offset that will be printed in form.symbol-filenameShow printing of source filename and line number with .Set printing of source filename and line number with .Construct a GDB command and then evaluate it. Usage: eval "format string", ARG1, ARG2, ARG3, ..., ARGN Convert the arguments to a string as "printf" would, but then treat this string as a command line, and evaluate it.Generic command for printing and manipulating memory tag properties.memory-tagPrint the logical tag from POINTER. Usage: memory-tag print-logical-tag . is an expression that evaluates to a pointer. Print the logical tag contained in POINTER. The tag interpretation is architecture-specific.print-logical-tagPrint the allocation tag for ADDRESS. Usage: memory-tag print-allocation-tag
.
is an expression that evaluates to a memory address. Print the allocation tag associated with the memory address ADDRESS. The tag interpretation is architecture-specific.print-allocation-tagPrint a POINTER with a specific logical TAG. Usage: memory-tag with-logical-tag is an expression that evaluates to a pointer. is a sequence of hex bytes that is interpreted by the architecture as a single memory tag.with-logical-tagSet the allocation tag(s) for a memory range. Usage: memory-tag set-allocation-tag
is an expression that evaluates to a memory address is the number of bytes that is added to
to calculate the memory range. is a sequence of hex bytes that is interpreted by the architecture as one or more memory tags. Sets the tags of the memory range [ADDRESS, ADDRESS + LENGTH) to TAG_BYTES. If the number of tags is greater than or equal to the number of tag granules in the [ADDRESS, ADDRESS + LENGTH) range, only the tags up to the number of tag granules are updated. If the number of tags is less than the number of tag granules, then the command is a fill operation. The TAG_BYTES are interpreted as a pattern that gets repeated until the number of tag granules in the memory range [ADDRESS, ADDRESS + LENGTH) is updated.set-allocation-tagValidate a pointer's logical tag against the allocation tag. Usage: memory-tag check is an expression that evaluates to a pointer Fetch the logical and allocation tags for POINTER and compare them for equality. If the tags do not match, print additional information about the tag mismatch.void compile_probe_arg(internalvar*, agent_expr*, axs_value*, void*)../../gdb/probe.csel >= -1No probe at PC %sInvalid probe argument %d -- probe has %d arguments availablevalue* compute_probe_arg(gdbarch*, internalvar*, void*)Invalid probe argument %d -- probe has %u arguments availableShow available static probes. Usage: info probes [all|TYPE [ARGS]] TYPE specifies the type of the probe, and can be one of the following: - stap If you specify TYPE, there may be additional arguments needed by the subcommand. If you do not specify any argument, or specify `all', then the command will show information about all types of probes.probesvoid gen_ui_out_table_header_info(const std::vector&, const static_probe_ops*)spops != NULLprobe_fields.size () == headings.size ()void print_ui_out_info(probe*)headings.size () == values.size ()Invalid provider regexpInvalid probe regexpInvalid object file regexpNo probes matched. Probe %s:%s disabled. Probe %s:%s cannot be disabled. Probe %s:%s enabled. Probe %s:%s cannot be enabled. std::vector parse_probes(const event_location*, program_space*, linespec_result*)event_location_type (location) == PROBE_LOCATION'%s' is not a probe linespecargument to `%s' missingno probe name specifiedinvalid provider nameinvalid objfile nameNo probe matching objfile=`%s', provider=`%s', name=`%s'_probe_argc_probe_arg0_probe_arg1_probe_arg2_probe_arg3_probe_arg4_probe_arg5_probe_arg6_probe_arg7_probe_arg8_probe_arg9_probe_arg10_probe_arg11Show information about all type of probes.Enable probes. Usage: enable probes [PROVIDER [NAME [OBJECT]]] Each argument is a regular expression, used to select probes. PROVIDER matches probe provider names. NAME matches the probe names. OBJECT matches the executable or shared library name. If you do not specify any argument then the command will enable all defined probes.Disable probes. Usage: disable probes [PROVIDER [NAME [OBJECT]]] Each argument is a regular expression, used to select probes. PROVIDER matches probe provider names. NAME matches the probe names. OBJECT matches the executable or shared library name. If you do not specify any argument then the command will disable all defined probes.StaticProbesproviderProviderWhereObjectn/a-p!cPJlcP5 |4 20any_static_probe_ops^@cP(KXcP8 0 0 S 0 Can't determine the current address space of thread %s ../../gdb/process-stratum-target.cvirtual gdbarch* process_stratum_target::thread_architecture(ptid_t)22process_stratum_target^ dPTR($''@?( @((A(0B(8C(@D(TE(\F(la (H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(p` p` p` p` ` U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b(c(Xf(8g(g(h(\i(0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wproducer_is_iccIntel(R)[0-9]+\.[0-9]+clang F90 Flang void switch_to_program_space_and_thread(program_space*)../../gdb/progspace-and-thread.cvoid program_space::free_all_objfiles()../../gdb/progspace.cso->objfile == NULLvoid set_current_program_space(program_space*)void program_space::remove_objfile(objfile*)iter != objfiles_list.end ()void print_program_space(ui_out*, int)pspaces Bound inferiors: ID %d (%s), ID %d (%s)program space ID %d not known.program_space::~program_space()this != current_program_spacevoid remove_program_space(program_space*)iter != program_spaces.end ()Info about currently known program spaces.program-spacesvoid program_space::add_objfile(std::shared_ptr&&, objfile*)int pv_is_identical(pv_t, pv_t)../../gdb/prologue-value.cunexpected prologue value kindEntire a A%sddress map: Psymtabs: %s partial symbols: `%s'undefined domain, struct domain, module domain, label domain, common block domain, , constant intpass by valuepass by referenceregister address parameterstack parameterconstant bytescomputed at runtime %s%s %s Reading in symbols for %s... partial_symbol* find_pc_sect_psymbol(objfile*, partial_symtab*, CORE_ADDR, obj_section*)../../gdb/psymtab.cpsymtab != NULL Anonymous partial symtab (%s) Partial symtab for source file %s (object Read from object file %s ( Full symtab was read (at Symbols cover text addresses Address map supported - %s. Depends on %d other partial symtabs. %d Shared partial symtab with user Global<>select_source_symtab: readin pst found and no symtabs.Psymtab covers bad range - Static symbol `' only found in psymtab Global symbol ` covers but symtab covers only { objfile %s { psymtab %s readin %s fullname %s text addresses psymtabs_addrmap_supported %s globals (* (struct partial_symbol **) %s @ %d) (none) statics user %s ((struct partial_symtab *) %s) dependencies psymtab %s ((struct partial_symtab *) %s) } partial_symtab* find_pc_sect_psymtab_closer(objfile*, CORE_ADDR, obj_section*, partial_symtab*, bound_minimal_symbol)!pst->psymtabs_addrmap_supported(Internal error: pc %s in read in psymtab, but not in symtab.) Number of "partial" symbols read: %d Number of psym tables (not yet expanded): %d Total memory used for psymbol cache: %d Psymbol byte cache statistics: partial symbol cachePrint dump of current partial symbol definitions. Usage: mt print psymbols [-objfile OBJFILE] [-pc ADDRESS] [--] [OUTFILE] mt print psymbols [-objfile OBJFILE] [-source SOURCE] [--] [OUTFILE] Entries in the partial symbol table are dumped to file OUTFILE, or the terminal if OUTFILE is unspecified. If ADDRESS is provided, dump only the file for that address. If SOURCE is provided, dump only that file's symbols. If OBJFILE is provided, dump only that file's minimal symbols.psymbolsList the partial symbol tables for all object files. This does not include information about individual partial symbols, just the symbol table structures themselves.Check consistency of currently expanded psymtabs versus symtabs.check-psymtabsconst char* psymtab_to_fullname(partial_symtab*)!ps->anonymousCreating one or more psymtabs for %s ... Created psymtab %s for module %s. partial_symbol* lookup_partial_symbol(objfile*, partial_symtab*, const lookup_name_info&, int, domain_enum)center < toptop == bottompartial_symbol* match_partial_symbol(objfile*, partial_symtab*, int, const lookup_name_info&, domain_enum, int (*)(const char*, const char*))-pcMissing pc valueMissing source fileMissing objfile nameUnknown option: %sMust specify at most one of -pc and -sourceJunk at end of command Partial symtabs for objfile %s No partial symtab for address: %sNo partial symtab for source file: %s,wP l ^8wP$LvPp88 H  0 < h l L x  @'&&14psymbol_bcache^wPyH17psymbol_functionsPython's ignore-environment setting is %s. PYTHONDONTWRITEBYTECODEPython's dont-write-bytecode setting is %s (currently %s). Python's dont-write-bytecode setting is %s. Start a Python interactive prompt. Python scripting is not supported in this copy of GDB. This command is only a placeholder.python-interactiveEvaluate a Python command. Python scripting is not supported in this copy of GDB. This command is only a placeholder.Prefix command for python preference settings.Show the mode of Python stack printing on error.Set mode for Python stack dump on error.ignore-environment When enabled GDB's Python interpreter will ignore any Python related flags in the environment. This is equivalent to passing `-E' to a python executable. Show whether the Python interpreter showlist ignore environment variables.Set whether the Python interpreter should ignore environment variables.dont-write-bytecodePython scripting is not supported in this copy of GDB.Python-gdb.pyi{Pd{P\{PmJ{P&{P"{PmessagefullnonekBTrailing junk: '%s'.btrace cpu is 'auto'. btrace cpu is 'none'. btrace cpu is 'intel: %u/%u'. btrace cpu is 'intel: %u/%u/%u'. Internal error: bad cpu state.decode error (errcode): btrace_insn_iterator* record_btrace_start_replaying(thread_info*)../../gdb/record-btrace.cbtinfo->replay == NULLThe record/replay pt buffer size is %s. The record/replay bts buffer size is %s. intel: %u/%u%n/%u%nBad format. See "help set record btrace cpu".Cpu family too big.Cpu model too big.Cpu stepping too big.Replay memory access is %s. target record-btraceunwind_stop_reason record_btrace_frame_unwind_stop_reason(frame_info*, void**)bfun != NULLvoid record_btrace_frame_dealloc_cache(frame_info*, void*)btrace_frame_cache* bfcache_new(frame_info*)void record_btrace_frame_this_id(frame_info*, void**, frame_id*)[record-btrace] [frame] %s id: (!stack, pc=%s, special=%s) [record-btrace] [frame] sniffed frame for %s on level %d [record-btrace] [frame] sniffed tailcall frame for %s on level %d Registers are not available in btrace record historyvalue* record_btrace_frame_prev_register(frame_info*, void**, int)No caller in btrace record history[record-btrace] [frame] unwound PC in %s on level %d: %s [record-btrace] ftrace (0x%x): [%u; %u) void btrace_call_history(ui_out*, const btrace_thread_info*, const btrace_call_iterator*, const btrace_call_iterator*, int)conf != NULL inst void btrace_call_history_insn_range(ui_out*, const btrace_function*)size > 0insn begininsn end at min linemax linevirtual void record_btrace_target::fetch_registers(regcache*, int)Internal error: bad record btrace cpu state.[record-btrace] require Instruction number out of range.No such instruction.[record-btrace] info Recording format: %s. Buffer size: %u%s. Recorded %u instructions in %u functions (%u gaps) for thread %s (%s). Replay in progress. At instruction %u. [record-btrace] resuming thread %s (%s): %x (%s) Start branch trace recording.Start branch trace recording in Branch Trace Store (BTS) format. The processor stores a from/to record for each branch into a cyclic buffer. This format may not be available on all processors.Start branch trace recording in Intel Processor Trace format. This format may not be available on all processors.Set record options.Show record options.replay-memory-accessDefault is READ-ONLY. The btrace record target does not trace data. The memory therefore corresponds to the live target and not to the current replay position. When READ-ONLY, allow accesses to read-only memory during replay. When READ-WRITE, allow accesses to read-only and read-write memory during replay.Show what memory accesses are allowed during replay.Set what memory accesses are allowed during replay.Set the cpu to be used for trace decode. The format is "VENDOR:IDENTIFIER" or "none" or "auto" (default). For vendor "intel" the format is "FAMILY/MODEL[/STEPPING]". When decoding branch trace, enable errata workarounds for the specified cpu. The default is "auto", which uses the cpu on which the trace was recorded. When GDB does not support that cpu, this option can be used to enable workarounds for a similar cpu that GDB supports. When set to "none", errata workarounds are disabled.Automatically determine the cpu to be used for trace decode.Do not enable errata workarounds for trace decode.Show the cpu to be used for trace decode.Set record btrace bts options.Show record btrace bts options.When starting recording request a trace buffer of this size. The actual buffer size may differ from the requested size. Use "info record" to see the actual buffer size. Bigger buffers allow longer recording but also take more time to process the recorded execution trace. The trace buffer size may not be changed while recording.Show the record/replay bts buffer size.Set the record/replay bts buffer size.Set record btrace pt options.Show record btrace pt options.Bigger buffers allow longer recording but also take more time to process the recorded execution. The actual buffer size may differ from the requested size. Use "info record" to see the actual buffer size.Show the record/replay pt buffer size.Set the record/replay pt buffer size.insn historyBad record function-call-history-size.[record-btrace] call-history (0x%x): %d At the start of the branch trace record. [record-btrace] call-history (0x%x): %d, prev: [%u; %u) At the end of the branch trace record. func history[record-btrace] call-history (0x%x): [%u; %u) Bad range.Range out of bounds.Cannot write registers while replaying.virtual void record_btrace_target::store_registers(regcache*, int)may_write_registersreverse-[record-btrace] resume %s: %s%s virtual void record_btrace_target::resume(ptid_t, int, gdb_signal)inferior_ptid.matches (ptid)[record-btrace] stop %s [record-btrace] itrace (0x%x): [%u; %u) void btrace_insn_history(ui_out*, const btrace_thread_info*, const btrace_insn_iterator*, const btrace_insn_iterator*, gdb_disassembly_flags)!asm_list.has_value ()src_and_asm_tuple.has_value ()Bad record instruction-history-size.[record-btrace] insn-history (0x%x): %d [record-btrace] insn-history (0x%x): %d, prev: [%u; %u) [record-btrace] insn-history (0x%x): [%u; %u) [record-btrace] wait %s (0x%x) [record-btrace] wait ended by %s: %s T ordered_remove(std::vector&, typename std::vector::size_type) [with T = thread_info*; typename std::vector::size_type = unsigned int][record-btrace] stepping thread %s (%s): %x (%s) invalid stepping type.virtual ptid_t record_btrace_target::wait(ptid_t, target_waitstatus*, target_wait_flags)!no_history.empty ()[record-btrace] cancel resume thread %s (%s): %x (%s) [record-btrace] movers pending [record-btrace] no-history pending [record-btrace] wait ended by thread %s (%s): %s [record-btrace] detach thread observer Detaching observable %s from observer %s[record-btrace] stop recording [record-btrace] attach thread observer [record-btrace] open reverse-contrecord-btrace tailcallBranch tracing targetCollect control-flow trace and provide the execution history.T unordered_remove(std::vector&, typename std::vector::size_type) [with T = thread_info*; typename std::vector::size_type = unsigned int]T unordered_remove(std::vector&, typename std::vector::iterator) [with T = thread_info*; typename std::vector::iterator = std::vector::iterator]}PP'P}P P  P P  read-writeN0OTPPTPTPTPPTPTPTPTPTPTPTPĈNLPPread-only20record_btrace_target^WPTRpP!!!!!$''\(! (! (< X 0 "(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(8(x9(:(:(L;(;(<(!0>($''@?( @((A(0B(8C(@D(TE(\F(dG((!$'(( h @K(K(L(M(TO( P(8Q(Q(R(S(T(y yyy$yU(`V(@W( X(X Y(Z([(P\(0](^(T_(_( a(b( Xf(8g(g(h(\i(0j(l(m($ , q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0((( ! ܡ((( p l P (!!!( (  < P H(((`(Process record: get a signal Process record: record_full_arch_list_add %s. record_full_get_bookmark returns %s record_full_get_bookmark returns NULL record_full_goto_bookmark receives %s Unbalanced quotes: %sReplay mode: Record mode: Current instruction number is %s. Highest recorded instruction number is %s. Log contains %u instructions. No instructions have been logged. Max logged instructions is %u. Lowest recorded instruction number is %s. Process record: record_full_core_kill You can't do that without a process to debug.target record-fullgdb_byte* record_full_get_loc(record_full_entry*)../../gdb/record-full.cunexpected record_full_entry typevoid record_full_mem_release(record_full_entry*)rec->type == record_full_memProcess record: record_full_close void record_full_list_release_first()record_full_insn_num == 1Do you want to auto delete previous execution log entries when record/replay buffer becomes full (record full stop-at-limit)?Process record: stopped by user.void record_full_message(regcache*, gdb_signal)record_full_list->type == record_full_endProcess record: inferior program stopped.Process record: failed to record execution log.Failed to read %d bytes from core file %s ('%s').Failed to write %d bytes to core file %s ('%s').T unordered_remove(std::vector&, typename std::vector::iterator) [with T = record_full_breakpoint; typename std::vector::iterator = std::vector::iterator]virtual int record_full_target::remove_breakpoint(gdbarch*, bp_target_info*, remove_bp_reason)removing unknown breakpointProcess record: add register num = %d to record list. Process record: add mem addr = %s len = %d to record list. Process record: add end to arch list. Because GDB is in replay mode, changing the value of a register will make the execution log unusable from this point onward. Change all registers?Because GDB is in replay mode, changing the value of a register will make the execution log unusable from this point onward. Change register %s?Process record canceled the operation.Because GDB is in replay mode, writing to memory will make the execution log unusable from this point onward. Write memory at address %s?Start full execution recording.Restore the execution log from a file. Argument is filename. File must be created with 'record save'.record full restoreDefault is ON. When ON, if the record/replay buffer becomes full, ask user what to do. When OFF, if the record/replay buffer becomes full, delete the oldest recorded instruction to make room for each new one.Show whether record/replay stops when record/replay buffer becomes full.Set whether record/replay stops when record/replay buffer becomes full.set record full stop-at-limitshow record full stop-at-limitSet the maximum number of instructions to be stored in the record/replay buffer. A value of either "unlimited" or zero means no limit. Default is 200000.Show record/replay buffer limit.Set record/replay buffer limit.set record full insn-number-maxshow record full insn-number-maxDefault is OFF. When ON, query if PREC cannot record memory change of next instruction.Show whether query if PREC cannot record memory change of next instruction.Set whether query if PREC cannot record memory change of next instruction.set record full memory-queryshow record full memory-queryProcess record: record_full_reg %s to inferior num = %d. Process record: record_full_mem %s to inferior addr = %s len = %d. Process record: error writing memory at addr = %s len = %d.Target insn not found.Already at target insn.Go forward to insn number %s Go backward to insn number %s Saving execution log to core file '%s' precordFailed to create 'precord' section for corefile %s: %s Writing 4-byte magic cookie RECORD_FULL_FILE_MAGIC (0x%s) Writing register %d (1 plus %lu plus %d bytes) Writing memory %s (1 plus %lu plus %lu plus %d bytes) Writing record_full_end (1 + %lu + %lu bytes) Saved core file %s with execution log. Process record: record_full_wait record_full_resume_step = %d, record_full_resumed = %d, direction=%s ptid_t record_full_wait_1(target_ops*, ptid_t, target_waitstatus*, target_wait_flags)(options & TARGET_WNOHANG) != 0Process record: record_full_wait target beneath not done yet Process record: record_full_wait issuing one more step in the target beneath Process record: break at %s. Process record: record_full_end %s to inferior. Process record: step. Process record: hit hw watchpoint. virtual int record_full_target::insert_breakpoint(gdbarch*, bp_target_info*)bp.in_target_beneath == in_target_beneathProcess record: record_full_open void record_full_restore()record_full_first.next == NULLRestoring recording from core file. null0Find precord section %s. Version mis-match or file format error in core file %s. Reading 4-byte magic cookie RECORD_FULL_FILE_MAGIC (0x%s) Reading register %d (1 plus %lu plus %d bytes) Reading memory %s (1 plus %lu plus %lu plus %d bytes) Reading record_full_end (1 + %lu + %lu bytes), offset == %s Bad entry type in core file %s.Auto increase record/replay buffer limit to %u.Restored records from core file %s. Process record: record_full_open_1 Process record: the program is not being run.Process record target can't debug inferior in non-stop mode (non-stop).Process record: the current architecture doesn't support record function.record-corePP\PPP\P23record_full_base_target^PTR18record_full_target^PP23record_full_core_target^4PPP`T!p&!$''\(((4(D((@!((((\((!!$!!"(@$(%(\&('(|)(X+(-('!/(4(!t1( 3(4(`6(7(8(x9(:(:(L;(;(<(=(0>($''@?( @((A(0B(8C(@D(TE(\F(dG((H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(y yyy$yU(`V(@W( X(!Y(Z([(P\(0](^(T_(d!!b(c(Xf(8g(g(h(\i(0j(l(m(!@!q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((P!(!;!!&!#!($!h!0;!T;!;!h(((( (P((h(<(((H(((`((P`T!T!T!hT!p&!$''\(!!8*!(@!(0!((H!,!!!$!!"(@$(%(\&('(|)(X+(-('!/(4(!t1( 3(4(`6(7(8(x9(:(:(L;(;(<(!0>($''@?( @((A(0B(8C(@D(TE(\F(dG((!$'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(y yyy$yU(`V(@W( X(!Y(Z([(P\(0](^(T_(d!!b(\2!Xf(8g(g(h(\i(0j(l(m(!@!q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((P!(!;!!&!#!($!h!0;!T;!;!h(((( (P((h(<(((H(((`(PP`T!T!T!tT!p&!$''\(((! !(@!0.!.!t!(x!!!!$!!"(@$(%(\&('(|)(X+(-('!/(4(!t1( 3(4(`6(7(8(x9(:(:(L;(;(<( !0>($''@?( @((A(0B(8C(@D(TE(\F(dG((H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(y yyy!U(`V(@W( X(!Y(Z([(P\(0](^(T_(d!!b(@!!Xf(8g(g(h(\i(0j(l(m(!@!q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((P!(!;!!&!#!($!h!0;!T;!;!h(((( (P((h(<(((H(((`(Log program while executing and replay execution from log.Process record and replay targetinteger %u out of rangeDebugging of process record target is %s. int command_size_to_target_size(unsigned int)../../gdb/record.csize <= INT_MAX || size == UINT_MAXrecord: stop %s record: unpush %s No recording is currently active. Use the "record full" or "record btrace" command first.Already at end of record list. The current record target does not support this operation. Delete the log from this point forward and begin to record the running message at current PC?gdb_record.%dInvalid modifier: %c.No recording is currently active. Active record target: %s The process is already being recorded. Use "record stop" to stop recording first.Invalid format.record fullrecord btracerecord btrace btsrecord btrace ptInvalid method.record stoprecord: error reading memory at addr %s len = %ld. void record_disconnect(target_ops*, const char*, int)t->stratum () == record_stratumrecord: disconnect %s void record_detach(target_ops*, inferior*, int)record: detach %s void record_mourn_inferior(target_ops*)record: mourn inferior %s void record_kill(target_ops*)record: kill %s Command requires an argument (insn number to go to).When enabled, debugging output for record/replay feature is displayed.Show debugging of record/replay feature.Set debugging of record/replay feature.instruction-history-sizeA size of "unlimited" means unlimited instructions. The default is 10.Show number of instructions to print in "record instruction-history".Set number of instructions to print in "record instruction-history".function-call-history-sizeA size of "unlimited" means unlimited lines. The default is 10.Show number of functions to print in "record function-call-history".Set number of function to print in "record function-call-history".Start recording.Info record options.Save the execution log to a file. Usage: record save [FILENAME] Default filename is 'gdb_record.PROCESS_ID'.Delete the rest of execution log and start recording it anew.Stop the record/replay target.Restore the program to its state at instruction number N. Argument is instruction number, as shown by 'info record'.Go to the beginning of the execution log.Go to the end of the execution log.Print disassembled instructions stored in the execution log. With a /m or /s modifier, source lines are included (if available). With a /r modifier, raw instructions in hex are included. With a /f modifier, function names are omitted. With a /p modifier, current position markers are omitted. With no argument, disassembles ten more instructions after the previous disassembly. "record instruction-history -" disassembles ten instructions before a previous disassembly. One argument specifies an instruction number as shown by 'info record', and ten instructions are disassembled after that instruction. Two arguments with comma between them specify starting and ending instruction numbers to disassemble. If the second argument is preceded by '+' or '-', it specifies the distance from the first argument. The number of instructions to disassemble can be defined with "set record instruction-history-size".instruction-historyPrints the execution history at function granularity. It prints one line for each sequence of instructions that belong to the same function. Without modifiers, it prints the function name. With a /l modifier, the source file and line number range is included. With a /i modifier, the instruction number range is included. With a /c modifier, the output is indented based on the call stack depth. With no argument, prints ten more lines after the previous ten-line print. "record function-call-history -" prints ten lines before a previous ten-line print. One argument specifies a function number as shown by 'info record', and ten lines are printed after that function. Two arguments with comma between them specify a range of functions to print. If the second argument is preceded by '+' or '-', it specifies the distance from the first argument. The number of functions to print can be defined with "set record function-call-history-size".function-call-historyProcess record is stopped and all execution logs are deleted. GroupsRmt Nr g/G Offset%7d %11dCooked valueRaw valuevirtual void register_dump_reg_buffer::dump_reg(ui_file*, int)../../gdb/regcache-dump.cstatus != REG_VALIDPrint the internal register configuration. Takes an optional file parameter.Print the internal register configuration including raw values. Takes an optional file parameter.raw-registersPrint the internal register configuration including cooked values. Takes an optional file parameter.cooked-registersPrint the internal register configuration including each register's group. Takes an optional file parameter.register-groupsPrint the internal register configuration including remote register number and g/G packets offset. Takes an optional file parameter.remote-registers13register_dump^P22register_dump_regcache^PP24register_dump_reg_bufferH^8PPP18register_dump_none^tPP20register_dump_remote^PP20register_dump_groups^PPP,Pl!l!o!TP,o!\o!Pn!TPTo!|o!dy!y!Px!x!Pl!l!|l!Pl!l!m!Pl!l!l!void* init_regcache_descr(gdbarch*)../../gdb/regcache.ctype* register_type(gdbarch*, int)regnum >= 0 && regnum < descr->nr_cooked_registersint register_size(gdbarch*, int)regnum >= 0 && regnum < gdbarch_num_cooked_regs (gdbarch)void reg_buffer::save(register_read_ftype)status != REG_UNKNOWNvoid reg_buffer::assert_regnum(int) constregnum < gdbarch_num_regs (arch ())virtual void reg_buffer::raw_collect(int, void*) constvirtual bool reg_buffer::raw_compare(int, const void*, int) constsize >= offsetregister_status readable_regcache::raw_read(int, gdb_byte*)void regcache::raw_write(int, const gdb_byte*)void reg_buffer::raw_collect_part(int, int, int, gdb_byte*) constoffset >= 0 && offset <= reg_sizelen >= 0 && offset + len <= reg_sizevoid reg_buffer::raw_supply_part(int, int, int, const gdb_byte*)in != nullptrvoid regcache::cooked_write(int, const gdb_byte*)void regcache::restore(readonly_detached_regcache*)src != NULLsrc->m_has_pseudogdbarch == src->arch ()register_status readable_regcache::cooked_read(int, gdb_byte*)register_status readable_regcache::read_part(int, int, int, gdb_byte*, bool)register_status readable_regcache::cooked_read_part(int, int, int, gdb_byte*)regnum >= 0 && regnum < m_descr->nr_cooked_registersregister_status regcache::write_part(int, int, int, const gdb_byte*, bool)void regcache::cooked_write_part(int, int, int, const gdb_byte*)value* readable_regcache::cooked_read_value(int)void register_dump::dump(ui_file*)descr->nr_cooked_registers == gdbarch_num_cooked_regs (m_gdbarch) %-10sNr %4sRel %6s %5s %4d*%d %5ld %-15s*%d: Inconsistent register offsets. *%d: Register type's name NULL. %6ldreg_buffer::reg_buffer(gdbarch*, bool)register_status regcache_raw_read_signed(regcache*, int, LONGEST*)register_status regcache_raw_read_unsigned(regcache*, int, ULONGEST*)void regcache_raw_write_signed(regcache*, int, LONGEST)void regcache_raw_write_unsigned(regcache*, int, ULONGEST)register_status regcache_cooked_read_signed(regcache*, int, LONGEST*)register_status regcache_cooked_read_unsigned(regcache*, int, ULONGEST*)PC register is not availableregcache_read_pc: Unable to find PCvoid regcache_cooked_write_signed(regcache*, int, LONGEST)void regcache_cooked_write_unsigned(regcache*, int, ULONGEST)regcache_write_pc: Unable to update PCvoid registers_changed_ptid(process_stratum_target*, ptid_t)ptid == minus_one_ptidRegister cache flushed. regcache* get_thread_arch_aspace_regcache(process_stratum_target*, ptid_t, gdbarch*, address_space*)regcache* get_thread_regcache(process_stratum_target*, ptid_t)ptid != null_ptidregcacheForce gdb to flush its register and frame cache.flushregsmaintenance flush register-cacheregister_status readable_regcache::cooked_read(int, T*) [with T = long long int; = void]register_status readable_regcache::cooked_read(int, T*) [with T = long long unsigned int; = void]void regcache::cooked_write(int, T) [with T = long long int; = void]regnum >=0 && regnum < m_descr->nr_cooked_registersvoid regcache::cooked_write(int, T) [with T = long long unsigned int; = void]17reg_buffer_common^ Pbuiltin_typePe@fdy!y!Px!x!P!!dy!y!Px!x!y!10reg_buffer^|P P8regcache^PNvoid add_group(reggroups*, reggroup*, reggroup_el*)../../gdb/reggroups.creggroup* reggroup_next(gdbarch*, reggroup*)groups != NULLGroupreggroup* reggroup_prev(gdbarch*, reggroup*)el->group != NULLPrint the internal register group names. Takes an optional file parameter.maintenance print reggroupsgeneral<^4^^$^D^^,^void registry_alloc_data(registry_data_registry*, registry_fields*)../../gdb/registry.cfields->data == NULLvoid registry_clear_data(registry_data_registry*, registry_callback_adaptor, registry_container*, registry_fields*)fields->data != NULLvoid registry_container_free_data(registry_data_registry*, registry_callback_adaptor, registry_container*, registry_fields*)*rdata != NULLvoid registry_set_data(registry_fields*, const registry_data*, void*)data->index < fields->num_datavoid* registry_data(registry_fields*, const registry_data*)Garbage after "show remote system-call-allowed" command: `%s'Calling host system(3) call from target is %sallowed Illegal argument for "set remote system-call-allowed" command,%x,CSet if the host system(3) call is allowed for the target.system-call-allowedShow if the host system(3) call is allowed for the target.lseekisatty=QP!0Q!]W!EV\!nPT! K!0Q!\Xremote)remote-notifnotificationWhen non-zero, debugging output about async remote notifications is enabled.Show debugging of async remote notification.Set debugging of async remote notification.notif: ack '%s' notif: parse '%s' notif: ignoring resent notification notif: Notification '%s' captured 0123456789abcdefPacket too long for target.packet_ok: attempt to use a disabled packet../../gdb/remote.cPacket %s (%s) is supportedProtocol error: %s (%s) conflicting enabled responses.Enabled packet %s (%s) not recognized by stubPacket %s (%s) is NOT supportedDebugging a target over a serial line. Timeout limit to wait for target to respond is %s. Debugging of remote protocol is %s. Number of remote packet characters to display is %s. Watchdog timer is %s. Debugger's willingness to use range stepping is %s. The maximum number of target hardware breakpoints is %s. The maximum length (in bytes) of a target hardware watchpoint is %s. The maximum number of target hardware watchpoints is %s. Send the ASCII ETX character (Ctrl-c) to the remote target to interrupt the execution of the program. send a break signal to the remote target to interrupt the execution of the program. Send a break signal and 'g' a.k.a. Magic SysRq g to the remote target to interrupt the execution of Linux kernel. Invalid value for interrupt_sequence_mode: %s.Argument required (integer, `fixed' or `limited').softInvalid %s (bad syntax).The target may not be able to correctly handle a %s of %ld bytes. Change the packet size? Packet size not changed.Set use of remote protocol `%s' (%s) packet.Show current use of remote protocol `%s' (%s) packet.%s-packetlong int get_fixed_memory_packet_size(memory_packet_config*)config->fixed_ppacket_support packet_config_support(packet_config*)Target does not support branch tracing.Cannot process branch tracing result. XML parsing not supported.Support for the `%s' packet is auto-detected, currently %s. Support for the `%s' packet is currently %s. packet_reg* packet_reg_from_regnum(gdbarch*, remote_arch_state*, long int)r->regnum == regnum;cmds:%x,Could not find config for %sRemote qSupported response supplied an unexpected value for "%s".remote_thread_info* get_remote_thread_info(thread_info*)void set_remote_exec_file(const char*, int, cmd_list_element*)remote_exec_file_var != NULLUnknown remote I/O error %dRemote I/O error: %sinvalid remote ptid: %sArgument given to "disconnect" when remotely debugging.Ending remote debugging. Remote communication error. Target disconnected.Z-packetselect_thread_for_ambiguous_stop_replyprocess_wide_stop = %dptid_t remote_target::select_thread_for_ambiguous_stop_reply(const target_waitstatus*)first_resumed_thread != nullptrfirst resumed thread is %sis this guess ambiguous? = %dmulti-inferior target stopped without sending a process-id, using first non-exited inferiormulti-threaded target stopped without sending a thread-id, using first non-exited threadThread handle size mismatch: %d vs %zu (from remote)int remote_register_number_and_offset(gdbarch*, int, int*, int*)not currently attached to process %dvoid register_remote_g_packet_guess(gdbarch*, int, const target_desc*)tdesc != NULLDuplicate g packet description added for size %dcommand cannot be used without an exec filetarget memory fault, section %s, range %s -- %sSection %s, range %s -- %s: MIS-MATCHED! One or more sections of the target image does not match the loaded file No loaded section named '%s'. p-%x.p%x.-%xIncomplete response to threadinfo request.ERROR RMT: threadinfo tag mismatch.ERROR RMT: length of threadid is not 16.ERROR RMT: 'exists' length too long.ERROR RMT: unknown thread info tag.Remote target reported "%s" without a size.Remote target reported "%s" with a bad size: "%s".;S%02xchar* remote_target::append_resumption(char*, char*, ptid_t, int, gdb_signal);r%s,%s;s;C%02x;cThe target is not responding to interrupt requests. Stop debugging it? Disconnected from target.Interrupted while waiting for the program. Give up waiting? The target is not responding to GDB commands. Stop debugging it? pass_ctrlcevent ignoredprocess_initial_stop_repliesdiscarded in-flight notification notif: discard queued event: 'Stop' in %s notif: push 'Stop' %s to queue %d could not set remote traceframeRemote connection closedRemote targetThread
Thread %d.%ldThread %ldTimeout in mid-packet, retryingread_frameSaw new packet start in middle of old oneTimeout in checksum, retryingCommunication error in checksumBad checksum, sentsum=0x%x, csum=0x%x, buf=%sInvalid run length encoding: %s Cannot execute this command while the target is running. Use the "interrupt" command to stop the target and then try again.Sending packet: %s [%d bytes omitted]Sending packet: %sReceived AckReceived NakPacket instead of Ack, ignoring itputpkt_binary Notification received: %sJunk: %c%sWatchdog timeout has expired. Target detached.Timed out.getpkt_or_notif_sane_1Packet received: %s [%d bytes omitted]Packet received: %sint remote_target::getpkt_or_notif_sane_1(gdb::char_vector*, int, int, int*)c == '%'Ignoring packet error, continuing... remote.c: error in outgoing packet.remote.c: error in outgoing packet at field #%ld.Target returns error code '%s'.qRelocInsn:invalid qRelocInsn packet: %sqRelocInsn:%xE01warning: relocating instruction: QTinitTarget does not support this command.QTDPsrc:Target does not support source download.QTStartBogus reply from target: %sQTStopqTBuffer:virtual void remote_target::pass_signals(gdb::array_view)pass_signals.size () < 256QPassSignals:virtual void remote_target::program_signals(gdb::array_view)QProgramSignals:qCwarning: garbage in qC replyremote_current_threadqfThreadInfoqsThreadInfoRemote failure reply: %sqOffsetsText=;Data=Target reported unsupported offsets: %sTextSeg=;DataSeg=Can not handle qOffsets TextSeg response with this symbol fileMalformed response to offset query, %s;Bss=vCont?vContRange stepping is not supported by the current targetUnexpected vCont reply in non-stop mode: %snotif: process: '%s' ack pending event notif: process: '%s' no pending reply Could not fetch register "%s"; remote failure reply '%s'fetch_register_using_p: early buf terminationbinary downloading NOT supported by targetcheck_binary_downloadbinary downloading supported by targetremote-packet command requires packet text as argumentsending: received: command can only be used with remote targetQTroToo many sections for read-only sections definition packet.qTfPqTsPqTfVqTsVvirtual bool remote_target::fetch_memtags(CORE_ADDR, size_t, gdb::byte_vector&, int)remote fetch_memtags called with packet disabledqMemTags:%s,%s:%svirtual bool remote_target::store_memtags(CORE_ADDR, size_t, const byte_vector&, int)remote store_memtags called with packet disabledQMemTags:%s,%s:%s:Contents too big for packet QMemTags.multiprocess+swbreak+qRelocInsn+hwbreak+vfork-events+exec-events+vContSupported+QThreadEvents+no-resumed+memory-tagging+qSupported:empty item in "qSupported" responseunrecognized item "%s" in "qSupported" responsevoid vcont_builder::push_action(ptid_t, bool, gdb_signal)rsize <= m_endp - m_pvirtual void remote_target::commit_resumed()stop_reply->ptid != tp->ptidR%xQDisableRandomization:%xTarget does not support QDisableRandomization.Bogus QDisableRandomization reply from target: %sQTDP:%x:%s:%c:%lx:%xTracepoint packet too large for target.:F%xFast tracepoint not valid during downloadTarget does not support fast tracepoints, downloading %d as regular tracepoint:SStatic tracepoint not valid during downloadTarget does not support static tracepoints:X%x,Target does not support conditional tracepoints, ignoring tp %d condTarget does not support tracepoints.QTDP:-%x:%s:%s%cError on target while setting tracepoints.QTDP:-%x:%s:%s%s%sQTDV:%x:%s:%x:Trace state variable name too long for tsv definition packetError on target while downloading trace state variable.QTEnable:%x:%sTarget does not support enabling tracepoints while a trace run is ongoing.Error on target while enabling tracepoint.QTDisable:%x:%sTarget does not support disabling tracepoints while a trace run is ongoing.Error on target while disabling tracepoint.qTP:%x:%sQTFrame:pc:%stdp:%xrange:%s:%soutside:%s:%sUnknown trace find type %dUnable to parse trace frame numberUnable to parse tracepoint numberqTV:%xQTSave:Remote file name too long for trace save packetQTDisconnected:%xTarget does not support disconnected tracing.QTBuffer:circular:%xvirtual void remote_target::set_trace_buffer_size(LONGEST)val >= 0 || val == -1QTBuffer:size:QTNotes:user:notes:tstop:qAttached:%xqAttachedptid_t remote_target::process_stop_reply(stop_reply*, target_waitstatus*)Invalid remote reply: %sCan't send signals to this remote system. %s not sent. QCatchSyscalls:0QCatchSyscalls:1pid %d needed %d any_count %d n_sysno %dset_syscall_catchpoint;%zxTarget is recording using Intel Processor Trace but support was disabled at compile time.Target is recording using %s. - Can't pass signal %d to target in reverse: ignored.Remote reverse-step not supported.Remote reverse-continue not supported.qTMinFTPILenRMT ERROR : failed to get remote thread list.RMT ERROR: threadlist response longer than requested.Remote fetch threadlist -infinite loop-.remote_threads_extra_infoqThreadExtraInfo, Name: %s State: %s Priority: %sqTSTMat:qSymbol::qSymbol::%sqSymbol:%s:%sqSymbol:start_remoteRemote replied unexpectedly to '%s': %sQStartNoAckModeNon-stop mode requested, but remote does not support non-stopQNonStop:1Remote refused setting non-stop mode with: %sQNonStop:0Remote refused setting all-stop mode with: %sThe target is not running (try extended-remote?)warning: couldn't determine remote current thread; picking first in list.Trace is already running on the target. vMustReplyEmptyTo open a remote debug connection, you need to specify what serial device is attached to the remote system (e.g. /dev/ttyS0, /dev/ttya, COM1, etc.).Already connected to a remote target. Disconnect? Still connected.udp:The remote protocol may be unreliable over UDP. Some events may be lost, rendering further debugging impossible.Remote debugging using QAllow:WriteReg:%x;WriteMem:%x;InsertBreak:%x;InsertTrace:%x;InsertFastTrace:%x;Stop:%xRemote refused setting permissions with: %sD;%xRemote doesn't know how to detachCan't detach process.No process to detach from.int remote_target::remote_resume_with_vcont(ptid_t, int, gdb_signal)strlen (rs->buf.data ()) < get_remote_packet_size ()virtual void remote_target::resume(ptid_t, int, gdb_signal)remote_thr->get_resume_state () == resume_state::NOT_RESUMEDEnqueueing phony stop reply for thread pending vCont-resume (%d, %ld, %ld)remote_stop_nsvoid remote_target::remote_stop_ns(ptid_t)info.sig == GDB_SIGNAL_0Remote server does not support stopping threadsvCont;tvCont;t:Stopping %s failed: %svCtrlCNo support for interrupting the remote target.Interrupting target failed: %sThis target does not support attaching to a processvAttach;%xAttaching to %s failed with: %sAttaching to %s failedvirtual void extended_remote_target::attach(const char*, int)wait_status != NULLwait_status == NULLtarget_can_async_p ()Could not read registers; remote failure reply '%s'Bad register packet; fetching a new packetsend_g_packetRemote 'g' packet reply is of odd length: %sP%s=Could not write register "%s"; remote failure reply '%s'Bad result from packet_okToo long remote packet.Communication problem with target.vFlashErase:%s,%sRemote target does not support flash eraseError erasing flash with vFlashErase packetRemote target does not support vFlashDoneError finishing flash operationvKill;%xCan't kill fork child process %dCan't kill processvRun;Remote file name too long for run packetArgument list too long for run packetRunning the default executable on the remote target failed; try "set remote exec-file"?Running "%s" on the remote target failedint remote_target::extended_remote_run(const string&)Unable to %s environment variable '%s' on remote.QEnvironmentResetUnable to reset environment on remote.QEnvironmentHexEncodedQEnvironmentUnsetQSetWorkingDir:%sQSetWorkingDir:Remote replied unexpectedly while setting the inferior's working directory: %sQStartupWithShell:%dRemote replied unexpectedly while setting startup-with-shell: %sRemote target does not support "set remote exec-file"Remote target does not support "set args" or run ARGS,%dTarget doesn't support breakpoints that have target side commands.hw_bp_to_z: bad watchpoint type %dZ%x,remote_insert_watchpoint: reached end of functionz%x,remote_remove_watchpoint: reached end of functionremote_insert_hw_breakpoint: reached end of functionremote_remove_hw_breakpoint: reached end of functionqCRC:%lx,%lxqGetTLSAddr:Remote target doesn't support qGetTLSAddr packetRemote target failed to process qGetTLSAddr requestTLS not supported or disabled on this targetqGetTIBAddr:Remote target doesn't support qGetTIBAddr packetRemote target failed to process qGetTIBAddr requestqGetTIBAddr not supported or disabled on this targetQAgent:%d%s=0x%xFailed to configure the BTS buffer size: %sFailed to configure the BTS buffer size.Failed to configure the trace buffer size: %sFailed to configure the trace buffer size.Could not enable branch tracing for %s.Could not enable branch tracing for %s: %sCould not disable branch tracing for %s: %sCould not disable branch tracing for %s.QThreadEvents:%xRemote refused setting thread events: %sqXfer:%s:read:%s:%s,%sUnknown remote qXfer reply: %sRemote qXfer reply contained no data.remote rcmd is only available after target openqRcmd,"monitor" command ``%s'' is too long.Protocol error with RcmdvFile:setfs:Reading %s from remote target... File transfers from remote targets can be slow. Use "set sysroot" to access files locally instead.vFile:open:vFile:pwrite:vFile:pread:Read returned %d, but %d bytes.readahead cache hit %sremote_hostio_preadreadahead cache miss %svFile:close:just probingremote target does not support file transfer, attempting to access files from local filesystem.Error reading %s.Remote write of %d bytes returned 0!Successfully sent file "%s". file to putInvalid parameters to remote putSuccessfully fetched file "%s". file to getInvalid parameters to remote getvFile:unlink:Successfully deleted file "%s". file to deleteInvalid parameters to remote deletevFile:readlink:Readlink returned %d, but %d bytes.vFile:fstat:vFile:fstat returned %d, but %d bytes.vFile:fstat returned %d bytes, but expecting %d.Malformed packet(a) (missing colon): %s Packet: '%s' Malformed packet(a) (missing register number): %s Packet: '%s' syscall_entrysyscall_returnswbreakUnexpected swbreak stop reasonhwbreakUnexpected hwbreak stop reasonreplaylogvforkdone;thread:Remote reply is too short: %sRemote register badly formatted: %s here: %sstop reply packet badly formatted: %sprocess:unknown stop reply packet: %sRemote sent bad register number %s: %s Packet: '%s' Remote 'g' packet reply is too long (expected %ld bytes, got %d bytes): %sTruncated register %d in remote 'g' packetunexpected end of 'g' packet replyvoid remote_target::process_g_packet(regcache*)r->offset * 2 < strlen (rs->buf.data ())remote_write_bytes_aux: bad packet formatminimum packet size too small to write dataremote_write_bytes: bad internal statevFlashWrite:qXfer:%s:write:%s:%s:qSearch:memory:%s;%s;Pattern is too large to transmit to remote target.Unknown qSearch:memory reply: %starget_xfer_status remote_target::remote_read_bytes(CORE_ADDR, gdb_byte*, ULONGEST, int, ULONGEST*)len <= oldlenstatictracevirtual target_xfer_status remote_target::xfer_partial(target_object, const char*, gdb_byte*, const gdb_byte*, ULONGEST, ULONGEST, ULONGEST*)annex == NULLlibraries-svr4memory-maprs->remote_descosdatatraceframe-infouibremote query is only available after target openannex != NULLreadbuf != NULLisprint (annex[i]) && annex[i] != '$' && annex[i] != '#'annex[i] == '\0'The %s is 0 (default). The %s is %ld. Packets are fixed at %ld bytes. Packets are limited to %ld bytes. The actual limit will be further reduced dependent on the target. qTStatusBogus trace status reply from target: %sqTStatus: virtual void remote_target::fetch_registers(regcache*, int)reg != NULLCould not write registers; remote failure reply '%s'virtual void remote_target::store_registers(regcache*, int)Remote protocol specific variables. Configure various remote-protocol specific variables such as the packets being used.Compare section data on target to the exec file. Argument is a single section name (default: all loaded sections). To compare only read-only loaded sections, specify the -r option.compare-sectionsSend an arbitrary packet to a remote target. maintenance packet TEXT If GDB is talking to an inferior via the GDB serial protocol, then this command sends the string TEXT to the inferior, and displays the response packet. GDB supplies the initial `$' character, and the terminating `#' character and checksum.remotebreakIf set, a break, instead of a cntrl-c, is sent to the remote target.Show whether to send break if interrupted.Set whether to send break if interrupted.set remote interrupt-sequenceshow remote interrupt-sequenceValid value is "Ctrl-C", "BREAK" or "BREAK-g". The default is "Ctrl-C".Show interrupt sequence to remote target.Set interrupt sequence to remote target.interrupt-on-connectIf set, interrupt sequence is sent to remote target.Show whether interrupt-sequence is sent to remote target when gdb connects to.Set whether interrupt-sequence is sent to remote target when gdb connects to.Set the maximum number of bytes per memory write packet (deprecated).remotewritesizeShow the maximum number of bytes per memory write packet (deprecated).Set the maximum number of bytes per memory-write packet. Specify the number of bytes in a packet or 0 (zero) for the default packet size. The actual limit is further reduced dependent on the target. Specify ``fixed'' to disable the further restriction and ``limit'' to enable that restriction.memory-write-packet-sizeSet the maximum number of bytes per memory-read packet. Specify the number of bytes in a packet or 0 (zero) for the default packet size. The actual limit is further reduced dependent on the target. Specify ``fixed'' to disable the further restriction and ``limit'' to enable that restriction.memory-read-packet-sizeShow the maximum number of bytes per memory-write packet.Show the maximum number of bytes per memory-read packet.hardware-watchpoint-limitSpecify "unlimited" for unlimited hardware watchpoints.Show the maximum number of target hardware watchpoints.Set the maximum number of target hardware watchpoints.hardware-watchpoint-length-limitSpecify "unlimited" to allow watchpoints of unlimited size.Show the maximum length (in bytes) of a target hardware watchpoint.Set the maximum length (in bytes) of a target hardware watchpoint.hardware-breakpoint-limitSpecify "unlimited" for unlimited hardware breakpoints.Show the maximum number of target hardware breakpoints.Set the maximum number of target hardware breakpoints.remoteaddresssizeShow the maximum size of the address (in bits) in a memory packet.Set the maximum size of the address (in bits) in a memory packet.binary-downloadverbose-resumepass-signalsQPassSignalscatch-syscallsQCatchSyscallsprogram-signalsQProgramSignalsset-working-dirQSetWorkingDirQStartupWithShellenvironment-hex-encodedenvironment-resetenvironment-unsetsymbol-lookupqSymbolset-registerfetch-registersoftware-breakpointZ0hardware-breakpointZ1write-watchpointZ2read-watchpointZ3access-watchpointZ4read-aux-vectorqXfer:auxv:readpid-to-exec-fileqXfer:exec-file:readqXfer:features:readlibrary-infoqXfer:libraries:readlibrary-info-svr4qXfer:libraries-svr4:readqXfer:memory-map:readqXfer:osdata:readqXfer:threads:readread-siginfo-objectqXfer:siginfo:readwrite-siginfo-objectqXfer:siginfo:writeqXfer:traceframe-info:readunwind-info-blockqXfer:uib:readget-thread-local-storage-addressqGetTLSAddrget-thread-information-block-addressqGetTIBAddrreverse-continuesupported-packetsqSupportedsearch-memoryqSearch:memoryhostio-setfsvFile:setfshostio-openvFile:openhostio-preadvFile:preadhostio-pwritevFile:pwritehostio-closevFile:closehostio-unlinkvFile:unlinkhostio-readlinkvFile:readlinkhostio-fstatvFile:fstatvAttachvRunnoackvKillquery-attachedconditional-tracepointsConditionalTracepointsconditional-breakpointsConditionalBreakpointsbreakpoint-commandsBreakpointCommandsFastTracepointsTracepointSourceallowQAllowstatic-tracepointsStaticTracepointsinstall-in-traceInstallInTraceread-sdata-objectqXfer:statictrace:readread-fdpic-loadmapqXfer:fdpic:readQDisableRandomizationQAgenttrace-buffer-sizeQTBuffer:sizedisable-btraceQbtrace:offenable-btrace-btsQbtrace:btsenable-btrace-ptQbtrace:ptread-btraceqXfer:btraceread-btrace-confqXfer:btrace-confbtrace-conf-bts-sizeQbtrace-conf:bts:sizemultiprocess-featureswbreak-featurehwbreak-featurevfork-event-featurebtrace-conf-pt-sizeQbtrace-conf:pt:sizeverbose-resume-supportedvContSupportedexec-event-featurectrl-cthread-eventsQThreadEventsno-resumed-stop-replyN stop replymemory-tagging-featurevoid _initialize_remote()excepted == (remote_protocol_packets[i].name == NULL)When set, GDB will attempt to use the remote breakpoint and watchpoint packets.Show use of remote protocol `Z' packets.Set use of remote protocol `Z' packets.Manipulate files on the remote system. Transfer files to and from the remote target system.Copy a local file to the remote system.Copy a remote file to the local system.Delete a remote file.Show the remote pathname for "run".Set the remote pathname for "run".range-steppingIf on, and the target supports it, when stepping a source line, GDB tells the target to step the corresponding range of addresses itself instead of issuing multiple single-steps. This speeds up source level stepping. If off, GDB always issues single-steps, even if range stepping is supported by the target. The default is on.Show whether target-assisted range stepping is enabled.Enable or disable range stepping.watchdogWhen non-zero, this timeout is used instead of waiting forever for a target to finish a low-level step or continue operation. If the specified amount of time passes without a response from the target, an error occurs.Show watchdog timer.Set watchdog timer.remote-packet-max-charsSpecify "unlimited" to display all the characters.Show the maximum number of characters to display for each remote packet.Set the maximum number of characters to display for each remote packet.When enabled, each packet sent or received with the remote target is displayed.Show debugging of remote protocol.Set debugging of remote protocol.remotetimeoutThis value is used to set the time limit for gdb to wait for a response from the target.Show timeout limit to wait for target to respond.Set timeout limit to wait for target to respond.vStoppedPacketSizeaugmented-libraries-svr4-readmultiprocessQNonStopDisconnectedTracingReverseContinueReverseStepEnableDisableTracepointsqXfer:btrace:readqXfer:btrace-conf:readvfork-eventsexec-eventsmemory-taggingextended-remoteExtended remote serial target in gdb-specific protocolRemote serial target in gdb-specific protocolconst resumed_pending_vcont_info& remote_thread_info::resumed_pending_vcont_info() constm_resume_state == resume_state::RESUMED_PENDING_VCONT16private_inferior^k=Q11notif_event^=Q18remote_thread_info^=Qp(O15remote_inferior^=Q=Q=Q4#4#=Q84#X4#?YQw*"*"4#X!$''\(4"\"Դ"8i"Č"0# #d#!L""h!p!!!T!@$(X""""X+(-(!/(!!!4(`6($T"8(x9($!:(L;($!<("l!$''@?("L!"L!<""L!!"\1"$'D",F"p""1"",! """ "x"""<"x4#T(p` p` p` p` ` 4#`V(3"3"4"4"!""!0](^(T_(_( a("\##H""T""!l( #!3"3"!!$!!v(v(D!a ` """""""H"'A"n"3"u"v"w"["C"0#8x"lC"y"@|"}"|]"^"C""}"~"""P!"l""ܠ"K" ""d!""p!!$!((@(ܡ((($(H((T(((h(((( (P(!h(<(((!^"`"T"HQwdA#A#4#X!(4#""8"\"Դ"8i"Č"0# #d#!L""h!p!!!T!@$(X""""X+(-(!/(!!!4(`6($T"8(x9($!:(L;($!<("l! 4#"@?("L!"L!<""L!!"\1"$'D",F"p""1"",! """ "x"""<"x4#T(p` p` p` p` ` 4#`V(3"3"4"4"!""!0](^(T_(_( a("\##H""T""!l( #!3"3"!P!$!!v(v(D!a ` """""""H"'A"n"3"u"v"w"["C"0#8x"lC"y"@|"}"|]"^"C""}"~"""P!"l""ܠ"K" ""d!""p!!$!((@(ܡ((($(H((T(((h(((( (P(!h(<(((!^"`"T";Qd"H.Q!i.Q!~.Q!.Q!.Q!;Q!J.Q!.Q!/Q!k/Q!,Q!!-Q!"-Q!#?-Q!$N-Q!%#Q!&Q!':Q!(Q!-;Q!F;Q!D//Q!/W/Q!0`1Q!21Q!31Q!41Q!52Q!612Q!7;Q!I;Q!8;Q!91Q!:1Q!;;Q!G|2Q!</Q!2Q!=2Q!>2Q!?uH!H2Q!@2Q!A3Q!BQ>QH>Q13remote_target22extended_remote_target^HQ<>Q10stop_reply^HQ=QUse a remote computer via a serial line, using a gdb-specific protocol. Specify the serial device it is connected to (e.g. /dev/ttyS0, /dev/ttya, COM1, etc.).Command requires an argument.goto-bookmark: invalid bookmark number '%s'.goto-bookmark: no bookmark found for '%s'.target_get_bookmark failed.Saved bookmark %d at %s %d %s '%s' No bookmark #%d No bookmarks. Already in reverse mode. Use '%s' or 'set exec-dir forward'.No bookmarks.Delete all bookmarks? No bookmark #%d.Step program backward until it reaches the beginning of another source line. Argument N means do this N times (or till program stops for another reason).Step program backward, proceeding through subroutine calls. Like the "reverse-step" command as long as subroutine calls do not happen; when they do, the call is treated as one instruction. Argument N means do this N times (or till program stops for another reason).Step backward exactly one instruction. Argument N means do this N times (or till program stops for another reason).rsiStep backward one instruction, but proceed through called subroutines. Argument N means do this N times (or till program stops for another reason).rniContinue program being debugged but run it in reverse. If proceeding from breakpoint, a number N may be used as an argument, which means to set the ignore count of that breakpoint to N - 1 (so that the breakpoint won't break until the Nth time it is reached).Execute backward until just before selected stack frame is called.Set a bookmark in the program's execution history. A bookmark represents a point in the execution history that can be returned to at a later point in the debug session.Status of user-settable bookmarks. Bookmarks are user-settable markers representing a point in the execution history that can be returned to later in the same debug session.bookmarksDelete a bookmark from the bookmark list. Argument is a bookmark number or numbers, or no argument to delete all bookmarks.Go to an earlier-bookmarked point in the program's execution history. Argument is the bookmark number of a bookmark saved earlier by using the 'bookmark' command, or the special arguments: start (beginning of recording) end (end of recording)goto-bookmarkrun-on-main-threadRust&[&str\%c\x%02x\u{%06x}Could not find active enum variant__%dvoid rust_language::print_enum(value*, ui_file*, int, const value_print_options*) const../../gdb/rust-lang.crust_enum_p (type)%s {%p[%p]}%ps: value* eval_op_rust_ind(type*, expression*, noside, exp_opcode, value*)noside == EVAL_NORMALCannot access field %d of empty enum %sCannot access field %d of variant %s::%s, there are only %d fieldsCannot access field %d of %s, there are only %d fieldsVariant %s::%s is not a tuple variantAttempting to access anonymous field %d of %s, which is not a tuple, tuple struct, or tuple-like variantAnonymous field access is only allowed on tuples, tuple structs, and tuple-like enum variants ( fn -> ; variable length; %svoid rust_print_struct_def(type*, const char*, ui_file*, int, int, const type_print_options*, bool, print_offset_data*)!field_is_static (&type->field (i))! (is_enum && TYPE_FIELD_ARTIFICIAL (type, i))%*s%ps, *mut sliceCould not determine the array boundsstd::ops::RangeFullstd::ops::RangeToInclusivestd::ops::RangeTostd::ops::RangeInclusivestd::ops::Rangestd::ops::RangeFromRange expression with different types&[*gdb*]Can't take slice of array without '&'Could not find 'data_ptr' in slice typeCannot subscript non-array typeusizeCan't compute array boundsFound array with non-zero lower boundIndex less than zeroIndex greater than lengthHigh index less than zeroLow index greater than high indexHigh index greater than lengthCannot access field %s of empty enum %sAttempting to access named field %s of tuple variant %s::%s, which has only anonymous fieldsCould not find field %s of struct variant %s::%sArray with negative number of elementsMethod calls only supported on struct or enum typesMethod call on nameless typeCould not find function named '%s'Function '%s' takes no argumentsi8i16i32i64isizetype %s = *(%s as *mut %s)rust_lookup_symbol_non_local (%s, %s (scope %s), %s) .rsN4expr23tuple_holding_operationIJP4typeSt10unique_ptrINS_9operationESt14default_deleteIS4_EESt6vectorISt4pairINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEES7_ESaISG_EEEEE^YQpLTZQDȕdԉ#0#`!gYILOjGOLmJS[Q\#h#(#x)#$/, wP+h ## l#)) \#d#yp##Q##O##P#p *| * t#0*8*@*ww13rust_language^p[QNN4expr13rust_structopE^[QLN4expr24rust_aggregate_operationE^[QTZQ[QČ###Dȕd@#H|#@`[Q #h#}#Dȕdԉ##0#`Could not find Rust type %sNot enough hex digits seenuint32_t rust_parser::lex_hex(int, int)../../gdb/rust-parse.cmin != maxOverlong hex escapeuint32_t rust_parser::lex_escape(int)pstate->lexptr[0] == '\\'Unicode escape in byte literalMissing '{' in Unicode escapeMissing '}' in Unicode escapeInvalid escape \%c in literalint rust_parser::lex_character()pstate->lexptr[0] == '\''Unterminated character literalint rust_parser::lex_string()pstate->lexptr[0] == '"'Unexpected EOF in stringNon-ASCII value in raw byte stringNon-ASCII value in byte stringint rust_parser::lex_identifier()rust_identifier_start_p (pstate->lexptr[0])int rust_parser::lex_number()match == 0subexps[0].rm_eo > 0type_index != -1void rust_parser::push_back(char)pstate->prev_lexptr != NULL*pstate->lexptr == cvoid _initialize_rust_exp()code == 0Could not find crate for current locationnot really an error'_' not allowed in integers in anonymous field referencesfield name expectedNo symbol '%s' in current contextCouldn't find namespace scope for self::std::string rust_parser::super_name(const string&, unsigned int)scope[current_len] == ':'Too many super:: uses from '%s'expr::operation_up rust_parser::parse_string()current_token == STRINGCould not find type '&str'could not find tuple type '%s''::' expectedunexpected '::''>' expectedstd::string rust_parser::parse_path(bool)missing case in path parsingNo type name '%s' in current contexttype expectedinteger expected'(' expected'->' expectedCould not find type '%s'Type %s is not a tuple structunexpected tokenexpr::operation_up rust_parser::parse_binop(bool)!requiredbad binary operatoroperator_stack.size () == 1',' or ')' expectedTuple expressions not supported yet',' or ']' expected',', ';', or ']' expectedStruct expression applied to non-struct type'}', '..', or identifier expected..=mutexternvoid rust_parser::assume(int)current_token == type'%c' expectedN4expr23rust_unop_ind_operationE^dQ HN4expr24rust_subscript_operationE^ 0 && s <= GDB_MI_MSG_WIDTHserial[fd%d->fd-scheduled] [fd%d->timer-scheduled] [fd%d->asynchronous] serial-error[fd%d->synchronous] creating serial event pipe failed.../../gdb/ser-event.cLND# #/bin/shV####h#p############p$$Missing port on hostname '%s'%s: cannot resolve name: %s TCP protocol specific variables. Configure variables specific to remote TCP connections.auto-retryShow auto-retry on socket connect.Set auto-retry on socket connect.connect-timeoutIf set to "unlimited", GDB will keep attempting to establish a connection forever, unless interrupted with Ctrl-c. The default is 15 seconds.Show timeout limit in seconds for socket connection.Set timeout limit in seconds for socket connection.O####h#p##############The socket name is too long. It may be no longer than %s bytes.AW8$$##h#p############$$Hardware flow control is %s. c_iflag = 0x%x, c_oflag = 0x%x, c_cflag = 0x%x, c_lflag = 0x%x c_cc: get_tty_state failed: %s set_tty_state failed: %s Invalid baud rate %d. Closest values are %d and %d.Invalid baud rate %d. Minimum value is %d.Invalid baud rate %d. Maximum value is %d.Incorrect parity value: %d../../gdb/ser-unix.cremoteflowEnable or disable hardware flow control (RTS/CTS) on the serial port when debugging using remote targets.Show use of hardware flow control for remote serial I/O.Set use of hardware flow control for remote serial I/O.hardwire2Kn,X  `  % KrQL$($##$$$$$$$0$$$`$P$#p$$ %c Baud rate for remote serial I/O is %s. c End of log Set default serial/parallel port configuration.Show default serial/parallel port configuration.This value is used to set the speed of the serial port when debugging using remote targets.Show baud rate for remote serial I/O.Set baud rate for remote serial I/O.parityShow parity for remote serial I/O.Set parity for remote serial I/O.remotelogfileThis file is used to record the remote session for future playback by gdbserver.Show filename for remote session recording.Set filename for remote session recording.remotelogbaseShow numerical base for remote session logging.Set numerical base for remote session logging.When non-zero, serial port debugging is enabled.Show serial debugging.Set serial debugging.oddevenasciihexoctal,wQvQvQvQwQvQnoneNo skiplist entries found with number %s.Not skipping any files or functions. No skiplist entries found with number %s. SkiplistTableGlobFileFunctionblklst-entryyes. no. skip: checking if file %s matches non-glob %s...skip: checking if file %s matches glob %s...skip: checking if function %s matches regex %s...bool skiplist_entry::skip_function_p(const char*) const../../gdb/skip.cm_compiled_function_regexpskip: checking if function %s matches non-regex %s...Ignore a function while stepping. Usage: skip [FUNCTION-NAME] skip [FILE-SPEC] [FUNCTION-SPEC] If no arguments are given, ignore the current function. FILE-SPEC is one of: -fi|-file FILE-NAME -gfi|-gfile GLOB-FILE-PATTERN FUNCTION-SPEC is one of: -fu|-function FUNCTION-NAME -rfu|-rfunction FUNCTION-NAME-REGULAR-EXPRESSIONIgnore a file while stepping. Usage: skip file [FILE-NAME] If no filename is given, ignore the current file.Ignore a function while stepping. Usage: skip function [FUNCTION-NAME] If no function name is given, skip the current function.Enable skip entries. Usage: skip enable [NUMBER | RANGE]... You can specify numbers (e.g. "skip enable 1 3"), ranges (e.g. "skip enable 4-8"), or both (e.g. "skip enable 1 3 4-8"). If you don't specify any numbers or ranges, we'll enable all skip entries.Disable skip entries. Usage: skip disable [NUMBER | RANGE]... You can specify numbers (e.g. "skip disable 1 3"), ranges (e.g. "skip disable 4-8"), or both (e.g. "skip disable 1 3 4-8"). If you don't specify any numbers or ranges, we'll disable all skip entries.Delete skip entries. Usage: skip delete [NUMBER | RANGES]... You can specify numbers (e.g. "skip delete 1 3"), ranges (e.g. "skip delete 4-8"), or both (e.g. "skip delete 1 3 4-8"). If you don't specify any numbers or ranges, we'll delete all skip entries.Display the status of skips. Usage: info skip [NUMBER | RANGES]... You can specify numbers (e.g. "info skip 1 3"), ranges (e.g. "info skip 4-8"), or both (e.g. "info skip 1 3 4-8"). If you don't specify any numbers or ranges, we'll show all skips.When non-zero, debug output about skipping files and functions is displayed.Show whether the debug output about skipping files and functions is printed.Set whether to print the debug output about skipping files and functions.skiplist_entry::skiplist_entry(bool, std::string&&, bool, std::string&&, skiplist_entry::private_key)!m_file.empty () || !m_function.empty ()!m_file.empty ()Function %s will be skipped when stepping. No default function now.No function found containing current program point %s.No default file now.File %s will be skipped when stepping. File(s)file(s)Function(s)-fiMissing value for %s option.-gfi-gfile-fu-rfu-rfunctionInvalid skip option: %sCannot specify both -file and -gfile.Cannot specify both -function and -rfunction.void skip_command(const char*, int)file != NULL || gfile != NULL || function != NULL || rfunction != NULL%s %s in %s %s will be skipped when stepping. link_map_offsets* svr4_fetch_link_map_offsets()../../gdb/solib-svr4.cops->fetch_link_map_offsetsUsing PIC (Position Independent Code) prelink displacement %s for "%s". .dynamic section for "%s" is not at the expected address (wrong library or version mismatch?)/usr/lib/ld.so.1/usr/lib/amd64/ld.so.1/usr/lib/sparcv9/ld.so.1Probes-based dynamic linker interface failed. Reverting to original interface.Error reading shared library list entry at %sCorrupted shared library list: %s != %sCan't read pathname for load map.rtld_%srtldrtld_map_failedvoid register_solib_event_probe(svr4_info*, objfile*, probe*, CORE_ADDR, probe_action)*slot == HTAB_EMPTY_ENTRYInitializing probes-based dynamic linker interface failed. Reverting to original interface._r_debugAttempt to reload symbols from process? failed to read exec filename from attached fileprobe_action solib_event_probe_action(probe_and_action*)action == FULL_RELOAD || action == UPDATE_OR_RELOADstart=%s;prev=%sUsing PIE (Position Independent Executable) displacement %s for "%s". .interpint enable_break(svr4_info*, int)load_addr < space_sizeUnable to find dynamic linker breakpoint function. GDB will be unable to debug shared library initializers and track explicitly loaded dynamic code.solib-svr4init_startinit_completereloc_completeunmap_startunmap_completemain_$main__start_r_debug_state_dl_debug_state__dl_rtld_db_dlactivity_rtld_debug_statePQ QQ7Q-Q&Q5QAQdQcQrQQQQ\Q[QLvoid solib_target_free_so(so_list*)../../gdb/solib-target.cli->name.empty ()Can not parse XML library list; XML support was disabled at compile timeCould not relocate shared library "%s": wrong number of ALLOC sectionsvoid solib_target_relocate_section_addresses(so_list*, target_section*)so->addr_low <= so->addr_highCould not relocate shared library "%s": no segmentsCould not relocate shared library "%s": bad offsetsli->segment_bases.size () > 0The search path for loading non-absolute shared library symbol files is %s. Autoloading of shared library symbols is %s. /libpthread/libc.Could not open `%s' as an executable file: %sShared library file name is too long.Error while reading shared library symbols for %s: LD_LIBRARY_PATH`%s': not in executable format: %s`%s': Shared library architecture %s is not compatible with target architecture %s.Could not load shared library symbols for %s. Do you need "set solib-search-path" or "set sysroot"?Could not load shared library symbols for %d libraries, e.g. %s. Use the "info sharedlibrary" command to see the complete listing. Do you need "set solib-search-path" or "set sysroot"?Error reading attached process's symbol file. Error while mapping shared library sections: Loading symbols for shared libraries: %s Loading symbols for shared libraries. Symbols already loaded for %s No loaded shared libraries match the pattern `%s'. remote:"%s" is deprecated, use "%s" instead.sysroot set to "%s".SharedLibraryTablesyms-readSyms ReadShared Object LibraryYes (*)No shared libraries matched. No shared libraries loaded at this time. (*): Shared library is missing debugging information. solibLoad shared object library symbols for files matching REGEXP.Status of loaded shared object libraries.dllUnload all shared object library symbols.nosharedlibraryauto-solib-addIf "on", symbols from all shared object libraries will be loaded automatically when the inferior begins execution, when the dynamic linker informs gdb that a new library has been loaded, or when attaching to the inferior. Otherwise, symbols must be loaded manually, using `sharedlibrary'.Show autoloading of shared library symbols.Set autoloading of shared library symbols.sysrootThe system root is used to load absolute shared library symbol files. For other (relative) files, you can add directories using `set solib-search-path'.Show the current system root.Set an alternate system root.solib-absolute-prefixsolib-search-pathThis takes precedence over the environment variables PATH and LD_LIBRARY_PATH.Show the search path for loading non-absolute shared library symbol files.Set the search path for loading non-absolute shared library symbol files.^̓Q*Z17_initialize_solibvEUlP8inferiorE_Source file is more recent than executable.bool source_cache::ensure(symtab*)../../gdb/source-cache.cm_offset_cache.find (fullname) != m_offset_cache.end ()bool source_cache::get_line_charpos(symtab*, const std::vector**)iter != m_offset_cache.end ()void delete_substitute_path_rule(substitute_path_rule*)../../gdb/source.cFilenames are displayed as "%s". Number of source lines gdb will list by default is %s. IncludesDoes not includeNo current source file. Current source file is %s Compilation directory is %s Located in %s Contains %d line%s. Source language is %s. Producer is %s. Compiled with %s debugging format. %s preprocessor macro info. Source directories searched: Too many arguments in commandSource path substitution rule matching `%s': List of all source path substitution rules: `%s' -> `%s'. Incorrect usage, too many arguments in commandDelete all source path substitution rules? CanceledNo substitution rule defined for `%s'$cdir%c$cwdIncorrect usage, too few arguments in commandFirst argument must be at least one character longAdd directory DIR to beginning of search path for source files. Forget cached info on source file locations and line positions. DIR can also be $cwd for the current working directory, or $cdir for the directory in which the source file was compiled into object code. With no argument, reset the search path to $cdir:$cwd, the default.$cwd in the path means the current working directory. $cdir in the path means the compilation directory of the source file. GDB ensures the search path always ends with $cdir:$cwd by appending these directories if necessary. Setting the value to an empty string sets it to $cdir:$cwd, the default.Show the search path for finding source files.Set the search path for finding source files.Information about the current source file.Core addresses of the code for a source line. Line can be specified as LINENUM, to list around that line in current file, FILE:LINENUM, to list around that line in that file, FUNCTION, to list around beginning of that function, FILE:FUNCTION, to distinguish among like-named static functions. Default is to describe the last source line that was listed. This sets the default address for "x" to the line's first instruction so that "x/i" suffices to start examining the machine code. The address is also stored as the value of "$_".Search for regular expression (see regex(3)) from last line listed. The matching line number is also stored as the value of "$_".forward-searchSearch backward for regular expression (see regex(3)) from last line listed. The matching line number is also stored as the value of "$_".reverse-searchlistsizeUse this to choose how many source lines the "list" displays (unless the "list" argument explicitly specifies some other number). A value of "unlimited", or zero, means there's no limit.Show number of source lines gdb will list by default.Set number of source lines gdb will list by default.Add a substitution rule to rewrite the source directories. Usage: set substitute-path FROM TO The rule is applied only if the directory name starts with FROM directly followed by a directory separator. If a substitution rule was previously set for FROM, the old rule is replaced by the new one.substitute-pathDelete one or all substitution rules rewriting the source directories. Usage: unset substitute-path [FROM] Delete the rule for substituting FROM in source directories. If FROM is not specified, all substituting rules are deleted. If the debugger cannot find a rule for FROM, it will display a warning.Show one or all substitution rules rewriting the source directories. Usage: show substitute-path [FROM] Print the rule for substituting FROM in source directories. If FROM is not specified, print all substitution rules.filename-displayfilename-display can be: basename - display only basename of a filename relative - display a filename relative to the compilation directory absolute - display an absolute filename By default, relative filenames are displayed.Show how to display filenames.Set how to display filenames.Can't find a default source fileint openp(const char*, openp_flags, const char*, int, gdb::unique_xmalloc_ptr*)(mode & O_CREAT) == 0$cdirinvalid filename_display_stringNo line number information availableLine %d of "%s" is at address but contains no code. starts at address and ends at Line number %d is out of range for "%s". %d %s in Line number %d out of range; %s has %d lines.%d ^%c^?%s is not a directory.Reinitialize source path to empty? Expression not foundExpression not found HQZQQQbasenameabsoluterelativeinvalid C++ abbreviation `%s'couldn't parse type; debugger out of date?bad structure-type formatUnknown builtin type %dshort realstringptrinteger*1integer*4struct/union type gets multiply defined: %s%sInvalid symbol data: type number (%d,%d) out of range at symtab pos %d.GDB internal error: bad real_filenumInvalid symbol data: common block within common blockneed a type nameforward-referenced types left unresolved, type code %d.ECOMM symbol unmatched by BCOMM%s: common block `%s' from global_sym_chain unresolvedFOOUnrecognized cross-reference type `%c'Prototyped function type didn't end arguments with `#': %sinvalid (minimal) member type data format at symtab pos %d.base type %d of range type is not definedUnknown virtual character `%c' for baseclassUnknown visibility `%c' for baseclassC++ abbreviated type name unknown at symtab pos %dINVALID_CPLUSPLUS_ABBREVUnknown visibility `%c' for fieldvirtual function table pointer not found when defining class `%s'GDB internal error, type is NULL in stabsread.c.const/volatile indicator missing, got '%c'member function type missing, got '%c'__base_ctor __base_dtor __deleting_dtorMethod has bad physname %s void patch_block_stabs(pending*, pending_stabs*, objfile*)../../gdb/stabsread.cInvalid (empty) method argumentsinvalid symbol name "%s"Bad stabs string '%s'eh_throwUnknown C++ symbol name `%s'$_vptr$_vb$Debugger's willingness to use disassemble-next-line is %s. Unable to restore previously selected frame.no-filtershideUnexpected print frame-info value `%s'.../../gdb/stack.cPlease specify a command to apply on all framesaddr_flagsbool frame_show_address(frame_info*, symtab_and_line)inline_skipped_frames (inferior_thread ()) > 0get_frame_type (get_next_frame (frame)) == INLINE_FRAMEBottom (innermost) frame selected; you cannot go down.Initial frame selected; you cannot go up.Make selected stack frame return to its caller. Control remains in the debugger, but when you continue execution will resume in the frame above the one now selected. If an argument is given, it is an expression for the value to return.Select and print stack frame that called this one. An argument says how many frames up to go.Same as the `up' command, but does not print anything. This is useful in command scripts.up-silentlySelect and print stack frame called by this one. An argument says how many frames down to go.Same as the `down' command, but does not print anything. This is useful in command scripts.down-silentlySelect and print a stack frame. With no argument, print the selected stack frame. (See also "info frame"). A single numerical argument specifies the frame to select.Apply a command to a number of frames. Usage: frame apply COUNT [OPTION]... COMMAND With a negative COUNT argument, applies the command on outermost -COUNT frames. Prints the frame location information followed by COMMAND output. By default, an error raised during the execution of COMMAND aborts "frame apply". Options: %OPTIONS%Apply a command to all frames. Usage: frame apply all [OPTION]... COMMAND Prints the frame location information followed by COMMAND output. By default, an error raised during the execution of COMMAND aborts "frame apply". Options: %OPTIONS%Apply a command to a list of frames. Usage: frame apply level LEVEL... [OPTION]... COMMAND LEVEL is a space-separated list of levels of frames to apply COMMAND on. Prints the frame location information followed by COMMAND output. By default, an error raised during the execution of COMMAND aborts "frame apply". Options: %OPTIONS%Apply a command to all frames (ignoring errors and empty output). Usage: faas [OPTION]... COMMAND shortcut for 'frame apply all -s [OPTION]... COMMAND' See "help frame apply all" for available options.Select and print a stack frame by stack address. Usage: frame address STACK-ADDRESSView a stack frame that might be outside the current backtrace. Usage: frame view STACK-ADDRESS frame view STACK-ADDRESS PC-ADDRESSSelect and print a stack frame by function name. Usage: frame function NAME The innermost frame that visited function NAME is selected.Select and print a stack frame by level. Usage: frame level LEVELSelect a stack frame without printing anything. A single numerical argument specifies the frame to select.Select a stack frame by stack address. Usage: select-frame address STACK-ADDRESSSelect a stack frame that might be outside the current backtrace. Usage: select-frame view STACK-ADDRESS select-frame view STACK-ADDRESS PC-ADDRESSSelect a stack frame by function name. Usage: select-frame function NAMESelect a stack frame by level. Usage: select-frame level LEVELPrint backtrace of all stack frames, or innermost COUNT frames. Usage: backtrace [OPTION]... [QUALIFIER]... [COUNT | -COUNT] Options: %OPTIONS% For backward compatibility, the following qualifiers are supported: full - same as -full option. no-filters - same as -no-filters option. hide - same as -hide. With a negative COUNT, print outermost -COUNT frames.whereBacktrace of the stack, or innermost COUNT frames.All about the selected stack frame. With no arguments, displays information about the currently selected stack frame. Alternatively a frame specification may be provided (See "frame") the information is then printed about the specified frame.Print information about a stack frame selected by stack address. Usage: info frame address STACK-ADDRESSPrint information about a stack frame outside the current backtrace. Usage: info frame view STACK-ADDRESS info frame view STACK-ADDRESS PC-ADDRESSPrint information about a stack frame selected by function name. Usage: info frame function NAMEPrint information about a stack frame selected by level. Usage: info frame level LEVELlocal variablesAll local variables of current stack frame or those matching REGEXPs. Usage: info locals [-q] [-t TYPEREGEXP] [NAMEREGEXP] Prints the local variables of the current stack frame. argument variablesAll argument variables of current stack frame or those matching REGEXPs. Usage: info args [-q] [-t TYPEREGEXP] [NAMEREGEXP] Prints the argument variables of the current stack frame. Select the stack frame that contains NAME. Usage: func NAMEIf set, frame arguments are printed in raw form, bypassing any pretty-printers for that value.Show whether to print frame arguments in raw form.Set whether to print frame arguments in raw form.set print raw-frame-argumentsdisassemble-next-lineIf ON, GDB will display disassembly of the next source line, in addition to displaying the source line itself. If the next source line cannot be displayed (e.g., source is unavailable or there's no line info), GDB will display disassembly of next instruction instead of showing the source line. If AUTO, display disassembly of next instruction only if the source line cannot be displayed. If OFF (which is the default), never display the disassembly of the next source line.Show whether to disassemble next source line or insn when execution stops.Set whether to disassemble next source line or insn when execution stops.void print_frame_arg(const frame_print_options&, const frame_arg*)arg->entry_kind == print_entry_values_no || arg->entry_kind == print_entry_values_only || (!uiout->is_mi_like_p () && arg->entry_kind == print_entry_values_compact)PC unavailable, cannot determine locals. No locals. No matching locals. PC unavailable, cannot determine args. No arguments. No matching arguments. No frame at address %s.Missing address argument to view a frameNo frame at level %s.void read_frame_arg(const frame_print_options&, symbol*, frame_info*, frame_arg*, frame_arg*)val == NULL!current_uiout->is_mi_like_p ()void print_frame_args(const frame_print_options&, symbol*, frame_info*, int, ui_file*)Stack frame at Stack level %d, frame at (%ps:%d)saved %s = Outermost frame: %s tail call frame inlined into frame %d called by frame at caller of frame at source language %s. Arglist at unknown address. Arglist at void info_frame_command_core(frame_info*, bool)numargs >= 0 no args. 1 arg: %d args: Locals at unknown address, Locals at Previous frame's sp is Previous frame's sp at Previous frame's sp in %s Saved registers: void print_frame(const frame_print_options&, frame_info*, int, print_what, int, symtab_and_line)void last_displayed_symtab_info_type::set(program_space*, CORE_ADDR, symtab*, int)pspace != nullptrPlease specify a command to apply on the selected framesframe apply unable to get selected frame.Missing or invalid LEVEL... argumentframe_info* leading_innermost_frame(int)frame apply levelframe apply allMissing COUNT argument.Invalid COUNT argument.frame applyThe location at which to store the function's return value is unknown. If you continue, the return value that you specified will be ignored. Can not force return from an inlined function.Return value type not available for selected stack frame. Please use an explicit cast of the value to return.%sMake selected stack frame return now? Function does not return normally to caller.%sMake %s return now? Not confirmedvoid return_command(const char*, int)rv_conv != RETURN_VALUE_STRUCT_CONVENTION && rv_conv != RETURN_VALUE_ABI_RETURNS_ADDRESSvoid backtrace_command_1(const frame_print_options&, const backtrace_cmd_options&, const char*, int)(More stack frames follow...) Backtrace stopped: %s frame_info* find_frame_for_function(const char*)function_name != NULL'%s' not within current stack frame.Missing function name argumentNo frame for function "%s".Set printing of function arguments at function entry.Show printing of function arguments at function entry.GDB can sometimes determine the values of function arguments at entry, in addition to their current values. This option tells GDB whether to print the current value, the value at entry (marked as val@entry), or both. Note that one or both of these values may be .Set printing of non-scalar frame arguments.Show printing of non-scalar frame arguments.Set printing of frame information.Show printing of frame information.Print values of local variables.Prohibit frame filters from executing on a backtrace.Causes Python frame filter elided frames to not be printed.Disables printing the frame location information.Print any error raised by COMMAND and continue.Silently ignore any errors or empty output produced by COMMAND.void number_or_range_parser::skip_range()../../gdb/cli/cli-utils.hm_in_rangecPQQ\QQ)Q Q QQQonlynocompactscalarspreferredif-neededdefaultbothnonepresenceautoalliQdQ|QQQlQQQtQQQshort-locationlocation-and-addresssource-and-locationlocationsource-lineexp_opcode stap_get_opcode(const char**)../../gdb/stap-probe.c**s == '='Invalid opcode in expression `%s' for SystemTapprobeCould not read the value of a SystemTap semaphore.Could not write the value of a SystemTap semaphore.SystemTap Probe expression debugging is %s. semaphoreSemaphoreexpr::operation_up stap_make_binop(exp_opcode, expr::operation_up&&, expr::operation_up&&)iter != stap_maker_map.end ()Invalid register displacement syntax on expression `%s'.Invalid register name '%s' after replacing it (previous name was '%s')Missing register name suffix on expression `%s'.Missing indirection suffix on expression `%s'.expr::operation_up stap_parse_argument_conditionally(stap_parse_info*)gdbarch_stap_is_single_operand_p (p->gdbarch)Invalid operator `%c' for register displacement on expression `%s'.Invalid constant suffix on expression `%s'.Unknown numeric token on expression `%s'.Operator `%c' not recognized on expression `%s'.Missing close-parenthesis on expression `%s'.Cannot parse expression `%s'.expr::operation_up stap_parse_argument_1(stap_parse_info*, expr::operation_up&&, stap_operand_prec)p->arg != NULLInvalid operator `%c' on expression `%s'.`-void stap_probe::parse_arguments(gdbarch*)!m_have_parsed_argsunrecognized bitness %s%c' for probe `%s'expression_up stap_parse_argument(const char**, type*, gdbarch*)p.inside_paren_p == 0The SystemTap SDT probe support is not fully implemented on this target; you will not be able to inspect the arguments of the probes. Please report a bug against GDB requesting a port to this target.virtual unsigned int stap_probe::get_argument_count(gdbarch*).stapsdt.basecould not obtain base address for SystemTap section on objfile `%s'.corrupt probe name when reading `%s'corrupt probe argument when reading `%s'could not parse SystemTap probe(s) from inferiorstap-expressionWhen non-zero, the internal representation of SystemTap expressions will be printed.Show SystemTap expression debugging.Set SystemTap expression debugging.Show information about SystemTap static probes. Usage: info probes stap [PROVIDER [NAME [OBJECT]]] Each argument is a regular expression, used to select probes. PROVIDER matches probe provider names. NAME matches the probe names. OBJECT matches the executable or shared library name.-pstapstap_probe_arg* stap_probe::get_arg_by_number(unsigned int, gdbarch*)Probe '%s' apparently does not have arguments, but GDB is requesting its argument number %u anyway. This should not happen. Please report this bug.DQJQ%(%4%%%%%P%%%L%))Q%@%%S %21stap_static_probe_ops^Q(K10stap_probe^Q8KStandard register ``$ps'' is not available for this targetStandard register ``$sp'' is not available for this targetSymfile debugging is %s. symfile_segment_data_up debug_sym_segments(bfd*)../../gdb/symfile-debug.cdebug_sym_segments calledprobes->sym_get_probes (%s) = %s sf->sym_new_init (%s) sf->sym_init (%s) sf->sym_read (%s, 0x%x) sf->sym_finish (%s) sf->sym_offsets (%s, %s) sf->sym_read_linetable (%s) sf->sym_relocate (%s, %s, %s) = %s void install_symfile_debug_logging(objfile*)!symfile_debug_installed (objfile)void uninstall_symfile_debug_logging(objfile*)qf->has_symbols (%s) = %d qf->has_unexpanded_symtabs (%s) qf->has_unexpanded_symtabs (%s) = %d qf->find_last_source_symtab (%s) qf->find_last_source_symtab (...) = %s qf->forget_cached_source_info (%s) qf->map_symtabs_matching_filename (%s, "%s", "%s", %s) qf->map_symtabs_matching_filename (...) = %d qf->print_stats (%s, %d) qf->dump (%s) qf->expand_all_symtabs (%s) qf->expand_symtabs_with_fullname (%s, "%s") qf->expand_matching_symbols (%s, %s, %d, %s) qf->expand_symtabs_matching (%s, %s, %s, %s, %s) qf->find_pc_sect_compunit_symtab (%s, %s, %s, %s, %d) qf->find_pc_sect_compunit_symtab (...) = %s qf->map_symbol_filenames (%s, ..., %d) qf->find_compunit_symtab_by_address (%s, %s) qf->find_compunit_symtab_by_address (...) = %s Reading symbols from %s... (No debugging symbols found in %s) void objfile_set_sym_fns(objfile*, const sym_fns*)debug_symfileWhen enabled, all calls to the symfile functions are logged.Show debugging of the symfile functions.Set debugging of the symfile functions.qf->lookup_symbol (%s, %d, "%s", %s) qf->lookup_symbol (...) = %s qf->expand_symtabs_for_function (%s, "%s") %shared object read from target memoryadd-symbol-file-from-memory not supported for this targetFailed to read a valid object file image from memory.Got object file from memory but can't read symbols: %s.add-symbol-file-from-memory requires an expression argumentMust use symbol-file or exec-file before add-symbol-file-from-memory.Could not load vsyscall page because no executable was specifiedsystem-supplied DSO at %sLoad the symbols out of memory from a dynamically loaded object file. Give an expression for the address of the file's shared object file header.add-symbol-file-from-memorysymfile-mem../../gdb/symfile.cThe directory where separate debug symbols are searched for is "%s". Mapping between filename extension and source language is "%s". Filename extensions and the languages they represent: %s - %s This target does not know how to read its overlay state.Automatic overlay debugging enabled.Overlay debugging disabled.Overlay debugging enabled..dynbss.sdynbssI'm sorry, Dave, I can't do that. Symbol format `%s' unknown.Overlay debugging not enabled. Use either the 'overlay auto' or the 'overlay manual' command.Argument required: name of an overlay sectionSection %s is not mappedNo overlay section called %sscoped_restore_tmpl increment_reading_symtab()currently_reading_symtab >= 0Created compunit symtab %s for %s. Note: section %s unmapped by overlap No sections are mapped. Section %s, loaded at , mapped at _novlys_ovly_tableError reading inferior's overlay table: couldn't find `_ovly_table' array in inferior. Use `overlay manual' mode.Error reading inferior's overlay table: couldn't find `_novlys' variable in inferior. Use `overlay manual' mode.bfd_byte* symfile_relocate_debug_section(objfile*, asection*, bfd_byte*)objfile->sf->sym_relocateint symfile_map_offsets_to_segments(bfd*, const symfile_segment_data*, section_offsets&, int, const CORE_ADDR*)num_segment_bases > 0data->segments.size () > 00 <= which && which <= data->segments.size ()Loading section %s, size %s lma %s Canceled the downloadCreating one or more symtabs for objfile %s ... Created symtab %s for module %s. no, same file as the objfile. no, error computing CRC. the debug information found in "%s" does not match "%s" (CRC mismatch). no, CRC doesn't match. `%s': can't open to read symbols: %s.`%s': can't read symbols: %s.file to loadInvalid download offset:%s.Too many parameters."%s" is not an object file: %sLoad failedStart address , load size load-sizeTransfer rate: transfer-rate bits/sec bytes/sec KB/sectransferred-bits bits in <1 secwrite-rate bytes/write Looking for separate debug info (debug link) for %s Discard symbol table from `%s'? Discard symbol table? void symbol_file_clear(int)current_program_space->symfile_object_file == NULLNo symbol file now. remove-symbol-file: no symbol file providedMissing address argumentJunk after %sNo symbol file foundRemove symbol table from file "%s"? void add_filename_language(const char*, language)'%s': Filename extension must begin with '.''%s': two arguments required -- filename extension and language.rodatano loadable sections found in added symbol-file %svoid addr_info_make_relative(section_addr_info*, bfd*)addrs_to_abfd_addrs[index_in_addrs] == NULL.gnu.liblist.gnu.conflictsection %s not found in %sLoad new symbol table from "%s"? Reading symbols from %ps... void syms_from_objfile_1(objfile*, section_addr_info*, symfile_add_flags)Expanding full symbols from %ps... (No debugging symbols found in %ps) `%s' has disappeared; keeping its symbols. `%s' has changed; re-reading symbols. Can't open %s to read symbols.Can't read symbols from %s: %s.(no debugging symbols found) \"' Unrecognized argument "%s"-readnow-readneverMissing argument to -ono symbol file name was specified-readnow and -readnever cannot be used simultaneously with all sectionswith other sectionsadd-symbol-file takes a file name and an addressMissing section name after "-s"Missing section address after "-s"You must provide a filename to be loaded.add symbol table from file "%s" at %s_addr = %s %s offset by %s newly-added symbol file "%s" does not provide any symbolsLoad symbol table from executable file FILE. Usage: symbol-file [-readnow | -readnever] [-o OFF] FILE OFF is an optional offset which is added to each section address. The `file' command can also load symbol tables, as well as setting the file to execute. The '-readnow' option will cause GDB to read the entire symbol file immediately. This makes the command slower, but may make future operations faster. The '-readnever' option will prevent GDB from reading the symbol file's symbolic debug information.Load symbols from FILE, assuming FILE has been dynamically loaded. Usage: add-symbol-file FILE [-readnow | -readnever] [-o OFF] [ADDR] [-s SECT-NAME SECT-ADDR]... ADDR is the starting address of the file's text. Each '-s' argument provides a section name and address, and should be specified if the data and bss segments are not contiguous with the text. SECT-NAME is a section name to be loaded at SECT-ADDR. OFF is an optional offset which is added to the default load addresses of all sections for which no other address was specified. The '-readnow' option will cause GDB to read the entire symbol file immediately. This makes the command slower, but may make future operations faster. The '-readnever' option will prevent GDB from reading the symbol file's symbolic debug information.add-symbol-fileRemove a symbol file added via the add-symbol-file command. Usage: remove-symbol-file FILENAME remove-symbol-file -a ADDRESS The file to remove can be identified by its filename or by an address that lies within the boundaries of this symbol file in memory.remove-symbol-fileDynamically load FILE into the running program. FILE symbols are recorded for access from GDB. Usage: load [FILE] [OFFSET] An optional load OFFSET may also be given as a literal address. When OFFSET is provided, FILE must also be provided. FILE can be provided on its own.Commands for debugging overlays.ovlyAssert that an overlay section is mapped.Assert that an overlay section is unmapped.unmap-overlayList mappings of overlay sections.list-overlaysEnable overlay debugging.manualDisable overlay debugging.Enable automatic overlay debugging.Read the overlay mapping state from the target.load-targetextension-languageUsage: set extension-language .foo barShow mapping between filename extension and source language.Set mapping between filename extension and source language.All filename extensions associated with a source language.extensionsdebug-file-directorySeparate debug symbols are first searched for in the same directory as the binary, then in the `.debug' subdirectory, and lastly at the path of the directory of the binary with each global debug-file-directory component prepended.Show the directories where separate debug symbols are searched for.Set the directories where separate debug symbols are searched for.symbol-loadingoff == turn all messages off brief == print messages for the executable, and brief messages for shared libraries full == print messages for the executable, and messages for each shared library.Show printing of symbol loading messages.Set printing of symbol loading messages.separate-debug-fileWhen on, GDB prints the searched locations while looking for separate debug info files.Show printing of separate debug info file search debug.Set printing of separate debug info file search debug.offfullbrief Symtab for file %s at %s Language: %s Line table: line %d at (stmt) Blockvector: block #%03d, object at under , %d syms/buckets in , function %slabel %s at %s %s = const %s (%s)const %s hex bytes:static at arg at offset %sreference arg at %saddress parameter register %slocal at offset %slabel at block object botched symbol class %x Blockvector same as owning compunit: %s Compunit user: %s Compunit include: %s Error printing symbol: Extra arguments after regexp. { symtab %s NULL blockvector { ((struct compunit_symtab *) %s) debugformat %s producer %s dirname %s blockvector ((struct blockvector *) %s) user ((struct compunit_symtab *) %s) ( includes (struct compunit_symtab *) (%s %s) ) { symtab %s fullname %s linetable ((struct linetable *) %s) } Object file %s: Objfile at , bfd at , %d minsyms Symtabs: , NOT ON CHAIN!Statistics for '%s': Number of "stab" symbols read: %d Number of "minimal" symbols read: %d Number of "full" symbols read: %d Number of "types" defined: %d Number of symbol tables: %d Number of symbol tables with line tables: %d Number of symbol tables with blockvectors: %d Space used by string tables: %d Total memory used for objfile obstack: %s Total memory used for BFD obstack: %s Total memory used for string cache: %d Byte cache statistics for '%s': string cachePrint dump of current symbol definitions. Usage: mt print symbols [-pc ADDRESS] [--] [OUTFILE] mt print symbols [-objfile OBJFILE] [-source SOURCE] [--] [OUTFILE] Entries in the full symbol table are dumped to file OUTFILE, or the terminal if OUTFILE is unspecified. If ADDRESS is provided, dump only the file for that address. If SOURCE is provided, dump only that file's symbols. If OBJFILE is provided, dump only that file's minimal symbols.Print dump of current minimal symbol definitions. Usage: mt print msymbols [-objfile OBJFILE] [--] [OUTFILE] Entries in the minimal symbol table are dumped to file OUTFILE, or the terminal if OUTFILE is unspecified. If OBJFILE is provided, dump only that file's minimal symbols.msymbolsPrint dump of current object file definitions. With an argument REGEXP, list the object files with matching names.objfilesList the full symbol tables for all object files. This does not include information about individual symbols, blocks, or linetables --- just the symbol table structures themselves. With an argument REGEXP, list the symbol tables with matching names.List the contents of all line tables, from all symbol tables. With an argument REGEXP, list just the line tables for the symbol tables with matching names.line-tableCheck consistency of currently expanded symtabs.check-symtabsExpand symbol tables. With an argument REGEXP, only expand the symbol tables with matching names.expand-symtabsobjfile: %s ((struct objfile *) %s) compunit_symtab: ((struct compunit_symtab *) %s) symtab: %s ((struct symtab *) %s) linetable: ((struct linetable *) %s): No line table. Line table has no lines. LINEis-stmtIS-STMT Object file %s: No minimal symbols found. [%2d] %c spurious section %ldinternal error: minimal symbol count %d != %dNo symtab for address: %sNo symtab for source file: %suTii?DBAStdbSymbol cache size is too large, max is %u.type* basic_lookup_transparent_type_1(objfile*, block_enum, const char*)../../gdb/symtab.c!TYPE_IS_OPAQUE (SYMBOL_TYPE (sym))void symbol_cache_flush(program_space*)symbol_cache_size == 0cache->static_symbols == NULLcache->global_symbols->size == symbol_cache_sizecache->static_symbols->size == symbol_cache_size(no object file)Symbol cache statistics for pspace %d %s: empty, no stats available Global block cache stats: size: %u hits: %u misses: %u collisions: %u Static block cache stats: const char* domain_name(domain_enum)bad domain_enumconst char* search_domain_name(search_domain)bad search_domainsymtab* compunit_primary_filetab(const compunit_symtab*)COMPUNIT_FILETABS (cust) != NULLglobalInternal: %s symbol `%s' found in %s psymtab but not in symtab. %s may be an inlined function, or may be a template function (if a template, try specifying an instantiation: %s).type* basic_lookup_transparent_type_quick(objfile*, block_enum, const char*)__dt__%s%s__%s%s%dvoid general_symbol_info::set_language(language, obstack*)ada_mangled == 0Symbol cache for pspace %d %s: [%4u] = %s, %s %s (not found) [%4u] = %s, %s %s Static symbols: Global symbols: bool matching_obj_sections(obj_section*, obj_section*)obj != NULLlookup_language_this (%s, %s (objfile %s)) = %s (%s, block %s) bool info_sources_filter::matches(const char*) constbad m_match_typedebug-fully-readtreg_matches_sym_type_name sym %s sym_type_name %s std::string symbol_to_info_string(symbol*, int, search_domain)block == GLOBAL_BLOCK || block == STATIC_BLOCKvoid collect_symbol_completion_matches_type(completion_tracker&, const char*, const char*, type_code)code == TYPE_CODE_UNION || code == TYPE_CODE_STRUCT || code == TYPE_CODE_ENUMint register_symbol_computed_impl(address_class, const symbol_computed_ops*)aclass == LOC_COMPUTEDresult < MAX_SYMBOL_IMPLSops->tracepoint_var_ref != NULLops->describe_location != NULLops->get_symbol_read_needs != NULLops->read_variable != NULLint register_symbol_block_impl(address_class, const symbol_block_ops*)aclass == LOC_BLOCKops->find_frame_base_location != NULLint register_symbol_register_impl(address_class, const symbol_register_ops*)aclass == LOC_REGISTER || aclass == LOC_REGPARM_ADDRobjfile* symbol_objfile(const symbol*)SYMBOL_OBJFILE_OWNED (symbol)symtab* symbol_symtab(const symbol*) File %ps: %d: void symbol_set_symtab(symbol*, symtab*)CORE_ADDR get_msymbol_address(objfile*, const minimal_symbol*)minsym->maybe_copied(objf->flags & OBJF_MAINLINE) == 0CORE_ADDR get_symbol_address(const symbol*)SYMBOL_CLASS (sym) == LOC_STATICsymbol* fixup_symbol_section(symbol*, objfile*)objfile || symbol_symtab (sym)lookup_symbol_in_block (%s, %s (objfile %s), %s)lookup_symbol_in_static_block (%s, %s (objfile %s), %s) lookup_symbol_in_static_block (...) = %s block_symbol lookup_symbol_in_objfile_symtabs(objfile*, block_enum, const char*, domain_enum)block_index == GLOBAL_BLOCK || block_index == STATIC_BLOCKlookup_symbol_in_objfile_symtabs (%s, %s, %s, %s) (via quick fns)block_symbol lookup_symbol_in_objfile(objfile*, block_enum, const char*, domain_enum)lookup_symbol_in_objfile (%s, %s, %s, %s) lookup_symbol_in_objfile (...) = %s (in symtabs) lookup_symbol_via_quick_fns (%s, %s, %s, %s) lookup_symbol_via_quick_fns (...) = NULL lookup_symbol_via_quick_fns (...) = %s (block %s) lookup_symbol_in_objfile (...) = %s%s block_symbol lookup_global_symbol_from_objfile(objfile*, block_enum, const char*, domain_enum)int lookup_symbol_global_or_static_iterator_cb(objfile*, void*)data->result.symbol == NULL && data->result.block == NULLInfinite recursion detected in find_pc_sect_line;please file a bug reportbool completion_list_add_name(completion_tracker&, language, const char*, const lookup_name_info&, const char*, const char*)symname != NULLbool iterate_over_some_symtabs(const char*, const char*, compunit_symtab*, compunit_symtab*, gdb::function_view)IS_ABSOLUTE_PATH (real_path)IS_ABSOLUTE_PATH (name)partially-readvoid info_sources_worker(ui_out*, bool, const info_sources_filter&)group_by_objfile || uiout->is_mi_like_p ()debug-info(Full debug information has not yet been read for this file.) (Objfile has no debug information.) (not found)block_symbol lookup_global_or_static_symbol(const char*, block_enum, objfile*, domain_enum)objfile == nullptr || block_index == GLOBAL_BLOCK%s block symbol cache hit%s for %s, %s %s block symbol cache miss for %s, %s lookup_symbol_aux (%s, %s (objfile %s), %s, %s) lookup_symbol_aux (...) = %s Internal error: `%s' is not an aggregatelookup_symbol_aux (...) = NULL void iterate_over_symtabs(const char*, gdb::function_view)IS_ABSOLUTE_PATH (real_path.get ())You cannot give both -basename and -dirname to 'info sources'.Missing REGEXP for 'info sources'.std::vector global_symbol_searcher::search() constmismatched quoting on brackets, try 'operator\[\]'nothing is allowed between '[' and ']'`operator ()' must be specified without whitespace in `()'`operator ?:' must be specified without whitespace in `?:'`operator []' must be specified without whitespace in `[]'`operator %s' not supportedoperator%.*s%sm_kind == VARIABLES_DOMAIN || m_kind == FUNCTIONS_DOMAIN%s:'%s' %s; All %ss matching regular expression "%s" with type matching regular expression "%s": All %ss matching regular expression "%s": All defined %ss with type matching regular expression "%s" : All defined %ss: Non-debugging symbols: %ps %ps std::vector > search_module_symbols(const char*, const char*, const char*, search_domain)p.symbol != nullptrglobal and static variablesAll global and static variable names or those matching REGEXPs. Usage: info variables [-q] [-n] [-t TYPEREGEXP] [NAMEREGEXP] Prints the global and static variables. All global and static variable names, or those matching REGEXPs. Usage: whereis [-q] [-n] [-t TYPEREGEXP] [NAMEREGEXP] Prints the global and static variables. whereisAll function names or those matching REGEXPs. Usage: info functions [-q] [-n] [-t TYPEREGEXP] [NAMEREGEXP] Prints the functions. All type names, or those matching REGEXP. Usage: info types [-q] [REGEXP] Print information about all types matching REGEXP, or all types if no REGEXP is given. The optional flag -q disables printing of headers.All source files in the program or those matching REGEXP. Usage: info sources [OPTION]... [REGEXP] By default, REGEXP is used to match anywhere in the filename. Options: %OPTIONS%All module names, or those matching REGEXP.Print information about modules.Display functions arranged by modules. Usage: info module functions [-q] [-m MODREGEXP] [-t TYPEREGEXP] [REGEXP] Print a summary of all functions within each Fortran module, grouped by module and file. For each function the line on which the function is defined is given along with the type signature and name of the function. If REGEXP is provided then only functions whose name matches REGEXP are listed. If MODREGEXP is provided then only functions in modules matching MODREGEXP are listed. If TYPEREGEXP is given then only functions whose type signature matches TYPEREGEXP are listed. The -q flag suppresses printing some header information.Display variables arranged by modules. Usage: info module variables [-q] [-m MODREGEXP] [-t TYPEREGEXP] [REGEXP] Print a summary of all variables within each Fortran module, grouped by module and file. For each variable the line on which the variable is defined is given along with the type and name of the variable. If REGEXP is provided then only variables whose name matches REGEXP are listed. If MODREGEXP is provided then only variables in modules matching MODREGEXP are listed. If TYPEREGEXP is given then only variables whose type matches TYPEREGEXP are listed. The -q flag suppresses printing some header information.Set a breakpoint for all functions matching REGEXP.rbreakmultiple-symbolsValid values are "ask", "all", "cancel", and the default is "all".Show how the debugger handles ambiguities in expressions.Set how the debugger handles ambiguities in expressions.basenames-may-differ(A "base name" is the name of a file with the directory part removed. Example: The base name of "/home/user/hello.c" is "hello.c".) If set, GDB will canonicalize file names (e.g., expand symlinks) before comparing them. Canonicalization is an expensive operation, but it allows the same file be known by more than one base name. If not set (the default), all source files are assumed to have just one base name, and gdb will do file name comparisons more efficiently.Show whether a source file may have multiple base names.Set whether a source file may have multiple base names.symtab-createWhen enabled (non-zero), debugging messages are printed when building symbol tables. A value of 1 (one) normally provides enough information. A value greater than 1 provides more verbose information.Show debugging of symbol table creation.Set debugging of symbol table creation.When enabled (non-zero), symbol lookups are logged.Show debugging of symbol lookup.Set debugging of symbol lookup.symbol-cache-sizeThe size of the symbol cache. If zero then the symbol cache is disabled.Show the size of the symbol cache.Set the size of the symbol cache.Dump the symbol cache for each program space.Print symbol cache statistics for each program space.symbol-cache-statisticsFlush the symbol cache for each program space.flush-symbol-cachemaintenancelist flush symbol-cacheAll variables in all modules:All functions in all modules:All variables matching regular expression "%s" in all modules:All functions matching regular expression "%s" in all modules:All variables with type matching regular expression "%s" in all modules:All functions with type matching regular expression "%s" in all modules:All variables matching regular expression "%s", with type matching regular expression "%s" in all modules:All functions matching regular expression "%s", with type matching regular expression "%s" in all modules:All variables in all modules matching regular expression "%s":All functions in all modules matching regular expression "%s":All variables matching regular expression "%s", in all modules matching regular expression "%s":All functions matching regular expression "%s", in all modules matching regular expression "%s":All variables with type matching regular expression "%s" in all modules matching regular expression "%s":All functions with type matching regular expression "%s" in all modules matching regular expression "%s":All variables matching regular expression "%s", with type matching regular expression "%s", in all modules matching regular expression "%s":All functions matching regular expression "%s", with type matching regular expression "%s", in all modules matching regular expression "%s":void info_module_subcommand(bool, const char*, const char*, const char*, search_domain)q.symbol != nullptrModule "%s": Show only the files having a dirname matching REGEXP.Show only the files having a basename matching REGEXP.VARIABLES_DOMAINTYPES_DOMAINMODULES_DOMAINUNDEF_DOMAINVAR_DOMAINSTRUCT_DOMAINMODULE_DOMAINLABEL_DOMAINCOMMON_BLOCK_DOMAINARM C Compiler, ADSThumb C Compiler, ADSARM C++ Compiler, ADSThumb C++ Compiler, ADSARM/Thumb C/C++ Compiler, RVCTARM C/C++ Compiler, RVCTglobal_symbol_searcher::global_symbol_searcher(search_domain, const char*)../../gdb/symtab.hm_kind != ALL_DOMAIN:R&:R1:R?:RM:RZ:R9R"R9R :Rf;Rn:R:R:R:R:R:RmSN-PXH;R;R;RcancelallaskTarget connections in use. Shows the list of target connections currently in use.connectionsNo connections. Cache use for code accesses is %s. Cache use for stack accesses is %s. The dcache was flushed. stack-cacheWhen on, use the target memory cache for all stack access, regardless of any configured memory regions. This improves remote performance significantly. By default, caching for stack access is on.Show cache use for stack access.Set cache use for stack access.code-cacheWhen on, use the target memory cache for all code segment accesses, regardless of any configured memory regions. This improves remote performance significantly. By default, caching for code segment access is on.Show cache use for code segment access.Set cache use for code segment access.Force gdb to flush its target memory data cache. The dcache caches all target memory accesses where possible, this includes the stack-cache and the code-cache. Original: %s */ #include "gdbsupport/tdesc.h" tdesc_%s = result.release (); tdesc_type *element_type; element_type = tdesc_named_type (feature, "%s"); tdesc_create_vector (feature, "%s", element_type, %d); tdesc_create_reg (feature, "%s", %ld, %d, "%s", NULL, return regnum; feature = tdesc_create_feature (result.get (), "%s"); #include "defs.h" #include "osabi.h" #include "target-descriptions.h" struct target_desc *tdesc_%s; static void initialize_tdesc_%s (void) target_desc_up result = allocate_target_description (); set_tdesc_architecture (result.get (), bfd_scan_arch ("%s")); set_tdesc_osabi (result.get (), osabi_from_tdesc_string ("%s")); tdesc_add_compatible (result.get (), bfd_scan_arch ("%s")); set_tdesc_property (result.get (), "%s", "%s"); struct tdesc_feature *feature; C output is not supported type "%s".ERROR: "regnum" attribute %ld is not the largest number (%d). "regnum" attribute %ld is not the largest number (%d). regnum = %ld; tdesc_create_reg (feature, "%s", regnum++, %d, The target description will be read from "%s". The target description will be read from the target. There is no target description to print.const char* tdesc_register_name(gdbarch*, int)../../gdb/target-descriptions.cdata->pseudo_register_name != NULLtype* tdesc_register_type(gdbarch*, int)data->pseudo_register_type != NULLRegister "%s" has an unsupported size (%d bits)Register "%s" has an unknown type "%s"Could not remove target-supplied descriptionvoid target_find_description()gdbarch_target_desc (target_gdbarch ()) == NULLArchitecture rejected target-supplied descriptionTarget-supplied registers are not supported by the current architecturevoid make_gdb_type(gdbarch*, tdesc_type*)::gdb_type_creator::make_gdb_type_struct(const tdesc_type_with_fields*)e->size != 0f.start == -1 && f.end == -1void make_gdb_type(gdbarch*, tdesc_type*)::gdb_type_creator::make_gdb_type_flags(const tdesc_type_with_fields*)f.type != NULLType "%s" has an unknown kind %dbuiltin_type_ieee_halfbuiltin_type_ieee_singlebuiltin_type_ieee_doublebuiltin_type_i387_extbuiltin_type_bfloat16int tdesc_register_bitsize(const tdesc_feature*, const char*)Set target description specific variables.Show target description specific variables.Unset target description specific variables.When set, GDB will read the target description from a local file instead of querying the remote target.Show the file to read for an XML target description.Set the file to read for an XML target description.Unset the file to read for an XML target description. When unset, GDB will read the description from the target.Print the current target description as a C source file. Usage: maintenance print c-tdesc [OPTION] [FILENAME] Options: %OPTIONS% When FILENAME is not provided then print the current target description, otherwise an XML target description is read from FILENAME and printed as a C function. When '-single-feature' is used then the target description should contain a single feature and the generated C code will only create that feature within an already existing target_desc object.c-tdescPrint the current target description as an XML file.xml-tdescCheck equality of GDB target descriptions and XML created descriptions. Check the target descriptions created in GDB equal the descriptions created from XML files in the directory. The parameter is the directory name.xml-descriptionsCould not convert description for %s to xml. Could not convert description for %s from xml. Converted description for %s does not match. Missing dir nameDescriptions for %s do not match. Tested %lu XML files, %d failed fetched from target/features/only target descriptions with 1 feature can be used with -single-feature optionvoid tdesc_use_registers(gdbarch*, const target_desc*, tdesc_arch_data_up&&, tdesc_unknown_register_ftype)tdesc_has_registers (target_desc)data->arch_regs.size () <= num_regsregno == -1 || regno >= num_regsdata->arch_regs.size () == num_regsAttempted to add duplicate compatible architecture "%s"void set_tdesc_property(target_desc*, const char*, const char*)key != NULL && value != NULLAttempted to add duplicate property "%s"single-featurePrint C description of just a single feature.static int create_feature_%s (struct target_desc *result, long regnum) feature = tdesc_create_feature (result, "%s"); /* THIS FILE IS GENERATED. -*- buffer-read-only: t -*- vi:set ro: tdesc_type *field_type; field_type = tdesc_type_with_fields *type_with_fields; type_with_fields = tdesc_create_struct (feature, "%s"); tdesc_set_struct_size (type_with_fields, %d); type_with_fields = tdesc_create_flags (feature, "%s", %d); virtual void print_c_tdesc::visit(const tdesc_type_with_fields*)f.end != -1f.start == f.end tdesc_add_flag (type_with_fields, %d, "%s"); tdesc_add_bitfield (type_with_fields, "%s", %d, %d); tdesc_add_typed_bitfield (type_with_fields, "%s", %d, %d, field_type); tdesc_add_field (type_with_fields, "%s", field_type); type_with_fields = tdesc_create_union (feature, "%s"); type_with_fields = tdesc_create_enum (feature, "%s", %d); tdesc_add_enum_value (type_with_fields, %d, "%s"); 21tdesc_element_visitor^%TR13tdesc_element^HTR11target_desc^`TRXTR13print_c_tdesc^|TR@TR15print_c_feature^TRTRpTRv'''TRw'v'w'dv' y'v'}',w'TRlv'hv'Pz'w' y'v'}'4y'DURu'u'u'v'_'|_'['v'^PUR@TR*ZL13make_gdb_typeP7gdbarchP10tdesc_typeE16gdb_type_creatorfloatformat_byteorders floatformat_normalize_byteorder(const floatformat*, const void*, void*)../../gdb/target-float.cfmt->byteorder == floatformat_littlebyte_bigwordlong unsigned int get_field(const bfd_byte*, floatformat_byteorders, unsigned int, unsigned int, unsigned int)order == floatformat_little || order == floatformat_bigint floatformat_is_negative(const floatformat*, const bfd_byte*)fmt != NULLfmt->totalsize <= FLOATFORMAT_LARGEST_BYTES * FLOATFORMAT_CHAR_BITfloat_kind floatformat_classify(const floatformat*, const bfd_byte*)void match_endianness(const gdb_byte*, const type*, gdb_byte*)type->code () == TYPE_CODE_DECFLOATUnknown decimal floating point type.void set_decnumber_context(decContext*, const type*)Cannot perform operation: %sConversion of large integer to a decimal floating type is not supported.Operation not valid for decimal floating point number.Comparison with an invalid number (NaN).const target_float_ops* get_target_float_ops(target_float_ops_kind)unexpected target_float_ops_kindtarget_float_ops_kind get_target_float_ops_kind(const type*)unexpected type codeconst target_float_ops* get_target_float_ops(const type*, const type*)type1->code () == type2->code ()%%.%dstd::string floatformat_printf_format(const floatformat*, const char*, char)len > 1conversion == 'e' || conversion == 'f' || conversion == 'g' || conversion == 'E' || conversion == 'G'bool target_float_is_valid(const gdb_byte*, const type*)bool target_float_is_zero(const gdb_byte*, const type*)void target_float_binop(exp_opcode, const gdb_byte*, const type*, const gdb_byte*, const type*, gdb_byte*, const type*)target_float_same_category_p (type_x, type_res)target_float_same_category_p (type_y, type_res)int target_float_compare(const gdb_byte*, const type*, const gdb_byte*, const type*)target_float_same_category_p (type_x, type_y)const char* floatformat_mantissa(const floatformat*, const bfd_byte*)sizeof res > ((fmt->man_len + 7) / 8) * 2len + strlen (buf) <= sizeof res%snan(0x%s)%sinfbool target_float_same_format_p(const type*, const type*)int target_float_format_length(const type*)virtual double decimal_float_ops::to_host_double(const gdb_byte*, const type*) constinvalid operation on decimal floatvirtual void decimal_float_ops::from_host_double(gdb_byte*, const type*, double) constvoid host_float_ops::to_target(const floatformat*, const T*, gdb_byte*) const [with T = float; gdb_byte = unsigned char]void host_float_ops::from_target(const floatformat*, const gdb_byte*, T*) const [with T = float; gdb_byte = unsigned char]void host_float_ops::to_target(const floatformat*, const T*, gdb_byte*) const [with T = double; gdb_byte = unsigned char]void host_float_ops::from_target(const floatformat*, const gdb_byte*, T*) const [with T = double; gdb_byte = unsigned char]void host_float_ops::to_target(const floatformat*, const T*, gdb_byte*) const [with T = long double; gdb_byte = unsigned char]void host_float_ops::from_target(const floatformat*, const gdb_byte*, T*) const [with T = long double; gdb_byte = unsigned char]Cannot perform exponentiation: %sInteger-only operation on floating point number.g%n16target_float_ops^!bR14host_float_opsIfE^&, flash_preserve_mode, void (*)(ULONGEST, void*))../../gdb/target-memory.citer.end != 0void block_boundaries(CORE_ADDR, CORE_ADDR*, CORE_ADDR*)region->attrib.mode == MEM_FLASHiter.data == NULLError writing data to flashvirtual void target_ops::attach(const char*, int)../../gdb/target.ctarget_ops::attach calledvirtual void target_ops::create_inferior(const char*, const string&, char**, int)target_ops::create_inferior calledcould not find a target to follow forkDon't know how to %s. Try "help target"."monitor" command not supported by this target.Command not implemented for this target.Writing to flash memory forbidden in this contextNo saved terminal information. Cannot find thread-local variables on this targetWhether GDB may automatically connect to the native target is %s. Controlling the inferior in asynchronous mode is %s. Mode for reading from readonly sections is %s. Target debugging is %s. Whether the target is always in non-stop mode is %s (currently %s). Whether the target is always in non-stop mode is %s. file I/Ocould not find a target to follow mourn inferiorYou can't do that when your target is `%s'exec_direction_kind default_execution_direction(target_ops*)to_execution_direction must be implemented for reverse asyncTARGET_XFER_E_IOTARGET_XFER_UNAVAILABLEMay not insert breakpointsMay not remove breakpointsptid_t target_wait(ptid_t, target_waitstatus*, target_wait_flags)(options & TARGET_WNOHANG) == 0Cannot find thread-local variables in this thread library.Cannot find shared library `%s' in dynamic linker's load module listCannot find executable file `%s' in dynamic linker's load module listThe inferior has not yet allocated storage for thread-local variables in the shared library `%s' for %sThe inferior has not yet allocated storage for thread-local variables in the executable `%s' for %sCannot find thread-local storage for %s, shared library %s: %sCannot find thread-local storage for %s, executable file %s: %sconst char* target_thread_name(thread_info*)info->inf == current_inferior ()void target_resume(ptid_t, int, gdb_signal)!curr_target->commit_resumed_statevoid target_commit_resumed()current_inferior ()->process_target ()->commit_resumed_statevoid target_mourn_inferior(ptid_t)ptid.pid () == inferior_ptid.pid ()native target already set ("%s").address_space* target_thread_address_space(ptid_t)aspace != NULLtarget_fileio_pwrite (%d,...,%d,%s) = %d (%d) target_fileio_pread (%d,...,%d,%s) = %d (%d) target_fileio_fstat (%d) = %d (%d) target_fileio_close (%d) = %d (%d) The "%s" target does not support "run". Try "help target" or "continue".No targets found-> %s->post_attach (...) <- %s->post_attach (-> %s->detach (...) <- %s->detach (-> %s->disconnect (...) <- %s->disconnect (-> %s->resume (...) <- %s->resume (-> %s->commit_resumed (...) <- %s->commit_resumed (-> %s->fetch_registers (...) <- %s->fetch_registers (-> %s->store_registers (...) <- %s->store_registers (-> %s->prepare_to_store (...) <- %s->prepare_to_store (-> %s->files_info (...) <- %s->files_info (-> %s->insert_breakpoint (...) <- %s->insert_breakpoint () = -> %s->remove_breakpoint (...) <- %s->remove_breakpoint (-> %s->stopped_by_sw_breakpoint (...) <- %s->stopped_by_sw_breakpoint (-> %s->supports_stopped_by_sw_breakpoint (...) <- %s->supports_stopped_by_sw_breakpoint (-> %s->stopped_by_hw_breakpoint (...) <- %s->stopped_by_hw_breakpoint (-> %s->supports_stopped_by_hw_breakpoint (...) <- %s->supports_stopped_by_hw_breakpoint (-> %s->can_use_hw_breakpoint (...) <- %s->can_use_hw_breakpoint (-> %s->ranged_break_num_registers (...) <- %s->ranged_break_num_registers (-> %s->insert_hw_breakpoint (...) <- %s->insert_hw_breakpoint (-> %s->remove_hw_breakpoint (...) <- %s->remove_hw_breakpoint (-> %s->remove_watchpoint (...) <- %s->remove_watchpoint (-> %s->insert_watchpoint (...) <- %s->insert_watchpoint (-> %s->insert_mask_watchpoint (...) <- %s->insert_mask_watchpoint (-> %s->remove_mask_watchpoint (...) <- %s->remove_mask_watchpoint (-> %s->stopped_by_watchpoint (...) <- %s->stopped_by_watchpoint (-> %s->have_steppable_watchpoint (...) <- %s->have_steppable_watchpoint (-> %s->stopped_data_address (...) <- %s->stopped_data_address (-> %s->watchpoint_addr_within_range (...) <- %s->watchpoint_addr_within_range (-> %s->region_ok_for_hw_watchpoint (...) <- %s->region_ok_for_hw_watchpoint (-> %s->can_accel_watchpoint_condition (...) <- %s->can_accel_watchpoint_condition (-> %s->masked_watch_num_registers (...) <- %s->masked_watch_num_registers (-> %s->can_do_single_step (...) <- %s->can_do_single_step (-> %s->supports_terminal_ours (...) <- %s->supports_terminal_ours (-> %s->terminal_init (...) <- %s->terminal_init (-> %s->terminal_inferior (...) <- %s->terminal_inferior (-> %s->terminal_save_inferior (...) <- %s->terminal_save_inferior (-> %s->terminal_ours_for_output (...) <- %s->terminal_ours_for_output (-> %s->terminal_ours (...) <- %s->terminal_ours (-> %s->terminal_info (...) <- %s->terminal_info (-> %s->kill (...) <- %s->kill (-> %s->load (...) <- %s->load (-> %s->post_startup_inferior (...) <- %s->post_startup_inferior (-> %s->insert_fork_catchpoint (...) <- %s->insert_fork_catchpoint (-> %s->remove_fork_catchpoint (...) <- %s->remove_fork_catchpoint (-> %s->insert_vfork_catchpoint (...) <- %s->insert_vfork_catchpoint (-> %s->remove_vfork_catchpoint (...) <- %s->remove_vfork_catchpoint (-> %s->follow_fork (...) <- %s->follow_fork (-> %s->insert_exec_catchpoint (...) <- %s->insert_exec_catchpoint (-> %s->remove_exec_catchpoint (...) <- %s->remove_exec_catchpoint (-> %s->follow_exec (...) <- %s->follow_exec (-> %s->mourn_inferior (...) <- %s->mourn_inferior (-> %s->thread_alive (...) <- %s->thread_alive (-> %s->update_thread_list (...) <- %s->update_thread_list (-> %s->extra_thread_info (...) <- %s->extra_thread_info (-> %s->thread_name (...) <- %s->thread_name (-> %s->thread_handle_to_thread_info (...) <- %s->thread_handle_to_thread_info (-> %s->stop (...) <- %s->stop (-> %s->interrupt (...) <- %s->interrupt (-> %s->pass_ctrlc (...) <- %s->pass_ctrlc (-> %s->rcmd (...) <- %s->rcmd (-> %s->pid_to_exec_file (...) <- %s->pid_to_exec_file (-> %s->log_command (...) <- %s->log_command (-> %s->get_section_table (...) <- %s->get_section_table (-> %s->get_thread_control_capabilities (...) <- %s->get_thread_control_capabilities (-> %s->attach_no_wait (...) <- %s->attach_no_wait (-> %s->can_async_p (...) <- %s->can_async_p (-> %s->is_async_p (...) <- %s->is_async_p (-> %s->async (...) <- %s->async (-> %s->async_wait_fd (...) <- %s->async_wait_fd (-> %s->has_pending_events (...) <- %s->has_pending_events (-> %s->thread_events (...) <- %s->thread_events (-> %s->supports_non_stop (...) <- %s->supports_non_stop (-> %s->always_non_stop_p (...) <- %s->always_non_stop_p (-> %s->find_memory_regions (...) <- %s->find_memory_regions (-> %s->get_bookmark (...) <- %s->get_bookmark (-> %s->goto_bookmark (...) <- %s->goto_bookmark (-> %s->get_thread_local_address (...) <- %s->get_thread_local_address (-> %s->xfer_partial (...) <- %s->xfer_partial (-> %s->get_memory_xfer_limit (...) <- %s->get_memory_xfer_limit (-> %s->flash_erase (...) <- %s->flash_erase (-> %s->flash_done (...) <- %s->flash_done (-> %s->read_description (...) <- %s->read_description (-> %s->get_ada_task_ptid (...) <- %s->get_ada_task_ptid (-> %s->auxv_parse (...) <- %s->auxv_parse (-> %s->search_memory (...) <- %s->search_memory (-> %s->can_execute_reverse (...) <- %s->can_execute_reverse (-> %s->execution_direction (...) <- %s->execution_direction (-> %s->supports_multi_process (...) <- %s->supports_multi_process (-> %s->supports_enable_disable_tracepoint (...) <- %s->supports_enable_disable_tracepoint (-> %s->supports_disable_randomization (...) <- %s->supports_disable_randomization (-> %s->supports_string_tracing (...) <- %s->supports_string_tracing (-> %s->supports_evaluation_of_breakpoint_conditions (...) <- %s->supports_evaluation_of_breakpoint_conditions (-> %s->supports_dumpcore (...) <- %s->supports_dumpcore (-> %s->dumpcore (...) <- %s->dumpcore (-> %s->can_run_breakpoint_commands (...) <- %s->can_run_breakpoint_commands (-> %s->thread_architecture (...) <- %s->thread_architecture (-> %s->thread_address_space (...) <- %s->thread_address_space (-> %s->filesystem_is_local (...) <- %s->filesystem_is_local (-> %s->trace_init (...) <- %s->trace_init (-> %s->download_tracepoint (...) <- %s->download_tracepoint (-> %s->can_download_tracepoint (...) <- %s->can_download_tracepoint (-> %s->download_trace_state_variable (...) <- %s->download_trace_state_variable (-> %s->enable_tracepoint (...) <- %s->enable_tracepoint (-> %s->disable_tracepoint (...) <- %s->disable_tracepoint (-> %s->trace_set_readonly_regions (...) <- %s->trace_set_readonly_regions (-> %s->trace_start (...) <- %s->trace_start (-> %s->get_trace_status (...) <- %s->get_trace_status (-> %s->get_tracepoint_status (...) <- %s->get_tracepoint_status (-> %s->trace_stop (...) <- %s->trace_stop (-> %s->trace_find (...) <- %s->trace_find (-> %s->get_trace_state_variable_value (...) <- %s->get_trace_state_variable_value (-> %s->save_trace_data (...) <- %s->save_trace_data (-> %s->upload_tracepoints (...) <- %s->upload_tracepoints (-> %s->upload_trace_state_variables (...) <- %s->upload_trace_state_variables (-> %s->get_raw_trace_data (...) <- %s->get_raw_trace_data (-> %s->get_min_fast_tracepoint_insn_len (...) <- %s->get_min_fast_tracepoint_insn_len (-> %s->set_disconnected_tracing (...) <- %s->set_disconnected_tracing (-> %s->set_circular_trace_buffer (...) <- %s->set_circular_trace_buffer (-> %s->set_trace_buffer_size (...) <- %s->set_trace_buffer_size (-> %s->set_trace_notes (...) <- %s->set_trace_notes (-> %s->core_of_thread (...) <- %s->core_of_thread (-> %s->verify_memory (...) <- %s->verify_memory (-> %s->get_tib_address (...) <- %s->get_tib_address (-> %s->set_permissions (...) <- %s->set_permissions (-> %s->static_tracepoint_marker_at (...) <- %s->static_tracepoint_marker_at (-> %s->use_agent (...) <- %s->use_agent (-> %s->can_use_agent (...) <- %s->can_use_agent (-> %s->enable_btrace (...) <- %s->enable_btrace (-> %s->disable_btrace (...) <- %s->disable_btrace (-> %s->teardown_btrace (...) <- %s->teardown_btrace (-> %s->read_btrace (...) <- %s->read_btrace (-> %s->btrace_conf (...) <- %s->btrace_conf (-> %s->record_method (...) <- %s->record_method (-> %s->stop_recording (...) <- %s->stop_recording (-> %s->info_record (...) <- %s->info_record (-> %s->save_record (...) <- %s->save_record (-> %s->supports_delete_record (...) <- %s->supports_delete_record (-> %s->delete_record (...) <- %s->delete_record (-> %s->record_is_replaying (...) <- %s->record_is_replaying (-> %s->record_will_replay (...) <- %s->record_will_replay (-> %s->record_stop_replaying (...) <- %s->record_stop_replaying (-> %s->goto_record_begin (...) <- %s->goto_record_begin (-> %s->goto_record_end (...) <- %s->goto_record_end (-> %s->goto_record (...) <- %s->goto_record (-> %s->augmented_libraries_svr4_read (...) <- %s->augmented_libraries_svr4_read (-> %s->get_unwinder (...) <- %s->get_unwinder (-> %s->get_tailcall_unwinder (...) <- %s->get_tailcall_unwinder (-> %s->prepare_to_generate_core (...) <- %s->prepare_to_generate_core (-> %s->done_generating_core (...) <- %s->done_generating_core (-> %s->supports_memory_tagging (...) <- %s->supports_memory_tagging (The current target stack is: - %s (%s) Symbols from "%s". While running this, GDB does not access memory from... target_info_proc ("%s", %d) target_fileio_unlink (%d,%s) = %d (%d) -> %s->insn_history (...) <- %s->insn_history (-> %s->insn_history_from (...) <- %s->insn_history_from (-> %s->insn_history_range (...) <- %s->insn_history_range (-> %s->call_history (...) <- %s->call_history (-> %s->call_history_from (...) <- %s->call_history_from (-> %s->call_history_range (...) <- %s->call_history_range (-> %s->fetch_memtags (...) <- %s->fetch_memtags (-> %s->store_memtags (...) <- %s->store_memtags (-> %s->set_syscall_catchpoint (...) <- %s->set_syscall_catchpoint (-> %s->pass_signals (...) <- %s->pass_signals (-> %s->program_signals (...) <- %s->program_signals (-> %s->make_corefile_notes (...) <- %s->make_corefile_notes (-> %s->pid_to_str (...) <- %s->pid_to_str (Detaching from program: %s, %s void target_close(target_ops*)!inf->target_is_pushed (targ)target_close () bool target_stack::unpush(target_ops*)Attempt to unpush the dummy targetpop_all_targets couldn't find target %s void target_detach(inferior*, int)Program not killed.void target_stop(ptid_t)May not interrupt or stop the target, ignoring attemptTARGET_WNOHANG-> %s->wait (...) <- %s->wait (target_fetch_registersWriting to registers is not allowed (regno %d)target_store_registersWhen non-zero, target debugging is enabled. Higher numbers are more verbose.Show target debugging.Set target debugging.trust-readonly-sectionsWhen this mode is on, memory reads from readonly sections (such as .text) will be read from the object file instead of from the target. This will result in significant performance improvement for remote targets.Show mode for reading from readonly sections.Set mode for reading from readonly sections.Send a command to the remote monitor (remote targets only).monitorPrint the name of each layer of the internal target stack.target-stackTells gdb whether to control the inferior in asynchronous mode.Show whether gdb controls the inferior in asynchronous mode.Set whether gdb controls the inferior in asynchronous mode.target-non-stopTells gdb whether to control the inferior in non-stop mode.Show whether gdb always controls the inferior in non-stop mode.Set whether gdb always controls the inferior in non-stop mode.may-write-registersWhen this permission is on, GDB may write into the target's registers. Otherwise, any sort of write attempt will result in an error.Show permission to write into registers.Set permission to write into registers.may-write-memoryWhen this permission is on, GDB may write into the target's memory. Otherwise, any sort of write attempt will result in an error.Show permission to write into target memory.Set permission to write into target memory.may-insert-breakpointsWhen this permission is on, GDB may insert breakpoints in the program. Otherwise, any sort of insertion attempt will result in an error.Show permission to insert breakpoints in the target.Set permission to insert breakpoints in the target.may-insert-tracepointsWhen this permission is on, GDB may insert tracepoints in the program. Otherwise, any sort of insertion attempt will result in an error.Show permission to insert tracepoints in the target.Set permission to insert tracepoints in the target.may-insert-fast-tracepointsWhen this permission is on, GDB may insert fast tracepoints. Otherwise, any sort of insertion attempt will result in an error.Show permission to insert fast tracepoints in the target.Set permission to insert fast tracepoints in the target.may-interruptWhen this permission is on, GDB may interrupt/stop the target's execution. Otherwise, any attempt to interrupt or stop will be ignored.Show permission to interrupt or signal the target.Set permission to interrupt or signal the target.Erase all flash memory regions.auto-connect-native-targetWhen on, and GDB is not connected to a target yet, GDB attempts "run" and other commands with the native target.Show whether GDB may automatically connect to the native target.Set whether GDB may automatically connect to the native target.Writing to memory is not allowed (addr %s, len %s)%s:target_xfer_partial (%d, %s, %s, %s, %s, %s) = %d, %s, bytes =target_xfer_status target_xfer_partial(target_ops*, target_object, const char*, gdb_byte*, const gdb_byte*, ULONGEST, ULONGEST, ULONGEST*)*xfered_len > 0ULONGEST get_target_memory_unsigned(target_ops*, CORE_ADDR, int, bfd_endian)len <= sizeof (buf)-> %s->thread_info_to_thread_handle (...) <- %s->thread_info_to_thread_handle (-> %s->static_tracepoint_markers_by_strid (...) <- %s->static_tracepoint_markers_by_strid (-> %s->traceframe_info (...) <- %s->traceframe_info (-> %s->memory_map (...) <- %s->memory_map (target_fileio_readlink (%d,%s) = %s (%d) std::vector read_memory_robust(target_ops*, ULONGEST, LONGEST)gdb::optional > > target_read_alloc_1(target_ops*, target_object, const char*) [with T = unsigned char]object != TARGET_OBJECT_MEMORYint acquire_fileio_fd(target_ops*, int)!fileio_fhandles[lowest_closed_fd].is_closed ()target_fileio_open (%d,%s,0x%x,0%o,%d) = %d (%d) target file %s contained unexpected null characters-> %s->open (...) <- %s->open (%s, %d) target already added ("%s").Connect to a target machine or process. The first argument is the type or protocol of the target machine. Remaining arguments are interpreted by the target protocol. For more information on the arguments for a particular protocol, type `help target ' followed by the protocol name.(none)gdb::optional > > target_read_alloc_1(target_ops*, target_object, const char*) [with T = char]target object %d, annex %s, contained unexpected null charactersget OS dataOverlapping regions in memory map: ignoringerased-regionsErasing flash memory region at address , size = No flash memory regions found. None2R2R!gYR'))( '$''|(P(\((((((((((D($ (!(!("(X$(@%(&('()(+(8-(.(/(0(1(P3(4(6(7(8(9(,:(:(d;(<(<(=(X>($''l?(@@(HA(PB(XC(hD(tE(|F(G(<(H($'0($(I(J(|(K(L(N(p(O(P(PQ(Q(S(T(T(y yyy$yU(xV(XW(8X( Y(Y(Z([(h\(H](8^(ܿ(_(4a(Tb((d(pf((g(h(ti(j(($''@?( @((A(0B(8C(@D(TE(\F(dG((H($'((I(J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T(y yyy$yU(`V(@W( X(Y(Y(Z([(P\(0](^(T_(_( a(b(c(Xf(8g(g(h(\i(0j(l(m(o(p(q(r(ds(Dt($u(v(v(w(x(y(z(,'@'@'T'd't'''{(D|( }(}(~(|(D((|((($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(|R')0)' '$''''|'' '''' ' '('0'$'$'$'$'''''''''$'$'''X''''$' ' ' ' ' ''8'|'$''$'8'8'8'8'H'8'8'@'T'0'$'\'\'p' ''''''$' '(''''y yyy$y'$'$'$''@'$''$'$''''|'''''''''''$'8'$'$''$'$'$''$' ' '$','@'@'T'd't'''''$'''''','''4'<''D'D'''''L'P'X'4(' 'p''''$''''''x' ' ''$''p'' '''' '''$','4'$''' ' '$'<'<'status->kind = %sexited, status = %d%sstopped, signal = %s%ssignalled, signal = %s%sloaded%sforked%svforked%sexecd%svfork-done%sentered syscall%sexited syscall%sspurious%signore%sno-history%sno-resumed%sthread created%sthread exited, status = %d%sunknown???Requested thread not found in requested processPrinting of thread events is %s. bool thread_alive(thread_info*)../../gdb/thread.ctp->inf == current_inferior ()%s "%s" (%s)%s "%s"thread_info* inferior_thread()current_thread_ != nullptrNo thread selectedvoid thread_step_over_chain_remove(thread_info**, thread_info*)tp->step_over_next != NULLtp->step_over_prev != NULLint thread_step_over_chain_length(thread_info*)enqueueing thread %s in global step over chainglobal_thread_step_over_chain_enqueuevoid step_over_chain_enqueue(thread_info**, thread_info*)tp->step_over_next == NULLtp->step_over_prev == NULLvoid global_thread_step_over_chain_enqueue_chain(thread_info*)chain_head->step_over_next != nullptrchain_head->step_over_prev != nullptrremoving thread %s from global step over chainglobal_thread_step_over_chain_removebool value_in_thread_stack_temporaries(value*, thread_info*)tp != NULL && tp->stack_temporaries_enabledvalue* get_last_thread_stack_temporary(thread_info*)No thread selected.The current thread has terminatedvoid switch_to_thread(thread_info*)thr != NULLvoid thr_try_catch_cmd(thread_info*, const char*, int, const qcs_flags&)is_current_thread (thr) Thread %s (%s): new-thread-id[Switching to thread )](running) Display currently known threads. Usage: info threads [OPTION]... [ID]... If ID is given, it is a space-separated list of IDs of threads to display. Otherwise, all threads are displayed. Options: %OPTIONS%Use this command to switch between threads. The new thread ID must be currently known.Apply a command to a list of threads. Usage: thread apply ID... [OPTION]... COMMAND ID is a space-separated list of IDs of threads to apply COMMAND on. Prints per-inferior thread number and target system's thread id followed by COMMAND output. By default, an error raised during the execution of COMMAND aborts "thread apply". Options: %OPTIONS%Apply a command to all threads. Usage: thread apply all [OPTION]... COMMAND Prints per-inferior thread number and target system's thread id followed by COMMAND output. By default, an error raised during the execution of COMMAND aborts "thread apply". Options: %OPTIONS%Apply a command to all threads (ignoring errors and empty output). Usage: taas [OPTION]... COMMAND shortcut for 'thread apply all -s [OPTION]... COMMAND' See "help thread apply all" for available options.taasApply a command to all frames of all threads (ignoring errors and empty output). Usage: tfaas [OPTION]... COMMAND shortcut for 'thread apply all -s -- frame apply all -s [OPTION]... COMMAND' See "help frame apply all" for available options.tfaasSet the current thread's name. Usage: thread name [NAME] If NAME is not given, then any existing name is removed.Find threads that match a regular expression. Usage: thread find REGEXP Will display thread ids whose name, target ID, or extra info matches REGEXP.Show printing of thread events (such as thread start and exit).Set printing of thread events (such as thread start and exit)._gthreadPlease specify a command to apply on all frames of all threadsthread apply all -s -- frame apply all -s Please specify a command to apply on all threadsthread apply all -s thread_info::thread_info(inferior*, ptid_t)inf_ != NULLPlease specify a thread ID listthread applyPlease specify a command following the thread ID listUnknown inferior %dUnknown thread %d.%dUnknown thread %dThread %s has terminated.void delete_thread_1(thread_info*, bool)thr != nullptrThread ID %s has terminated.[Current thread is %s (%s) (exited)] [Current thread is %s (%s)] thread_info* any_thread_of_inferior(inferior*)Thread %s has name '%s' Thread %s has target name '%s' Thread %s has target id '%s' Thread %s has extra info '%s' No threads match '%s' thread_info* any_live_thread_of_inferior(inferior*)inf != NULL && inf->pid != 0thread_info* find_thread_ptid(inferior*, ptid_t)thread_info* add_thread_silent(process_stratum_target*, ptid_t)targ != nullptrthread_info* new_thread(inferior*, ptid_t)ptid != last->ptid || last->state == THREAD_EXITED[New %s] void push_thread_stack_temporary(thread_info*, value*)No threads. No threads match '%s'. id-in-tgGIdTarget IdFramedetails The current thread has terminated. See `help thread'. No selected thread. See `help thread'. thread apply allPlease specify a command at the end of 'thread apply all'void thread_apply_all_command(const char*, int)thr_list_cpy.size () == tcShow global thread IDs.ascendingCall COMMAND for all threads in ascending order. The default is descending order.Disables printing the thread information.))Invalid thread ID: %snegative value: %sNo inferior number '%d'Unknown thread %d.Unknown thread %d.%d.bool tid_range_parser::finished() const../../gdb/tid-parse.cunhandled stateconst char* tid_range_parser::cur_tok() constvoid tid_range_parser::skip_range()m_state == STATE_THREAD_RANGE || m_state == STATE_STAR_RANGEbool tid_range_parser::get_tid_range(int*, int*, int*)inf_num != NULL && thr_start != NULL && thr_end != NULLbool tid_range_parser::get_tid(int*, int*)inf_num != NULL && thr_num != NULLWhether to start up quietly is %s. Notification of completion for asynchronous execution commands is %s. Annotation_level is %s. Whether to confirm potentially dangerous operations is %s. The number of history entries to look back at for duplicates is %s. The size of the command history is %s. Saving of the history record on exit is %s. Saving of the history is disabled due to the value of 'history filename'. Editing of command lines as they are typed is %s. Gdb's prompt is "%s". GDB's data directory is "%ps". void set_readline_history_size(int)../../gdb/top.chistory_size >= -1void gdb_readline_wrapper_line(gdb::unique_xmalloc_ptr&&)!gdb_readline_wrapper_doneThe filename in which to record the command history is "%ps". There is no filename currently set for recording the command history in. ui::~ui()sync wait"%s" must be followed by the name of a subcommand. That is not a command, just a help topic.void execute_command(const char*, int)strlen (args_pointer) >= strlen (repeat_arguments)Usage: new-ui INTERPRETER TTYopening terminal failedw+New UI allocated No previous command to relaunchchar* gdb_readline_wrapper(const char*)after_char_processing_hook == NULL(GDB) GNU gdb %s%sCopyright (C) 2022 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Type "show copying" and "show warranty" for details. This GDB was configured as "--host=%s --target=%sType "show configuration" for configuration details. For bug reporting instructions, please see: Find the GDB manual and other documentation resources online at: .For help, type "help". Type "apropos word" to search for commands related to "word".This GDB was configured as follows: configure --host=%s --target=%s --with-auto-load-dir=%s --with-auto-load-safe-path=%s --without-expat (relocatable) --with-gdb-datadir=%s%s --with-jit-reader-dir=%s%s --without-libunwind-ia64 --without-lzma --without-babeltrace --without-intel-pt --without-mpfr --without-xxhash --without-python --without-python-libdir --without-debuginfod --without-guile --disable-source-highlight --with-separate-debug-dir=%s%s ("Relocatable" means the directory can be moved with the GDB installation tree, and GDB will still find it.) A debugging session is active. Inferior %d [%s] will be detached. Inferior %d [%s] will be killed. Quit anyway? Debugger's interactive mode is %s (currently %s). Debugger's interactive mode is %s. Could not rename %ps to %ps: %svoid gdb_safe_append_history()saved_errno == ENOENTCould not rename %s to %s: %s%s-gdb%ld~%5d %s Set verbose printing of informational messages.Show verbose printing of informational messages.void set_verbose(const char*, int, cmd_list_element*)showcmd != NULL && showcmd != CMD_LIST_AMBIGUOUSGDBHISTSIZEGDBHISTFILE.gdb_history(gdb) operate-and-get-nextShow gdb's prompt.Set gdb's prompt.Don't repeat this command. Primarily used inside of user-defined commands that should not be repeated when hitting return.dont-repeateditingUse "on" to enable the editing, and "off" to disable it. Without an argument, command line editing is enabled. To edit, use EMACS-like or VI-like commands like control-P or ESC.Show editing of command lines as they are typed.Set editing of command lines as they are typed.Use "on" to enable the saving, and "off" to disable it. Without an argument, saving is enabled.Show saving of the history record on exit.Set saving of the history record on exit.This is the number of previous commands to keep a record of. If set to "unlimited", the number of commands kept in the history list is unlimited. This defaults to the value of the environment variable "GDBHISTSIZE", or to 256 if this variable is not set.Show the size of the command history.Set the size of the command history.remove-duplicatesIf set to a nonzero value N, GDB will look back at the last N history entries and remove the first history entry that is a duplicate of the most recent entry, each time a new history entry is added. If set to "unlimited", this lookbehind is unbounded. Only history entries added during this session are considered for removal. If set to 0, removal of duplicate history entries is disabled. By default this option is set to 0.Show how far back in history to look for and remove duplicate entries.Set how far back in history to look for and remove duplicate entries.(the list of previous commands of which a record is kept).Show the filename in which to record the command history.Set the filename in which to record the command history.confirmShow whether to confirm potentially dangerous operations.Set whether to confirm potentially dangerous operations.0 == normal; 1 == fullname (for use when running under emacs) 2 == output annotated suitably for use by programs that control GDB.Show annotation_level.Set annotation_level.exec-done-displayUse "on" to enable the notification, and "off" to disable it.Show notification of completion for asynchronous execution commands.Set notification of completion for asynchronous execution commands.When set, GDB uses the specified path to search for data files.Show GDB's data directory.Set GDB's data directory.interactive-modeIf on, GDB assumes that standard input is a terminal. In practice, it means that GDB should wait for the user to answer queries associated to commands entered at the command prompt. If off, GDB assumes that standard input is not a terminal, and uses the default answer to all queries. If auto (the default), determine which mode to use based on the standard input settings.Show whether GDB's standard input is a terminal.Set whether GDB's standard input is a terminal.startup-quietlyThis setting will not affect the current session. Instead this command should be added to the .gdbearlyinit file in the users home directory to affect future GDB sessions. Show whether GDB should start up quietly.Set whether GDB should start up quietly.Create a new UI. Usage: new-ui INTERPRETER TTY The first argument is the name of the interpreter to run. The second argument is the terminal the UI runs on.new-ui_gdb_major_gdb_minor%d.%d.%d  pre-gdb_readline_wrapper_cleanup::~gdb_readline_wrapper_cleanup()ui->input_handler == gdb_readline_wrapper_lineui->secondary_prompt_depth >= 0int ctf_save_fseek(trace_write_handler*, long int, int)../../gdb/tracectf.cwhence != SEEK_SET || offset <= handler->content_size + handler->packet_startUnable to seek file for saving trace data (%s)Unable to write metadata file (%s)event { name = "register"; id = %u; fields := struct { ascii contents[%d]; }; }; event { name = "memory"; id = %u; fields := struct { uint64_t address; uint16_t length; uint8_t contents[length]; }; }; event { name = "tsv"; id = %u; fields := struct { uint64_t val; uint32_t num; }; }; event { name = "frame"; id = %u; fields := struct { }; }; event { name = "tsv_def"; id = %u; fields := struct { int64_t initial_value; int32_t number; int32_t builtin; chars name; }; }; event { name = "tp_def"; id = %u; fields := struct { uint64_t addr; uint64_t traceframe_usage; int32_t number; int32_t enabled; int32_t step; int32_t pass; int32_t hit_count; int32_t type; chars cond; uint32_t action_num; chars actions[action_num]; uint32_t step_action_num; chars step_actions[step_action_num]; chars at_string; chars cond_string; uint32_t cmd_num; chars cmd_strings[cmd_num]; }; }; void ctf_write_header(trace_file_writer*)writer->tcs.content_size == 0writer->tcs.packet_start == 0void ctf_end(trace_file_writer*)Unable to write file for saving trace data (%s)event { name = "status"; id = %u; fields := struct { int32_t stop_reason; int32_t stopping_tracepoint; int32_t traceframe_count; int32_t traceframes_created; int32_t buffer_free; int32_t buffer_size; int32_t disconnected_tracing; int32_t circular_buffer; }; }; Unable to open directory '%s' for saving trace data (%s)Unable to open file '%s' for saving trace data (%s)/* CTF %d.%d */ typealias integer { size = 8; align = 8; signed = false; encoding = ascii;} := ascii; typealias integer { size = 8; align = 8; signed = false; } := uint8_t; typealias integer { size = 16; align = 16;signed = false; } := uint16_t; typealias integer { size = 32; align = 32;signed = false; } := uint32_t; typealias integer { size = 64; align = 64;signed = false; base = hex;} := uint64_t; typealias integer { size = 32; align = 32;signed = true; } := int32_t; typealias integer { size = 64; align = 64;signed = true; } := int64_t; typealias string { encoding = ascii; } := chars; trace { major = %u; minor = %u; byte_order = %s; packet.header := struct { uint32_t magic; }; }; stream { packet.context := struct { uint32_t content_size; uint32_t packet_size; uint16_t tpnum; }; event.header := struct { uint32_t id; }; }; datastream) )d))H)8)<))))Rأ))Ī)<)ȫ)ԫ)l)TRACE0 R %x tp T%x:%s:%c:%x:%x:X%x,%stp A%x:%s:%s tp S%x:%s:%s tp Z%s tp V%x:%s:%x:%s tsv %x:%s:%x:%s status %c;%s;tframes:%x;tcreated:%x;tfree:%x;tsize:%x;disconn:%x;circular:%x;starttime:%s;stoptime:%s;notes:%s;username:%s `%s' Premature end of file while reading trace fileUnknown block type '%c' (0x%x) in trace frameunknown tfind type../../gdb/tracefile-tfile.cvirtual void tfile_target::close()trace_fd != -1No trace file specified.File is not a valid trace file.R status tp tsv tdesc Ignoring trace file definition "%s"Excessively long lines in trace fileNo register block size recorded in trace fileNo traceframes present in this file.target.xmltfile_xfer_partial: tdesc is read-onlytfile_xfer_partial: trace file is read-onlytdesc %.*s tdesc %s Unhandled trace block type (%d) '%c ' while building trace frame info.tfileLocal trace dump fileUse a trace file as a target. Specify the filename of the trace file.R#R9R`))))0)) )D)t)$)ȯ)\)12tfile_target^RRRw))))$''\(((4(D((L(\)(()\((,( ( (!("(@$(%(\&('(|)(X+(-(.(/(h0(t1( 3(4(`6(7(8(x9(:(:(L;(;(<(=(0>($''@?( @((A(0B(8C(@D(TE(\F(la (H($'(()J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T()))))U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b()Xf(8g(g(h(\i(0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(,'@'@'T'd't'''{(D|( }(}(~(|(D(()D)(\))((((P((((((((D((T((T()((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wTracepoint %d has multiple locations, cannot infer $pcTracepoint %d does while-stepping, cannot infer $pcSave the trace data to a file. Use the '-ctf' option to save the data to CTF format. Use the '-r' option to direct the target to save directly to the file, using its own filesystem.tsaveTarget failed to save trace data to '%s'.Failure to get requested trace buffer datafile in which to save trace data-ctfunknown option `%s'Trace data saved to %s '%s'. 16tracefile_target^R($''@?( @((A(0B(8C(@D(TE(\F(la (H($'(()J(@K(K(L(M(TO(O(P(8Q(Q(R(S(T()))))U(`V(e X(Y(Y(Z([(e 0](^(T_(_( a(b(c(Xf(8g(g(h(\i(0j(l(m(o(p(q(r(e Dt($u(v(v(w(a ` z(,'@'@'T'd't'''{(D|( }(}(~(|(D(()(($(<(((((P((((((((D((T((T((((((h(0(((((@(ܡ((($(H((T(((h(((( (P((h(<(((H(((`(wThis command cannot be used at the top level.This command can only be used in a tracepoint actions list.Expression is too complicated.expression is malformed../../gdb/tracepoint.cexpression has min height < 0trace_frametrace_linetrace_functrace_fileTarget does not support trace notes, stop note ignoredTarget does not support trace notes, note ignoredTarget does not support trace notes, user ignoredMust supply a non-empty variable name$%s is not a valid trace state variable nametvariable $%sTarget does not support "/s" option for string tracing.Undefined collection format "%c".collect register %d Can't collect locals; no symbol table info available. No locals found in scope.Can't collect args; no symbol table info available.No args found in scope.collect static trace data disconnectiontrace-filevoid trace_status_mi(int)ts->running_knownstop-reasonstopping-tracepointerror-descriptionframes-createdbuffer-freecircularuser-name%ld.%06ldstart-timestop-timeMay not look at trace frames while trace is running.No current trace frame.No known tracepoint matches 'current' tracepoint #%d.Buffer too small for source encoding%x:%s:%s:%x:%x:Source string too long for bufferMalformed trace status, at %s Status line: '%s' tframestcreatedtfreedisconnstarttimestoptimeusernamebad marker definition: %sCan not parse XML trace frame info; XML support was disabled at compile timeList the variables local to a scope.Tracing of program execution without stopping the program.Print everything collected at the current tracepoint.tdumpDefine a trace state variable. Argument is a $-prefixed name, optionally followed by '=' and an expression that sets the initial value at the start of tracing.tvariableDelete one or more trace state variables. Arguments are the names of the variables to delete. If no arguments are supplied, delete all variables.Status of trace state variables and their values.tvariablesList target static tracepoints markers.static-tracepoint-markersSelect a trace frame. No argument means forward by one frame; '-' means backward by one frame.tfindSelect a trace frame whose PC is outside the given range (exclusive). Usage: tfind outside ADDR1, ADDR2outsideSelect a trace frame whose PC is in the given range (inclusive). Usage: tfind range ADDR1, ADDR2Select a trace frame by source line. Argument can be a line number (with optional source file), a function name, or '*' followed by an address. Default argument is 'the next source line that was traced'.Select a trace frame by tracepoint number. Default is the tracepoint for the current trace frame.Select a trace frame by PC. Default is the current PC, or the PC of the current trace frame.De-select any trace frame and resume 'live' debugging.Select the first trace frame in the trace buffer.Display the status of the current trace data collection.Stop trace data collection. Usage: tstop [NOTES]... Any arguments supplied are recorded with the trace as a stop reason and reported by tstatus (if the target supports trace notes).tstopStart trace data collection. Usage: tstart [NOTES]... Any arguments supplied are recorded with the trace as a note and reported by tstatus (if the target supports trace notes).tstartEnds a list of commands or actions. Several GDB commands allow you to enter a list of commands or actions. Entering "end" on a line by itself is the normal way to terminate such a list. Note: the "end" command cannot be used at the gdb prompt.Specify single-stepping behavior at a tracepoint. Argument is number of instructions to trace in single-step mode following the tracepoint. This command is normally followed by one or more "collect" commands, to specify what to collect while single-stepping. Note: this command can only be used in a tracepoint "actions" list.while-steppingSpecify one or more data items to be collected at a tracepoint. Accepts a comma-separated list of (one or more) expressions. GDB will collect all data (variables, registers) referenced by that expression. Also accepts the following special arguments: $regs -- all registers. $args -- all function arguments. $locals -- all variables local to the block/function scope. $_sdata -- static tracepoint data (ignored for non-static tracepoints). Note: this command can only be used in a tracepoint "actions" list.Specify one or more expressions to be evaluated at a tracepoint. Accepts a comma-separated list of (one or more) expressions. The result of each evaluation will be discarded. Note: this command can only be used in a tracepoint "actions" list.tevalSpecify the actions to be taken at a tracepoint. Tracepoint actions may include collecting of specified data, single-stepping, or enabling/disabling other tracepoints, depending on target's capabilities.actionsShow the list of expressions to collect by default.Set the list of expressions to collect by default.disconnected-tracingUse this to continue a tracing run even if GDB disconnects or detaches from the target. You can reconnect later and look at trace data collected in the meantime.Show whether tracing continues after GDB disconnects.Set whether tracing continues after GDB disconnects.circular-trace-bufferUse this to make the trace buffer into a circular buffer, which will discard traceframes (oldest first) instead of filling up and stopping the trace run.Show target's use of circular trace buffer.Set target's use of circular trace buffer.Use this to choose a size for the trace buffer. Some targets may have fixed or limited buffer sizes. Specifying "unlimited" or -1 disables any attempt to set the buffer size and lets the target choose.Show requested size of trace buffer.Set requested size of trace buffer.trace-userShow the user name to use for current and future trace runs.Set the user name to use for current and future trace runs.trace-notesShow the notes string to use for current and future trace runs.Set notes string to use for current and future trace runs.trace-stop-notesShow the notes string to use for future tstop commands.Set notes string to use for future tstop commands.Enter actions for tracepoint %d, one per line.trace-variablesInitialCurrentNo trace state variables. `%s' is not a tracepoint action, or is ambiguous.constant `%s' (value %s) will not be collected.`%s' is optimized away and cannot be collected.while-stepping step count `%s' is malformed.`%s' is not a supported tracepoint action.collect %sCan't collect register %dStaticTracepointMarkersTablecounterCntmarker-idmarker Data: "extra-datatracepoints-atProbed by static tracepoints: tracepoint-idnumber-of-tracepointsBad action list item: %svoid trace_dump_actions(command_line*, int, int, int)action->body_list_1 == nullptr$reg$locData collected at tracepoint %d, trace frame %d: Delete all trace state variables? No trace variable named "$%s", not deletingName "%s" not prefixed with '$', ignoring__tsvAssuming trace state variable $%s is same as target's variable %d. %s_%dCreated trace state variable $%s for target's variable %d. Syntax is $NAME [ = EXPR ]Syntax must be $NAME [ = EXPR ]Trace state variable $%s now has initial value %s. Trace state variable $%s created, with initial value %s. Using a trace file. Trace can not be run on this target. Run/stop status is unknown. Trace is running on the target. No trace has been run on the target. Trace stopped by a tstop command (%s). Trace stopped by a tstop command. Trace stopped because the buffer was full. Trace stopped because of disconnection. Trace stopped by tracepoint %d. Trace stopped by an error (%s, tracepoint %d). Trace stopped by an error (%s). Trace stopped for an unknown reason. Trace stopped for some other reason (%d). Buffer contains %d trace frames (of %d created total). Collected %d trace frames. Trace buffer has %d bytes of %d bytes free (%d%% full)Trace buffer has %d bytes free. Trace will continue if GDB disconnects. Trace will stop if GDB disconnects. Trace buffer is circular. Trace user is %s. Trace notes: %s. Looking at trace frame %d, tracepoint %d. Not looking at any trace frame. Trace started at %ld.%06ld secs, stopped %ld.%06ld secs later. Trace started at %ld.%06ld secs. Trace stopped at %ld.%06ld secs. Trace is running and will continue after detach; detach anyway? Trace is running but will stop on detach; detach anyway? Pending tracepoints will not be resolved while GDB is disconnected Trace is not running.requires an argument (function, line or *addr) to define a scopeScope for %s: Symbol %s is a bogus symbol, class %d. a constant with value %s (%s)constant bytes: in static storage at address an argument in register $%sa local variable in register $%san argument at stack/frame offset %sa local variable at frame offset %sa reference argument at offset %sthe address of an argument, in register $%sa typedef. Unresolved Staticoptimized out. void info_scope_command(const char*, int), length %s. Scope for %s contains no locals or arguments. Assuming tracepoint %d is same as target's tracepoint %d at %s. Created tracepoint %d for target's tracepoint %d at %s. Failed to create tracepoint for target's tracepoint %d at %s, skipping it. Unrecognized char '%c' in tracepoint definition, skipping restcond:cmd:Unrecognized tracepoint piece '%c', ignoringcould not change traceframeTarget failed to find requested trace frame.End of trace buffer. Found trace frame %d, tracepoint %d No longer looking at any trace frame No trace frame found not debugging trace bufferalready at start of trace bufferinvalid input (%d is less than zero)No current tracepoint -- please supply an argument.No line number information available.Line number %d is out of range for "%s".Cannot find a good line.Attempting to find line %d instead. Usage: tfind range STARTADDR, ENDADDR Usage: tfind outside STARTADDR, ENDADDR fast No tracepoints defined, not starting traceMay not insert %stracepoints, skipping tracepoint %dNo tracepoints enabledNo tracepoints enabled, not starting traceNo tracepoints that may be downloaded, not starting tracevoid start_tracing(const char*)!loc->insertedTarget does not support trace user/notes, info ignoredA trace is running already. Start a new run? New trace run not started.(%d,%s,%ld) %s: don't know symbol class %d constant %s (value %s) will not be collected. LOC_STATIC %s: collect %ld bytes at %s. LOC_REG[parm] %s: Sorry, don't know how to do LOC_REF_ARG yet. (will not collect %s) LOC_LOCAL %s: Collect %ld bytes at offset %s from frame ptr reg %d LOC_REGPARM_ADDR %s: Collect %ld bytes at offset %s from reg %d %s has been optimized out of existence. $_sdataOP_REGISTER: void encode_actions_1(command_line*, bp_location*, int, LONGEST, collection_list*, collection_list*)stepping_listInvalid tracepoint command '%s' Collecting static trace data Collecting registers (mask): 0x%02XCollecting memranges: (%d, %s, %ld) M-1,%s,%lXM%X,%s,%lXX%08X,tunknowntnotruntfulltdisconnectedtpasscountterror'*0123456789abcdefvoid tramp_frame_prepend_unwinder(gdbarch*, const tramp_frame*)../../gdb/tramp-frame.ctramp_frame->insn_size <= sizeof (tramp_frame->insn[0].bytes)i < ARRAY_SIZE (tramp_frame->insn)type_instance_flags type_stack::follow_type_instance_flags()../../gdb/type-stack.cunrecognized tp_ value in follow_typesstd::vector* type_stack::pop_typelist()../../gdb/type-stack.h!m_elements.empty ()type_stack* type_stack::pop_type_stack()type* type_stack::follow_types(type*)void type_stack::insert(type_pieces)tp == tp_pointer || tp == tp_reference || tp == tp_rvalue_reference || tp == tp_const || tp == tp_volatile || tp == tp_restrict || tp == tp_atomicvoid type_stack::insert_into(int, type_stack_elt)slot <= m_elements.size ()Display of struct members offsets and sizes in hexadecimal is %s Will not print nested types defined in a class Will print %s nested types defined in a class Printing of typedefs defined in a class in %s Printing of methods defined in a class in %s /* XXX %2u-bit %-7s */ /* XXX %2u-byte %-7s */ /* 0x%04x: 0x%x/* %6u:%2u /* 0x%04x/* %6u | 0x%04x */ | %6u *//* %6s */hole/* total size (bytes): %4s */ '%s' has unknown type; cast it to its declared type%s-byte fixed point (small = %s)internal error: unhandled type in print_type_scalarPrint definition of type TYPE. Usage: ptype[/FLAGS] TYPE | EXPRESSION Argument may be any type (for example a type name defined by typedef, or "struct STRUCT-TAG" or "class CLASS-NAME" or "union UNION-TAG" or "enum ENUM-TAG") or an expression. The selected stack frame's lexical context is used to look up the name. Contrary to "whatis", "ptype" always unrolls any typedefs. Available FLAGS are: /r print in "raw" form; do not substitute typedefs /m do not print methods defined in a class /M print methods defined in a class /t do not print typedefs defined in a class /T print typedefs defined in a class /o print offsets and sizes of fields in a struct (like pahole) /x use hexadecimal notation when displaying sizes and offsets of struct members /d use decimal notation when displaying sizes and offsets of struct members Print data type of expression EXP. Only one level of typedefs is unrolled. See also "ptype".whatisGeneric command for showing type-printing settings.Generic command for setting how types print.methodsShow printing of methods defined in classes.Set printing of methods defined in classes.typedefsShow printing of typedefs defined in classes.Set printing of typedefs defined in classes.nested-type-limitShow the number of recursive nested type definitions to print.Set the number of recursive nested type definitions to print ("unlimited" or -1 to show all).Show whether sizes and offsets of struct members are printed using hex notation.Set printing of struct members sizes and offsets using hex notation.unrecognized flag '%c'flag expectedexpected space after format/* offset | size */ /* real type = (incomplete object)virtual void ui_file::write_async_safe(const char*, long int)write_async_safevirtual long int string_file::read(char*, long int)a string_file is not readabledumbdO*U$.---*2S*L***U4*-*$**3Sl*****ć**-P**t3S|**Ԇ**d*ć**-P**43S*܎***4*ć**-P**L3SЊ****X*$.**l**2S*d****$.---*9null_file^2SdO11string_file^2SdO10stdio_file^3SdO11stderr_file^$3S3S8tee_file^@3SdO23no_terminal_escape_file^X3S3Sextra table_body call not allowed; there must be only one table_body after a table_begin and before a table_end.../../gdb/ui-out.cnumber of headers differ from number of table columns.table header must be specified after table_begin and before table_body.bool ui_out_table::query_field(int, int*, int*, const char**) constcolno == hdr->number ()tables cannot be nested; table_begin found before previous table_end.table_header outside a table is not valid; it must be after a table_begin and before a table_body.table_body outside a table is not valid; it must be after a table_begin and before a table_end.misplaced table_end or missing table_begin.table_body missing; table fields must be specified after table_body and inside a list.ui-out internal error in handling headers.void ui_out::vmessage(const ui_file_style&, const char*, va_list)piece.n_int_args >= 0 && piece.n_int_args <= 2piece.n_int_args == 0 || piece.argclass == string_arg || piece.argclass == int_arg || piece.argclass == long_argwide_string_arg not supported in vmessagewide_char_arg not supported in vmessagelong_double_arg not supported in vmessagedec32float_arg not supported in vmessagedec64float_arg not supported in vmessagedec128float_arg not supported in vmessage!test_flags (disallow_ui_out_field)arg == nullptrvoid ui_out::pop_level(ui_out_type)m_levels.size () > 0current_level ()->type () == typep9Ss 6ui_out^h9Svoid ui_file_style::color::get_rgb(uint8_t*) const../../gdb/ui-style.cget_rgb called on invalid colorbool ui_file_style::parse(const char*, size_t*)subexps[0].rm_so == 0subexps[FINAL_SUBEXP].rm_eo - subexps[FINAL_SUBEXP].rm_so == 1void _initialize_ui_style()38;5;48;5;38;2;48;2;[\\^\[([0-?]*[ -/]*)([@-~]) %-11s %3s %-11s %3d void append_user_reg(gdb_user_regs*, const char*, value* (*)(frame_info*, const void*), const void*, user_reg*)../../gdb/user-regs.cvoid user_reg_add(gdbarch*, const char*, value* (*)(frame_info*, const void*), const void*)regs != NULLvalue* value_of_user_reg(int, frame_info*)List the names of the current user registers.user-registers[abi:Configure what GDB does when %s is detected.Show what GDB does when %s is detected.Set whether GDB should quit when an %s is detected.Show whether GDB will quit when an %s is detected.Set whether GDB should create a core file of GDB when %s is detected.Show whether GDB will create a core file of GDB when %s is detected.QuitQuit (expect signal SIGINT when the program is resumed)virtual memory exhausted: can't allocate %ld bytes.../../gdb/utils.cvirtual memory exhausted.Attempt to raise 0 to negative power.The escape sequence `\%c' is equivalent to plain `%c', which has no equivalent in the `%s' character set.INSIDE_EMACSinvalid hex "%s"invalid decimal "%s"process-id to attachIllegal process-id: %s.pid_t wait_to_die_with_timeout(pid_t, int*, int)timeout >= 0int gdb_filename_fnmatch(const char*, const char*, int)(flags & FNM_FILE_NAME) != 0(flags & FNM_NOESCAPE) != 0const char* strip_leading_path_elements(const char*, int)This affects where GDB wraps its output to fit the screen width. Setting this to "unlimited" or zero prevents GDB from wrapping its output.Show number of characters where GDB should wrap lines of its output.Set number of characters where GDB should wrap lines of its output.heightThis affects the number of lines after which GDB will pause its output and ask you whether to continue. Setting this to "unlimited" or zero causes GDB never pause during output.Show number of lines in a page for GDB output pagination.Set number of lines in a page for GDB output pagination.paginationWhen pagination is ON, GDB pauses at end of each screenful of its output and asks you whether to continue. Turning pagination off is an alternative to "set height unlimited".Show state of GDB output pagination.Set state of GDB output pagination.sevenbit-stringsShow printing of 8-bit characters in strings as \nnn.Set printing of 8-bit characters in strings as \nnn.When set, debugging messages will be marked with seconds and microseconds.Show timestamping of debugging messages.Set timestamping of debugging messages.. Matching formats:. Use "set gnutarget format-name" to specify the format.%ld.%06ld %s Unable to dump core, use `ulimit -c unlimited' before executing GDB next time. %s: %s. pre-prompt-for-continue --Type for more, q to quit, c to continue without paging-- prompt-for-continue post-prompt-for-continue void puts_filtered_tabular(char*, int, int)chars_per_line > 0void wrap_here(const char*)filter_initializedTimestamping debugging messages is %s. Printing of 8-bit characters in strings as \nnn is %s. State of pagination is %s. Number of lines gdb thinks are in a page is %s. Number of characters gdb thinks are in a line is %s. [y][n] pre-query query (%s or %s) [answered %c; input not from terminal] %s%s(%s or %s) %sEOF [assumed %c] Please answer %s or %s. post-query %s:%d: %s: %s A problem internal to GDB has been detected, further debugging may prove unreliable.%s Quit this debugging session? This is a bug, please report it. For instructions, see: %s.%s Create a core file of GDB? HSHSHSRecursive internal problem. askyesnovoid value_args_as_target_float(value*, value*, gdb_byte*, type**, gdb_byte*, type**)../../gdb/valarith.cis_floating_type (type1) || is_floating_type (type2)Mixing decimal floating types with other floating types is not allowed.Don't know how to convert from %s to %s.LONGEST find_size_for_pointer_math(type*)ptr_type->code () == TYPE_CODE_PTRCannot perform pointer math on incomplete types, try casting to a known type, or void *.Cannot perform pointer math on incomplete type "%s", try casting to a known type, or void *.LONGEST value_ptrdiff(value*, value*)type1->code () == TYPE_CODE_PTRtype2->code () == TYPE_CODE_PTRFirst argument of `-' is a pointer and second argument is neither an integer nor a pointer of the same type.Type size unknown, assuming 1. Try casting to a known type, or void *.Argument to positive operation not a number.Second argument of 'IN' has wrong typeFirst argument of 'IN' has wrong typeFirst argument of 'IN' not in rangearray or string index out of rangenot an array or stringCould not find %s.Can't do that binary op on that typeoperator__?Invalid binary operation specified.value* value_x_binop(value*, value*, exp_opcode, exp_opcode, noside)static_memfuncp == 0member function %s not foundCan't do that unary op on that typeInvalid unary operation specified.value* value_x_unop(value*, exp_opcode, noside)unimplemented support for boolean repeatscan't repeat values of that typeStrings can only be concatenated with other strings.Booleans can only be concatenated with other bitstrings or booleans.unimplemented support for boolean concatenation.illegal operands for concatenation.Invalid type combination in equality test.value* value_vector_widen(value*, type*)vector_type->code () == TYPE_CODE_ARRAY && vector_type->is_vector ()conversion of scalar to vector involves truncationVector operations are only supported among vectorsArgument to negate operation not a number.Argument to complement operation not an integer, boolean.Argument to complex arithmetic operation not supported.Invalid binary operation on numbers.value* fixed_point_binop(value*, value*, exp_opcode)is_fixed_point_type (type1) || is_fixed_point_type (type2)Division by zeroInteger-only operation on fixed point number.Invalid operation on booleans.Invalid type combination in ordering comparison.Overload resolution in evaluating C++ functions is %s. gdb_mpq value_to_gdb_mpq(value*)../../gdb/valops.cis_integral_type (type) || is_fixed_point_type (type)Not a numeric type.value* value_one(type*)VALUE_LVAL (val) == not_lvalOnly values in memory can be extended with '@'.Invalid number %d of repetitions."%s" exists in this program but is not a function.evaluation of this expression requires the target program to be activeevaluation of this expression requires the program to have a function "%s".No memory available to program now: you need to start the target firstNo memory available to program: call to malloc failedvalue* address_of_variable(symbol*, const block*)regname && *regnameAddress requested for identifier "%s" which is in register $%sCan't take address of "%s" which isn't an lvalue.value* value_ref(value*, type_code)bad array bounds (%d, %d)array elements must all be the same sizeAttempt to extract a component of a value that is not a %s.No field with matching bitpos and type.name of destructor must equal name of classUnexpected value type.Couldn't retrieve complete object of RTTI type %s; object may be in register(s).no `this' in current languageno frame selectedcurrent stack frame does not contain a variable named `%s'slice from bad array or bitstringslice out of rangevalue* value_real_part(value*)type->code () == TYPE_CODE_COMPLEXvalue* value_imaginary_part(value*)overload-resolutionShow overload resolution in evaluating C++ functions.Set overload resolution in evaluating C++ functions.int find_oload_champ(gdb::array_view, size_t, fn_field*, xmethod_worker_up*, symbol**, badness_vector*)(methods != NULL) + (functions != NULL) + (xmethods != NULL) == 1Overloaded method instance %s, # of parms %d Xmethod worker, # of parms %d Overloaded function instance %s # of parms %d ...Badness of length : {%d, %d} ...Badness of arg %d : {%d, %d} Overload resolution champion is %d, ambiguous? %d int find_oload_champ_namespace_loop(gdb::array_view, const char*, const char*, int, std::vector*, badness_vector*, int*, int)qualified_name[next_namespace_len] == ':'cannot resolve overloaded method `%s': no arguments suppliedvalue* search_struct_method(const char*, value**, gdb::optional >, LONGEST, int*, type*)args.has_value ()virtual baseclass botchbase class '%s' is ambiguous in type '%s'value* search_struct_field(const char*, value*, type*, int)!candidate.path.empty () '%s %s::%s' (%s)Request for member '%s' is ambiguous in type '%s'. Candidates are:%svalue* value_cast_structs(type*, value*)type != NULL && v2 != NULL(t1->code () == TYPE_CODE_STRUCT || t1->code () == TYPE_CODE_UNION) && !!"Precondition is that type is of STRUCT or UNION kind."(t2->code () == TYPE_CODE_STRUCT || t2->code () == TYPE_CODE_UNION) && !!"Precondition is that value is of STRUCT or UNION kind"value* value_cast_pointers(type*, value*, int)check_typedef (value_type (v2))->code () == TYPE_CODE_STRUCT && !!"Why did coercion fail?"Internal error: non-aggregate type to value_struct_elt_for_referencevalue* value_struct_elt_for_reference(type*, int, type*, const char*, type*, int, noside)type != NULL && type->code () == TYPE_CODE_MEMBERPTRno member function matches that type instantiationnon-unique member `%s' requires type instantiationno matching member functionCannot reference virtual member function "%s"value* enum_constant_from_type(type*, const char*)type->code () == TYPE_CODE_ENUM && type->is_declared_class ()no constant named "%s" in enum "%s"non-aggregate type in value_aggregate_eltInvalid conversion from type %s to fixed point type %svalue* value_cast(type*, value*)!TYPE_IS_REFERENCE (type)array element type size does not divide object size in castcannot cast non-number to complexvalue truncatedCannot convert between vector values of different sizescan only cast scalar to vector of same sizeInvalid type conversion.Invalid cast.Invalid reinterpret_castArgument to dynamic_cast must be a pointer or reference typeArgument to dynamic_cast must be pointer to class or `void *'Argument to dynamic_cast does not have pointer typeArgument to dynamic_cast does not have pointer to class typeArgument to dynamic_cast does not have class typeAmbiguous dynamic_castCouldn't determine value's most derived type for dynamic_castdynamic_cast failedvalue* value_assign(value*, value*)value_parent (value_parent (toval)) == NULLCan't handle bitfields which don't fit in a %d bit word.Value being assigned to is no longer active.value has been optimized outvalue is not availableLeft operand of assignment is not an lvalue.Cannot take address of method %s.There is no member or method named %s.One of the arguments you tried to pass to %s could not be converted to what the function wants.Structure has no component named %s.int find_overload_match(gdb::array_view, const char*, oload_search_type, value**, symbol*, value**, symbol**, int*, int, noside)Attempt to extract a component of a value that is not a struct or unionCouldn't find method %s%s%sTYPE_SELF_TYPE (methods[0].type) != NULLUnexpected overload comparison resultAmbiguous overload resolutionInternal error: incompatible overload candidates proposedInternal error: unexpected overload comparison resultCannot resolve method %s%s%s to any overloaded instanceCannot resolve function %s to any overloaded instanceUsing non-standard conversion to match method %s%s%s to supplied argumentsUsing non-standard conversion to match function %s to supplied argumentsDefault output radix for printing of values is %s. Default input radix for entering numbers is %s. Printing of C++ virtual function tables is %s. Printing of unions interior to structures is %s. Printing of symbols when printing pointers is %s. Printing of C++ static members is %s. Threshold for repeated print elements is %s. Pretty formatting of structures is %s. Printing of object's derived type based on vtable info is %s. Printing of char arrays to stop at first null char is %s. Printing of memory tag violations is %s. Maximum print depth is %s. Limit on string chars or array elements to print is %s. Printing of array indexes is %s. Pretty formatting of arrays is %s. Printing of addresses is %s. \x%lxInput and output radices set to decimal %u, hex %x, octal %o. Input radix set to decimal %u, hex %x, octal %o. Output radix set to decimal %u, hex %x, octal %o. Unsupported output radix ``decimal %u''; output radix unchanged.Output radix now set to decimal %u, hex %x, octal %o. Nonsense input radix ``decimal %u''; input radix unchanged.Input radix now set to decimal %u, hex %x, octal %o. Input and output radices now set to decimal %u, hex %x, octal %o.
bool val_print_check_max_depth(ui_file*, int, const value_print_options*, const language_defn*)../../gdb/valprint.clanguage->struct_too_deep_ellipsis () != NULLvoid value_print_scalar_formatted(value*, const value_print_options*, int, ui_file*)void generic_val_print_enum_1(type*, LONGEST, ui_file*)nbits == 0 || nbits == 1unknown: 0xValue out of range.%.11Fg%.17Fgconst gdb_byte* get_value_addr_contents(value*)deref_val != NULLvoid generic_val_print_enum(type*, int, ui_file*, value*, const value_print_options*)!options->format %ps=void generic_val_print_func(type*, int, CORE_ADDR, ui_file*, value*, const value_print_options*)} Unhandled type code %d in symbol table.Generic command for setting how things print.Generic command for showing print settings.Generic command for setting what things to print in "raw" mode.Generic command for showing "print raw" settings.input-radixShow default input radix for entering numbers.Set default input radix for entering numbers.output-radixShow default output radix for printing of values.Set default output radix for printing of values.Set default input and output number radices. Use 'set input-radix' or 'set output-radix' to independently set each. Without an argument, sets both radices back to the default value of 10.Show the default input and output number radices. Use 'show input-radix' or 'show output-radix' to independently show each.bool maybe_negate_by_bytes(const gdb_byte*, unsigned int, bfd_endian, gdb::byte_vector*)%1dint count_next_character(wchar_iterator*, std::vector*)tmp.num_chars < MAX_WCHARSd.num_chars < MAX_WCHARSSet printing of addresses.Show printing of addresses.Set pretty formatting of arrays.Show pretty formatting of arrays.array-indexesSet printing of array indexes.Show printing of array indexes.Set limit on string chars or array elements to print.Show limit on string chars or array elements to print."unlimited" causes there to be no limit.max-depthSet maximum print depth for nested structures, unions and arrays.Show maximum print depth for nested structures, unions, and arrays.When structures, unions, or arrays are nested beyond this depth then they will be replaced with either '{...}' or '(...)' depending on the language. Use "unlimited" to print the complete structure.memory-tag-violationsSet printing of memory tag violations for pointers.Show printing of memory tag violations for pointers.Issue a warning when the printed value is a pointer whose logical tag doesn't match the allocation tag of the memory location it points to.null-stopSet printing of char arrays to stop at first null char.Show printing of char arrays to stop at first null char.Set printing of C++ virtual function tables.Show printing of C++ virtual function tables.prettySet pretty formatting of structures.Show pretty formatting of structures.raw-valuesSet whether to print values in raw form.Show whether to print values in raw form.If set, values are printed in raw form, bypassing any pretty-printers for that value.Set threshold for repeated print elements.Show threshold for repeated print elements."unlimited" causes all elements to be individually printed.Set printing of C++ static members.Show printing of C++ static members.Set printing of symbol names when printing pointers.Show printing of symbol names when printing pointers.Set printing of unions interior to structures.Show printing of unions interior to structures.\a\b\f\n\r\t\v\, '<incomplete sequence >...value of type `%s' requires %s bytes, which is more than max-value-sizevalue requires %s bytes, which is more than max-value-sizeMaximum value size is unlimited. Maximum value size is %d bytes. You must provide one argument for $_cimag.expected a complex numberYou must provide one argument for $_creal.void set_max_value_size(const char*, int, cmd_list_element*)../../gdb/value.cmax_value_size == -1 || max_value_size >= 0max-value-size set too low, increasing to %d bytesshort unsigned int type::bit_offset() constmain_type->type_specific_field == TYPE_SPECIFIC_INTshort unsigned int type::bit_size() constint value_bits_available(const value*, LONGEST, LONGEST)!value->lazyint value_bits_any_optimized_out(const value*, int, int)bool value_contents_bits_eq(const value*, int, const value*, int, int)!val1->lazy && !val2->lazyoffset1 + length <= TYPE_LENGTH (val1->enclosing_type) * TARGET_CHAR_BIToffset2 + length <= TYPE_LENGTH (val2->enclosing_type) * TARGET_CHAR_BITint memcmp_with_bit_offsets(const gdb_byte*, size_t, const gdb_byte*, size_t, size_t)offset1_bits % TARGET_CHAR_BIT == offset2_bits % TARGET_CHAR_BITo1 % TARGET_CHAR_BIT == 0o2 % TARGET_CHAR_BIT == 0offset1_bits % TARGET_CHAR_BIT == 0offset2_bits % TARGET_CHAR_BIT == 0length_bits % TARGET_CHAR_BIT == 0register has not been saved in frameconst gdb_byte* value_contents_for_printing_const(const value*)const lval_funcs* value_computed_funcs(const value*)value_lval_const (v) == lval_computedvoid* value_computed_closure(const value*)v->lval == lval_computedCORE_ADDR value_address(const value*)PROP_CONST == TYPE_DATA_LOCATION_KIND (value_type (value))void set_value_address(value*, CORE_ADDR)value->lval == lval_memoryframe_id* deprecated_value_next_frame_id_hack(value*)value->lval == lval_registerint* deprecated_value_regnum_hack(value*)void value_force_lval(value*, CORE_ADDR)VALUE_LVAL (v) == not_lvalvoid set_value_component_location(value*, const value*)whole->lval != lval_xcallablevalue_lazy (component)VALUE_LVAL (component) == lval_memoryconst char* value_internal_function_name(value*)VALUE_LVAL (val) == lval_internalvarvalue* call_internal_function(gdbarch*, const language_defn*, value*, int, value**)VALUE_LVAL (func) == lval_internalvartype* result_type_of_xmethod(value*, gdb::array_view)value_type (method)->code () == TYPE_CODE_XMETHOD && method->lval == lval_xcallable && !argv.empty ()value* call_xmethod(value*, gdb::array_view)Value can't be converted to integer.int unpack_value_field_as_long(type*, const gdb_byte*, LONGEST, int, const value*, LONGEST*)Value does not fit in %s bits.Unexpected type (%d) encountered for integer constant.value* readjust_indirect_value_type(value*, type*, const type*, value*, CORE_ADDR)original_type->code () == TYPE_CODE_PTR || TYPE_IS_REFERENCE (original_type)Function return type unknown.void value_decref(value*)val->reference_count > 0Debugger convenience ("$foo") variables and functions. Convenience variables are created when you assign them values; thus, "set $foo=1" gives "$foo" the value 1. Values may be any type. A few convenience variables are given values automatically: "$_"holds the last address examined with "x" or "info lines", "$__" holds the contents of the last address examined with "x".convenienceElements of value history around item number IDX (or last ten).Initialize a convenience variable if necessary. init-if-undefined VARIABLE = EXPRESSION Set an internal VARIABLE to the result of the EXPRESSION if it does not exist or does not contain a value. The EXPRESSION is not evaluated if the VARIABLE is already initialized.init-if-undefinedPlaceholder command for showing help on convenience functions.Check whether an expression is void. Usage: $_isvoid (expression) Return 1 if the expression is void, zero otherwise._isvoidExtract the real part of a complex number. Usage: $_creal (expression) Return the real part of a complex number, the type depends on the type of a complex number._crealExtract the imaginary part of a complex number. Usage: $_cimag (expression) Return the imaginary part of a complex number, the type depends on the type of a complex number._cimagUse this to control the maximum size, in bytes, of a value that gdb will load from the inferior. Setting this value to 'unlimited' disables checking. Setting this does not invalidate already allocated values, it only prevents future values, larger than this size, from being allocated.Show maximum sized value gdb will load from the inferior.Set maximum sized value gdb will load from the inferior.Init-if-undefined requires an assignment expression.The first parameter to init-if-undefined should be a GDB variable.void value_contents_copy_raw(value*, LONGEST, value*, LONGEST, LONGEST)!dst->lazy && !src->lazyvalue_bytes_available (dst, dst_offset, length)!value_bits_any_optimized_out (dst, TARGET_CHAR_BIT * dst_offset, TARGET_CHAR_BIT * length)You must provide one argument for $_isvoid.Unexpected type (%d) encountered for unsigned integer constant.value* value_from_host_double(type*, double)value* value_static_field(type*, int)unexpected field location kindvoid value_fetch_lazy(value*)val->optimized_out.empty ()val->unavailable.empty ()void value_fetch_lazy_register(value*)value_offset (val) == 0!gdbarch_convert_register_p (get_frame_arch (next_frame), regnum, type)infinite loop while fetching a register(frame=%d, regnum=%d(%s), ...) value_fetch_lazy_registerUnexpected lazy value type.Invalid floating value found in program.set_internalvar_componentvalue* value_primitive_field(value*, LONGEST, int, type*)0 == offsetPROP_CONST == TYPE_DATA_LOCATION_KIND (type)The history is empty.History does not go back to $$%d.History has not yet reached $%d.bad kind$%s = No debugger convenience variables now defined. Convenience variables have names starting with "$"; use "set" as in "set $foo = 5" to define them. Cannot overwrite convenience function %svoid set_internalvar(internalvar*, value*)Varobj debugging is %s. Duplicate variable object namevar%dbool is_path_expr_parent(const varobj*)../../gdb/varobj.cvar->root->lang_ops->is_path_expr_parent != NULLInvalid variable object (child of a dynamic varobj)const char* varobj_get_path_expr(const varobj*)!is_root_p (var)Python support requiredWhen non-zero, varobj debugging is enabled.Show varobj debugging.Set varobj debugging.Deleting %s bool install_new_value(varobj*, value*, bool)var->type || CPLUS_FAKE_CHILD (var)!value_lazy (value)!var->print_value.empty () && !print_value.empty ()var->value == nullptr || value_type (var->value.get ())bool varobj_set_value(varobj*, const char*)varobj_editable_p (var)Attempt to use a type name as an expression. Failed to find the specified frame%s.%d_anonymousstd::unique_ptr varobj_get_iterator(varobj*)requested an iterator from a non-dynamic varobjtdxozarm-buildroot-linux-gnueabihfarm-buildroot-linux-gnueabihf11.2btrace.dtdbtrace-conf.dtdgdb-target.dtdlibrary-list.dtdlibrary-list-aix.dtdlibrary-list-svr4.dtdosdata.dtdthreads.dtdtraceframe-info.dtdxinclude.dtd5S3S@SmSPSèS_S+SpSSSASSDSSSSSƗS,S %xinclude; XML debugging is %s. LONGEST xml_builtin_xfer_partial(const char*, gdb_byte*, const gdb_byte*, ULONGEST, LONGEST)../../gdb/xml-support.creadbuf != NULL && writebuf == NULLWhen set, debugging messages for XML parsers are displayed.Show XML parser debugging.Set XML parser debugging.seek to end of fileRead error from "%s"Can not parse XML syscalls information; XML support was disabled at compile time.Can not fetch XML target description; XML support was disabled at compile timeCan not parse XML target description; XML support was disabled at compile timeCould not open "%s"GDB_REVERSE_INIT_FUNCTIONSLDi$%$##$ _ HqX+vp|*,q,  %D) [#0@x"LDt@x;b    7 B N u , h `pP4|7`]|8h\81`4<H0bxc\t9,:(Hp4>"%g Z DE8' I g $ c! H4!إ!\i!! #!,I#K#̡#$#$ $l$$ܢ$p$P%%S&%{&41'(LD'N'pd'-)@))))|*Ĭ** *X`++,@^,, D 5 X_ < i OAOBOCODOHOF[3;5~[200~8.1_*\AaIiCcDdPpYyRrSsXx~ hl^$0ftFT;,%wbeWBE|` l|h^0bBFT` l|hwW^0bBFT` l|h^0%bBFT`vidomove_dispatch: unknown operator %daccept-linearrow-key-prefixbackward-bytebackward-charbackward-kill-linebackward-kill-wordbeginning-of-historybeginning-of-linebracketed-paste-begincall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-displayclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charhistory-search-backwardhistory-search-forwardhistory-substring-search-backwardhistory-substring-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-complete-backwardnext-historynext-screen-linenon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-againold-menu-completeoverwrite-modepossible-completionsprevious-historyprevious-screen-lineprint-last-kbd-macroquoted-insertre-read-init-fileredraw-current-linerevert-lineself-insertskip-csi-sequencestart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardupcase-wordyankyank-last-argyank-nth-argvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-backward-bigwordvi-backward-wordvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-bigwordvi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-forward-bigwordvi-forward-wordvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-unix-word-ruboutvi-yank-argvi-yank-popvi-yank-to>Y-׹S$.SP.S$.S.S.S-#S-S.6S4.KS.]S-sSP-S!.Sp&.S&.ºS.кS'.-W-ݺS,-S-S-S .S .*S@ .BS\..QSD.fS!.tS\-S@]-SH^-S@6.S-St3.λS.ڻS'.S .S|.S.Sp-S.)S,AS\,XS(,zS,S !.S|-S|-S-ͼS-,SD-S-ټS!-S4.S.S,5S,\S,S,S-gR5.ȽS6.׽Sh-S3.S.S8-'S.5SM-GS.ESp-[Sp-gS,.tS`'.sS.S-S.St-S".S!.S-˾S-оS-.S-S-S- S!.S-S-)S-S-6Sض,DS,SS,`SH,rS,S԰,S,S԰,Sp,S,,ǿS,ԿS,S,S,S,SH,S,S6.)S,8Sд,DS0,QS,ZSx,cS,tS,Sx,S,S,S|,St,SP,SH,S,S,S,S ,&S,3S@,:S,BS,MS,WS(,aS,qS<,}ST,S|,S ,Sx,S-S0,warning: turning off output flushing[?2004l [?2004hCOLUMNSbad value %d for what_to_do in rl_complete "\'`@$><=;|&{(readline: %s: line %d: $endif without matching $ifaudibleviemacs$else found without matching $if"%s%s": "%s" %s%s outputs %s blink-matching-parenprefer-visible-bellshow-mode-in-promptenable-bracketed-paste%s: unknown variable name%s: could not set value to `%s'%s: unknown parser directive%s: no closing `"' in key binding`%s': invalid key binding: missing key sequence`%s': missing closing quote for macro%s: no key sequence terminator%s: unknown key modifierprefix-meta/etc/inputrcINPUTRC~/.inputrc(ins)(cmd)bell-stylecomment-begincompletion-display-widthcompletion-prefix-display-lengthcompletion-query-itemsisearch-terminatorskeymapkeyseq-timeoutemacs-mode-stringvi-cmd-mode-stringvi-ins-mode-stringterm=mode=numeric argument expected, found `%s'trailing garbage on line: `%s'equality comparison operator expected, found `%s'\M-# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on "%s"%sset %s %s %s is set to `%s' emacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insertDELEscapeLFDNewlineRETReturnRuboutSPCSpaceTabbind-tty-special-charsbyte-orientedcolored-completion-prefixcolored-statscompletion-ignore-casecompletion-map-caseconvert-metadisable-completionecho-control-charactersenable-keypadenable-meta-keyexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmenu-complete-display-prefixmeta-flagoutput-metapage-completionsprint-completions-horizontallyrevert-all-at-newlineshow-all-if-ambiguousshow-all-if-unmodifiedskip-completed-textvisible-statsendifotherMetaControl-C-CTRL- S^;S`#S̎`1ST`KSP`YS@`pSD`S^S`S ^xS^S`S _SH`SL`S}`S~` S_1S ~`ES``S|_sS`S~`S~`S_PS_S|`S|`Sd`Sh`dS{`S`-SX`S*-S*-S(-S<(-!S'-S0+-bS7-ӽP(-8Sd6-LS$M-SS'-tS5-S4-abtnvfrSTQ-;S)-mJ+-Q@K-SUSS S S S SS S S LSUSXSGSSfailed i-search)` /-_=~.#$[201~maximum macro execution nesting level exceededreadline_callback_read_char() called with no handler!coLINESxnkmDCdceikDkHkIkdkhklkrkuvbvsjI`S̍`V`2I`K`oU` ?U`SЍ`S`pI`zJč`S`S؍`S`St`(H܍`S`S|`Sx`RX`Sp`}X`H`-)X`hhH`HR`a1U`cJ`SIԍ` Sȍ` S`O`LANGPOSIX(arg: %d) X%lu<>;&|"'`<>$!@?+*^$*%-:$*%^event not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitution ;&()|<> =JSZSmSSS.tmp.history ~ ~LS_COLORSLS_COLORS: unrecognized prefix: %sLS_COLORS: syntax error: %sunparsable value for LS_COLORS environment variable01;3401;3601;3501;3301;3237;4130;4337;4434;4230;4230;41lnbdsutwcamh5PSfYYQ_sYÁQahUSHOcJSO HshH[H?SSO%H+lXSSSoUPlease report this bug[%s, #%s%lu][%s, #%s%lu]![%s], #%s%lu undefined instruction: illegal sizesize equals zerosize equals twosize equals threesize <= 1size not equal to 0size not equal to 2size not equal to 3not unsigned and size = zeronot unsigned and size = onenot unsignedfsi = 0 and invalid imm6bad size with op2 = 2 and op1 = 0 or 1unsigned with op2 = 0 and op1 = 0 or 1op field equal 0 and bad cmodeexchange and unsigned togethermve instruction in it blockcondition bits, fca = 0 and fcb = 1use of r13 (sp)use of r15 (pc)start register block > r4start register block > r6use of r13 and write backsame vector register used for destination and other operanduse of offset scaledsame general-purpose register used for both operandsuse of identical q registers and size = 1CPSRR9_usrR10_usrR11_usrR12_usrSP_usrLR_usrR8_fiqR9_fiqR10_fiqR11_fiqR12_fiqSP_fiqLR_fiqLR_irqSP_irqLR_svcSP_svcLR_abtSP_abtLR_undSP_undLR_monSP_monELR_hypSP_hypSPSRSPSR_fiqSPSR_irqSPSR_svcSPSR_abtSPSR_undSPSR_monSPSR_hypR8_usrishstishldunstnshldoshoshstoshldEAPSRIPSRIEPSRMSPPSPMSPLIMPSPLIMPRIMASKBASEPRIBASEPRI_MAXFAULTMASKCONTROLMSP_NSPSP_NSMSPLIM_NSPSPLIM_NSPRIMASK_NSBASEPRI_NSFAULTMASK_NSCONTROL_NSIAPSR%%, #%d]%s, #-0], #-0, {%s%d}{d%d}{d%d-}{d%d-d%d}{VPR}{%c%d, VPR}{%c%d-d%ldq%ld%ld ; 0x%08x %c%u.%01u%ld ; 0x%08x %c%u.%03u%ld ; 0x%08x %c%u.%07u#%sf%ld-%c%d, %c%d, #%s%d]%s[%s, %c%s[%s], %c%s, lsl #%dINVALID ; 0x%lx ; unpredictable branch in IT block ; unpredictable #%ld ; instruction: %04x.byte 0x%02lx.short 0x%04lx.word 0x%08lx%sd%dd%d-d%d}, [%s :%d%sd%d[%d]%sd%d[]d%d[]-d%d[] :#%ld ; 0x%.4lx#%ld ; 0x%.2lx#%.7g ; 0x%.8lx#%ld ; 0x%.8lx{d%d-#0x%.8lx%.8lx, rrx, %s #%d ; , %s %s[pc], %s[pc, #%s%d] ; [pc] ; [pc], #%s%d], %s%s#%d, %d, {%d}(UNDEF: %lu)%cPSR_ ; IMB ; IMBRange%01lx#%lu, #%lu(invalid: %lu:%lu) ; instruction: %08x#%lu ; 0x%.4lx#%lu ; 0x%.8lx, uxtw #%luf16.s16s16.f16f16.u16u16.f16f32.s32s32.f32f32.u32u32.f32f16.f32f32.f16{q%ld, q%ld}{q%ld, q%ld, q%ld, q%ld}zrp16270180../../opcodes/arm-dis.cvpt_block_state.num_pred_insn >= 1APSR_nzcvs%up%u, lsl #%u, lsr #%u, asr #%u, ror #%u, ], #%c%u], {%u}(invalid: %s)#%u, #%u], #%dno-force-thumbcde coprocessor not between 0-7: %scoproc must have an argument: %sgenericcdeCDEcoprocN argument takes options "generic", "cde", or "CDE": %sunrecognised disassembler option: %sunrecognised register name set: %s__tagsym$$ The following ARM specific disassembler options are supported for use with the -M switch: %s%*c %s ttttteteeteteeeeetettwcidwconwcssfwcasfreservedwcgr0wcgr1wcgr2wcgr3wr0wr1wr2wr3wr4wr5wr6wr7wr8wr9wr10wr11wr12wr13wr14wr15bushushchsswuswssdusdssreg-names-rawSelect raw register namesreg-names-gccSelect register names used by GCCSelect register names used in ARM's ISA documentationAssume all insns are Thumb insnsExamine preceding label to determine an insn's typereg-names-apcsSelect register names used in the APCSreg-names-atpcsSelect register names used in the ATPCSreg-names-special-atpcsSelect special register names used in the ATPCSSLcoproc=(cde|generic)Enable CDE extensions for coprocessor N spacelsllsrasr1.02.03.04.05.00.510.0lctp%cle %Ple lr, %Pletp lr, %Pwls lr, %16-19S, %Qwlstp.%20-21s lr, %16-19S, %Qdls lr, %16-19Sdlstp.%20-21s lr, %16-19Sbf%c %G, %Wbfx%c %G, %16-19Sbfl%c %G, %Ybflx%c %G, %16-19Sbfcsel %G, %Z, %18-21cclrm%c %nttt %8-11r, %16-19rtta %8-11r, %16-19rttat %8-11r, %16-19resbsevl%c.wdcps%0-1dstlb%c %12-15r, [%16-19R]stlh%c %12-15r, [%16-19R]stl%c %12-15r, [%16-19R]stlexb%c %0-3r, %12-15r, [%16-19R]stlexh%c %0-3r, %12-15r, [%16-19R]stlex%c %0-3r, %12-15r, [%16-19R]stlexd%c %0-3r, %12-15r, %8-11r, [%16-19R]ldab%c %12-15r, [%16-19R]ldah%c %12-15r, [%16-19R]lda%c %12-15r, [%16-19R]ldaexb%c %12-15r, [%16-19R]ldaexh%c %12-15r, [%16-19R]ldaex%c %12-15r, [%16-19R]ldaexd%c %12-15r, %8-11r, [%16-19R]dfb%ccrc32b %8-11R, %16-19R, %0-3Rcrc32h %9-11R, %16-19R, %0-3Rcrc32w %8-11R, %16-19R, %0-3Rcrc32cb %8-11R, %16-19R, %0-3Rcrc32ch %8-11R, %16-19R, %0-3Rcrc32cw %8-11R, %16-19R, %0-3Rcsdbpssbbpli%c %adbg%c #%0-3ddmb%c %Udsb%c %Uisb%c %Usdiv%c %8-11r, %16-19r, %0-3rudiv%c %8-11r, %16-19r, %0-3rhvc%c %Vpldw%c %asmc%c %Knop%c.wyield%c.wwfe%c.wwfi%c.wsev%c.wnop%c.w {%0-7d}udf%c.w %Hclrex%ccpsie.w %7'a%6'i%5'f%Xcpsid.w %7'a%6'i%5'f%Xbxj%c %16-19r%xrfedb%c %16-19r%21'!rfeia%c %16-19r%21'!mrs%c %8-11r, %Dcps #%0-4d%Xtbb%c [%16-19r, %0-3r]%xtbh%c [%16-19r, %0-3r, lsl #1]%xcpsie %7'a%6'i%5'f, #%0-4d%Xcpsid %7'a%6'i%5'f, #%0-4d%Xsubs%c pc, lr, #%0-7dmsr%c %C, %16-19rldrex%c %12-15r, [%16-19r]ldrex%4?hb%c %12-15r, [%16-19r]srsdb%c %16-19r%21'!, #%0-4dsrsia%c %16-19r%21'!, #%0-4dsxth%c.w %8-11r, %0-3r%Ruxth%c.w %8-11r, %0-3r%Rsxtb16%c %8-11r, %0-3r%Ruxtb16%c %8-11r, %0-3r%Rsxtb%c.w %8-11r, %0-3r%Ruxtb%c.w %8-11r, %0-3r%Rstrex%c %8-11r, %12-15r, [%16-19r]ldrexd%c %12-15r, %8-11r, [%16-19r]sadd8%c %8-11r, %16-19r, %0-3rshadd8%c %8-11r, %16-19r, %0-3ruadd8%c %8-11r, %16-19r, %0-3ruqadd8%c %8-11r, %16-19r, %0-3ruhadd8%c %8-11r, %16-19r, %0-3rqadd%c %8-11r, %0-3r, %16-19rqdadd%c %8-11r, %0-3r, %16-19rqsub%c %8-11r, %0-3r, %16-19rqdsub%c %8-11r, %0-3r, %16-19rsadd16%c %8-11r, %16-19r, %0-3rshadd16%c %8-11r, %16-19r, %0-3ruadd16%c %8-11r, %16-19r, %0-3ruqadd16%c %8-11r, %16-19r, %0-3ruhadd16%c %8-11r, %16-19r, %0-3rrev%c.w %8-11r, %16-19rrev16%c.w %8-11r, %16-19rrbit%c %8-11r, %16-19rrevsh%c.w %8-11r, %16-19rsasx%c %8-11r, %16-19r, %0-3rshasx%c %8-11r, %16-19r, %0-3ruasx%c %8-11r, %16-19r, %0-3ruqasx%c %8-11r, %16-19r, %0-3ruhasx%c %8-11r, %16-19r, %0-3rsel%c %8-11r, %16-19r, %0-3rclz%c %8-11r, %16-19rssub8%c %8-11r, %16-19r, %0-3rshsub8%c %8-11r, %16-19r, %0-3rusub8%c %8-11r, %16-19r, %0-3ruqsub8%c %8-11r, %16-19r, %0-3ruhsub8%c %8-11r, %16-19r, %0-3rssub16%c %8-11r, %16-19r, %0-3rshsub16%c %8-11r, %16-19r, %0-3rusub16%c %8-11r, %16-19r, %0-3ruqsub16%c %8-11r, %16-19r, %0-3ruhsub16%c %8-11r, %16-19r, %0-3rssax%c %8-11r, %16-19r, %0-3rshsax%c %8-11r, %16-19r, %0-3rusax%c %8-11r, %16-19r, %0-3ruqsax%c %8-11r, %16-19r, %0-3ruhsax%c %8-11r, %16-19r, %0-3rmul%c.w %8-11r, %16-19r, %0-3rusad8%c %8-11r, %16-19r, %0-3rlsl%20's%c.w %8-11R, %16-19R, %0-3Rlsr%20's%c.w %8-11R, %16-19R, %0-3Rasr%20's%c.w %8-11R, %16-19R, %0-3Rror%20's%c.w %8-11r, %16-19r, %0-3rstrex%4?hb%c %0-3r, %12-15r, [%16-19r]ssat16%c %8-11r, #%0-4D, %16-19rusat16%c %8-11r, #%0-4d, %16-19rsmuad%4'x%c %8-11r, %16-19r, %0-3rsmulw%4?tb%c %8-11r, %16-19r, %0-3rsmusd%4'x%c %8-11r, %16-19r, %0-3rsmmul%4'r%c %8-11r, %16-19r, %0-3rsxtah%c %8-11r, %16-19r, %0-3r%Ruxtah%c %8-11r, %16-19r, %0-3r%Rsxtab16%c %8-11r, %16-19r, %0-3r%Ruxtab16%c %8-11r, %16-19r, %0-3r%Rsxtab%c %8-11r, %16-19r, %0-3r%Ruxtab%c %8-11r, %16-19r, %0-3r%Rsmul%5?tb%4?tb%c %8-11r, %16-19r, %0-3rbfc%c %8-11r, %Etst%c.w %16-19r, %Steq%c %16-19r, %Scmn%c.w %16-19r, %Scmp%c.w %16-19r, %Stst%c.w %16-19r, %Mteq%c %16-19r, %Mcmn%c.w %16-19r, %Mcmp%c.w %16-19r, %Mmov%20's%c.w %8-11r, %Smvn%20's%c.w %8-11r, %Sstrexd%c %0-3r, %12-15r, %8-11r, [%16-19r]mla%c %8-11r, %16-19r, %0-3r, %12-15rmls%c %8-11r, %16-19r, %0-3r, %12-15rusada8%c %8-11R, %16-19R, %0-3R, %12-15Rsmull%c %12-15R, %8-11R, %16-19R, %0-3Rumull%c %12-15R, %8-11R, %16-19R, %0-3Rsmlal%c %12-15R, %8-11R, %16-19R, %0-3Rumlal%c %12-15R, %8-11R, %16-19R, %0-3Rumaal%c %12-15R, %8-11R, %16-19R, %0-3Rldrex%c %12-15r, [%16-19r, #%0-7W]mov%20's%c.w %8-11r, %Mmvn%20's%c.w %8-11r, %Mpld%c %asmlad%4'x%c %8-11R, %16-19R, %0-3R, %12-15Rsmlaw%4?tb%c %8-11R, %16-19R, %0-3R, %12-15Rsmlsd%4'x%c %8-11R, %16-19R, %0-3R, %12-15Rsmmla%4'r%c %8-11R, %16-19R, %0-3R, %12-15Rsmmls%4'r%c %8-11R, %16-19R, %0-3R, %12-15Rsmlald%4'x%c %12-15R, %8-11R, %16-19R, %0-3Rsmlsld%4'x%c %12-15R, %8-11R, %16-19R, %0-3Rpkhbt%c %8-11r, %16-19r, %Spkhtb%c %8-11r, %16-19r, %Ssbfx%c %8-11r, %16-19r, %Fubfx%c %8-11r, %16-19r, %Fstr%wt%c %12-15r, %asmla%5?tb%4?tb%c %8-11r, %16-19r, %0-3r, %12-15rsmlal%5?tb%4?tb%c %12-15r, %8-11r, %16-19r, %0-3rbfi%c %8-11r, %16-19r, %Eldr%wt%c %12-15r, %assat%c %8-11r, #%0-4D, %16-19r%susat%c %8-11r, #%0-4d, %16-19r%saddw%c %8-11r, %16-19r, %Imovw%c %8-11r, %Jsubw%c %8-11r, %16-19r, %Imovt%c %8-11r, %Jand%20's%c.w %8-11r, %16-19r, %Sbic%20's%c.w %8-11r, %16-19r, %Sorr%20's%c.w %8-11r, %16-19r, %Sorn%20's%c %8-11r, %16-19r, %Seor%20's%c.w %8-11r, %16-19r, %Sadd%20's%c.w %8-11r, %16-19r, %Sadc%20's%c.w %8-11r, %16-19r, %Ssbc%20's%c.w %8-11r, %16-19r, %Ssub%20's%c.w %8-11r, %16-19r, %Srsb%20's%c %8-11r, %16-19r, %Sstrex%c %8-11r, %12-15r, [%16-19r, #%0-7W]and%20's%c.w %8-11r, %16-19r, %Mbic%20's%c.w %8-11r, %16-19r, %Morr%20's%c.w %8-11r, %16-19r, %Morn%20's%c %8-11r, %16-19r, %Meor%20's%c.w %8-11r, %16-19r, %Madd%20's%c.w %8-11r, %16-19r, %Madc%20's%c.w %8-11r, %16-19r, %Msbc%20's%c.w %8-11r, %16-19r, %Msub%20's%c.w %8-11r, %16-19r, %Mrsb%20's%c %8-11r, %16-19r, %Mstmia%c.w %16-19r%21'!, %mldmia%c.w %16-19r%21'!, %mstmdb%c %16-19r%21'!, %mldmdb%c %16-19r%21'!, %mstrd%c %12-15r, %8-11r, [%16-19r]ldrd%c %12-15r, %8-11r, [%16-19r]strd%c %12-15r, %8-11r, [%16-19r, #%23`-%0-7W]%21'!%Lldrd%c %12-15r, %8-11r, [%16-19r, #%23`-%0-7W]%21'!%Lstrd%c %12-15r, %8-11r, [%16-19r], #%23`-%0-7W%Lldrd%c %12-15r, %8-11r, [%16-19r], #%23`-%0-7W%Lstr%w%c.w %12-15r, %aldr%w%c.w %12-15r, %aundefined (bcc, cond=0xF)undefined (bcc, cond=0xE)b%22-25c.w %b%Xb%c.w %B%xblx%c %B%xbl%c %B%x ; instruction: %0-31xblxns %3-6rbxns %3-6rsevl%chlt %0-5xsetpan #%3-3dnop%cyield%cwfe%cwfi%csev%cnop%c {%4-7d}cbnz %0-2r, %b%Xcbz %0-2r, %b%Xit%I%Xcpsie %2'a%1'i%0'f%Xcpsid %2'a%1'i%0'f%Xmov%c %0-2r, %3-5rrev%c %0-2r, %3-5rrev16%c %0-2r, %3-5rrevsh%c %0-2r, %3-5rsetend %3?ble%Xsxth%c %0-2r, %3-5rsxtb%c %0-2r, %3-5ruxth%c %0-2r, %3-5ruxtb%c %0-2r, %3-5rbkpt %0-7xblx%c %3-6r%xnop%c ; (mov r8, r8)and%C %0-2r, %3-5reor%C %0-2r, %3-5rlsl%C %0-2r, %3-5rlsr%C %0-2r, %3-5rasr%C %0-2r, %3-5radc%C %0-2r, %3-5rsbc%C %0-2r, %3-5rror%C %0-2r, %3-5rtst%c %0-2r, %3-5rneg%C %0-2r, %3-5rcmp%c %0-2r, %3-5rcmn%c %0-2r, %3-5rorr%C %0-2r, %3-5rmul%C %0-2r, %3-5rbic%C %0-2r, %3-5rmvn%C %0-2r, %3-5radd%c sp, #%0-6Wsub%c sp, #%0-6Wbx%c %S%xadd%c %D, %Scmp%c %D, %Smov%c %D, %Spush%c %Npop%c %Oadd%C %0-2r, %3-5r, %6-8rsub%C %0-2r, %3-5r, %6-8radd%C %0-2r, %3-5r, #%6-8dsub%C %0-2r, %3-5r, #%6-8dstrh%c %0-2r, [%3-5r, %6-8r]ldrh%c %0-2r, [%3-5r, %6-8r]ldrs%11?hb%c %0-2r, [%3-5r, %6-8r]str%10'b%c %0-2r, [%3-5r, %6-8r]ldr%10'b%c %0-2r, [%3-5r, %6-8r]mov%C %0-2r, %3-5rlsl%C %0-2r, %3-5r, #%6-10dlsr%C %0-2r, %3-5r, %sasr%C %0-2r, %3-5r, %smov%C %8-10r, #%0-7dcmp%c %8-10r, #%0-7dadd%C %8-10r, #%0-7dsub%C %8-10r, #%0-7dldr%c %8-10r, [pc, #%0-7W] ; (%0-7a)str%c %0-2r, [%3-5r, #%6-10W]ldr%c %0-2r, [%3-5r, #%6-10W]strb%c %0-2r, [%3-5r, #%6-10d]ldrb%c %0-2r, [%3-5r, #%6-10d]strh%c %0-2r, [%3-5r, #%6-10H]ldrh%c %0-2r, [%3-5r, #%6-10H]str%c %8-10r, [sp, #%0-7W]ldr%c %8-10r, [sp, #%0-7W]add%c %8-10r, pc, #%0-7W ; (adr %8-10r, %0-7a)add%c %8-10r, sp, #%0-7Wstmia%c %8-10r!, %Mldmia%c %8-10r%W, %Msvc%c %0-7dudf%c #%0-7db%8-11c.n %0-7B%Xb%c.n %0-10B%xnop ; (mov r0, r0)udf #%ebx%c %0-3rmul%20's%c %16-19R, %0-3R, %8-11Rmla%20's%c %16-19R, %0-3R, %8-11R, %12-15Rswp%22'b%c %12-15RU, %0-3Ru, [%16-19RuU]%22?sumull%20's%c %12-15Ru, %16-19Ru, %0-3R, %8-11R%22?sumlal%20's%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rdfbsevlhlt 0x%16-19X%12-15X%8-11X%0-3Xstlex%c %12-15r, %0-3r, [%16-19R]stlexd%c %12-15r, %0-3r, %0-3T, [%16-19R]ldaexd%c %12-15r, %12-15T, [%16-19R]stlexb%c %12-15r, %0-3r, [%16-19R]stlexh%c %12-15r, %0-3r, [%16-19R]stl%c %0-3r, [%16-19R]stlb%c %0-3r, [%16-19R]stlh%c %0-3r, [%16-19R]crc32b %12-15R, %16-19R, %0-3Rcrc32h %12-15R, %16-19R, %0-3Rcrc32w %12-15R, %16-19R, %0-3Rcrc32cb %12-15R, %16-19R, %0-3Rcrc32ch %12-15R, %16-19R, %0-3Rcrc32cw %12-15R, %16-19R, %0-3Rsetpan #%9-9deret%chvc%c %esdiv%c %16-19r, %0-3r, %8-11rudiv%c %16-19r, %0-3r, %8-11rpldw %apli %Pdmb %Udsb %Uisb %Unop%c {%0-7d}bfc%c %12-15R, %Ebfi%c %12-15R, %0-3r, %Emls%c %16-19R, %0-3R, %8-11R, %12-15Rstrht%c %12-15R, %Sldr%6's%5?hbt%c %12-15R, %Smovw%c %12-15R, %Vmovt%c %12-15R, %Vrbit%c %12-15R, %0-3R%22?usbfx%c %12-15r, %0-3r, #%7-11d, #%16-20Wsmc%c %eldrexb%c %12-15R, [%16-19R]ldrexd%c %12-15r, [%16-19R]ldrexh%c %12-15R, [%16-19R]strexb%c %12-15R, %0-3R, [%16-19R]strexd%c %12-15R, %0-3r, [%16-19R]strexh%c %12-15R, %0-3R, [%16-19R]cpsie %8'a%7'i%6'fcpsie %8'a%7'i%6'f,#%0-4dcpsid %8'a%7'i%6'fcpsid %8'a%7'i%6'f,#%0-4dcps #%0-4dpkhbt%c %12-15R, %16-19R, %0-3Rpkhbt%c %12-15R, %16-19R, %0-3R, lsl #%7-11dpkhtb%c %12-15R, %16-19R, %0-3R, asr #32pkhtb%c %12-15R, %16-19R, %0-3R, asr #%7-11dldrex%c r%12-15d, [%16-19R]sadd16%c %12-15R, %16-19R, %0-3Rsadd8%c %12-15R, %16-19R, %0-3Rsasx%c %12-15R, %16-19R, %0-3Rshadd16%c %12-15R, %16-19R, %0-3Rshadd8%c %12-15R, %16-19R, %0-3Rshasx%c %12-15R, %16-19R, %0-3Rshsub16%c %12-15R, %16-19R, %0-3Rshsub8%c %12-15R, %16-19R, %0-3Rshsax%c %12-15R, %16-19R, %0-3Rssub16%c %12-15R, %16-19R, %0-3Rssub8%c %12-15R, %16-19R, %0-3Rssax%c %12-15R, %16-19R, %0-3Ruadd16%c %12-15R, %16-19R, %0-3Ruadd8%c %12-15R, %16-19R, %0-3Ruasx%c %12-15R, %16-19R, %0-3Ruhadd16%c %12-15R, %16-19R, %0-3Ruhadd8%c %12-15R, %16-19R, %0-3Ruhasx%c %12-15R, %16-19R, %0-3Ruhsub16%c %12-15R, %16-19R, %0-3Ruhsub8%c %12-15R, %16-19R, %0-3Ruhsax%c %12-15R, %16-19R, %0-3Ruqadd16%c %12-15R, %16-19R, %0-3Ruqadd8%c %12-15R, %16-19R, %0-3Ruqasx%c %12-15R, %16-19R, %0-3Ruqsub16%c %12-15R, %16-19R, %0-3Ruqsub8%c %12-15R, %16-19R, %0-3Ruqsax%c %12-15R, %16-19R, %0-3Rusub16%c %12-15R, %16-19R, %0-3Rusub8%c %12-15R, %16-19R, %0-3Rusax%c %12-15R, %16-19R, %0-3Rrev%c %12-15R, %0-3Rrev16%c %12-15R, %0-3Rrevsh%c %12-15R, %0-3Rrfe%23?id%24?ba %16-19r%21'!sxth%c %12-15R, %0-3Rsxth%c %12-15R, %0-3R, ror #8sxth%c %12-15R, %0-3R, ror #16sxth%c %12-15R, %0-3R, ror #24sxtb16%c %12-15R, %0-3Rsxtb16%c %12-15R, %0-3R, ror #8sxtb16%c %12-15R, %0-3R, ror #16sxtb16%c %12-15R, %0-3R, ror #24sxtb%c %12-15R, %0-3Rsxtb%c %12-15R, %0-3R, ror #8sxtb%c %12-15R, %0-3R, ror #16sxtb%c %12-15R, %0-3R, ror #24uxth%c %12-15R, %0-3Ruxth%c %12-15R, %0-3R, ror #8uxth%c %12-15R, %0-3R, ror #16uxth%c %12-15R, %0-3R, ror #24uxtb16%c %12-15R, %0-3Ruxtb16%c %12-15R, %0-3R, ror #8uxtb16%c %12-15R, %0-3R, ror #16uxtb16%c %12-15R, %0-3R, ror #24uxtb%c %12-15R, %0-3Ruxtb%c %12-15R, %0-3R, ror #8uxtb%c %12-15R, %0-3R, ror #16uxtb%c %12-15R, %0-3R, ror #24sxtah%c %12-15R, %16-19r, %0-3Rsxtah%c %12-15R, %16-19r, %0-3R, ror #8sxtah%c %12-15R, %16-19r, %0-3R, ror #16sxtah%c %12-15R, %16-19r, %0-3R, ror #24sxtab16%c %12-15R, %16-19r, %0-3Rsxtab16%c %12-15R, %16-19r, %0-3R, ror #8sxtab16%c %12-15R, %16-19r, %0-3R, ror #16sxtab16%c %12-15R, %16-19r, %0-3R, ror #24sxtab%c %12-15R, %16-19r, %0-3Rsxtab%c %12-15R, %16-19r, %0-3R, ror #8sxtab%c %12-15R, %16-19r, %0-3R, ror #16sxtab%c %12-15R, %16-19r, %0-3R, ror #24uxtah%c %12-15R, %16-19r, %0-3Ruxtah%c %12-15R, %16-19r, %0-3R, ror #8uxtah%c %12-15R, %16-19r, %0-3R, ror #16uxtah%c %12-15R, %16-19r, %0-3R, ror #24uxtab16%c %12-15R, %16-19r, %0-3Ruxtab16%c %12-15R, %16-19r, %0-3R, ror #8uxtab16%c %12-15R, %16-19r, %0-3R, ror #16uxtab16%c %12-15R, %16-19r, %0-3R, ROR #24uxtab%c %12-15R, %16-19r, %0-3Ruxtab%c %12-15R, %16-19r, %0-3R, ror #8uxtab%c %12-15R, %16-19r, %0-3R, ror #16uxtab%c %12-15R, %16-19r, %0-3R, ror #24sel%c %12-15R, %16-19R, %0-3Rsetend %9?blesmuad%5'x%c %16-19R, %0-3R, %8-11Rsmusd%5'x%c %16-19R, %0-3R, %8-11Rsmlad%5'x%c %16-19R, %0-3R, %8-11R, %12-15Rsmlald%5'x%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rsmlsd%5'x%c %16-19R, %0-3R, %8-11R, %12-15Rsmlsld%5'x%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rsmmul%5'r%c %16-19R, %0-3R, %8-11Rsmmla%5'r%c %16-19R, %0-3R, %8-11R, %12-15Rsmmls%5'r%c %16-19R, %0-3R, %8-11R, %12-15Rsrs%23?id%24?ba %16-19r%21'!, #%0-4dssat%c %12-15R, #%16-20W, %0-3Rssat%c %12-15R, #%16-20W, %0-3R, lsl #%7-11dssat%c %12-15R, #%16-20W, %0-3R, asr #%7-11dssat16%c %12-15r, #%16-19W, %0-3rstrex%c %12-15R, %0-3R, [%16-19R]umaal%c %12-15R, %16-19R, %0-3R, %8-11Rusad8%c %16-19R, %0-3R, %8-11Rusada8%c %16-19R, %0-3R, %8-11R, %12-15Rusat%c %12-15R, #%16-20d, %0-3Rusat%c %12-15R, #%16-20d, %0-3R, lsl #%7-11dusat%c %12-15R, #%16-20d, %0-3R, asr #%7-11dusat16%c %12-15R, #%16-19d, %0-3Rbxj%c %0-3Rbkpt 0x%16-19X%12-15X%8-11X%0-3Xblx %Bblx%c %0-3Rclz%c %12-15R, %0-3Rldrd%c %12-15r, %sstrd%c %12-15r, %spld %asmlabb%c %16-19R, %0-3R, %8-11R, %12-15Rsmlatb%c %16-19R, %0-3R, %8-11R, %12-15Rsmlabt%c %16-19R, %0-3R, %8-11R, %12-15Rsmlatt%c %16-19r, %0-3r, %8-11R, %12-15Rsmlawb%c %16-19R, %0-3R, %8-11R, %12-15Rsmlawt%c %16-19R, %0-3r, %8-11R, %12-15Rsmlalbb%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rsmlaltb%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rsmlalbt%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rsmlaltt%c %12-15Ru, %16-19Ru, %0-3R, %8-11Rsmulbb%c %16-19R, %0-3R, %8-11Rsmultb%c %16-19R, %0-3R, %8-11Rsmulbt%c %16-19R, %0-3R, %8-11Rsmultt%c %16-19R, %0-3R, %8-11Rsmulwb%c %16-19R, %0-3R, %8-11Rsmulwt%c %16-19R, %0-3R, %8-11Rqadd%c %12-15R, %0-3R, %16-19Rqdadd%c %12-15R, %0-3R, %16-19Rqsub%c %12-15R, %0-3R, %16-19Rqdsub%c %12-15R, %0-3R, %16-19Rpush%c {%12-15r} ; (str%c %12-15r, %a)strb%t%c %12-15R, %astr%t%c %12-15r, %astrb%c %12-15R, %astrh%c %12-15R, %sldr%6's%5?hb%c %12-15R, %sand%20's%c %12-15r, %16-19r, %oand%20's%c %12-15R, %16-19R, %oeor%20's%c %12-15r, %16-19r, %oeor%20's%c %12-15R, %16-19R, %osub%20's%c %12-15r, %16-19r, %osub%20's%c %12-15R, %16-19R, %orsb%20's%c %12-15r, %16-19r, %orsb%20's%c %12-15R, %16-19R, %oadd%20's%c %12-15r, %16-19r, %oadd%20's%c %12-15R, %16-19R, %oadc%20's%c %12-15r, %16-19r, %oadc%20's%c %12-15R, %16-19R, %osbc%20's%c %12-15r, %16-19r, %osbc%20's%c %12-15R, %16-19R, %orsc%20's%c %12-15r, %16-19r, %orsc%20's%c %12-15R, %16-19R, %omsr%c %C, %0-3rmsr%c %C, %omrs%c %12-15R, %Rtst%p%c %16-19r, %otst%p%c %16-19R, %oteq%p%c %16-19r, %oteq%p%c %16-19R, %ocmp%p%c %16-19r, %ocmp%p%c %16-19R, %ocmn%p%c %16-19r, %ocmn%p%c %16-19R, %oorr%20's%c %12-15r, %16-19r, %oorr%20's%c %12-15R, %16-19R, %omov%20's%c %12-15r, %omov%20's%c %12-15r, %0-3rlsl%20's%c %12-15R, %qlsr%20's%c %12-15R, %qasr%20's%c %12-15R, %qrrx%20's%c %12-15r, %0-3rror%20's%c %12-15R, %qbic%20's%c %12-15r, %16-19r, %obic%20's%c %12-15R, %16-19R, %omvn%20's%c %12-15r, %omvn%20's%c %12-15R, %opop%c {%12-15r} ; (ldr%c %12-15r, %a)ldrb%t%c %12-15R, %aldrt%c %12-15R, %aldr%c %12-15r, %astmfd%c %16-19R!, %mpush%c %mstm%c %16-19R%21'!, %m%22'^stm%23?id%24?ba%c %16-19R%21'!, %m%22'^ldmfd%c %16-19R!, %mpop%c %mldm%c %16-19R%21'!, %m%22'^ldm%23?id%24?ba%c %16-19R%21'!, %m%22'^b%24'l%c %bsvc%c %0-23xnop%c {%0-7d} ; vpst%ivpt%i.f%28s %n, %17-19Q, %1-3,5Qvpt%i.f%28s %n, %17-19Q, %0-3Zvpt%i.i%20-21s %n, %17-19Q, %1-3,5Qvpt%i.u%20-21s %n, %17-19Q, %1-3,5Qvpt%i.s%20-21s %n, %17-19Q, %1-3,5Qvpt%i.i%20-21s %n, %17-19Q, %0-3Zvpt%i.u%20-21s %n, %17-19Q, %0-3Zvpt%i.s%20-21s %n, %17-19Q, %0-3Zvbic%v.i%8-11s %13-15,22Q, %Evbic%v %13-15,22Q, %17-19,7Q, %1-3,5Qvabav%v.%u%20-21s %12-15r, %17-19,7Q, %1-3,5Qvabd%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvabd%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvabs%v.f%18-19s %13-15,22Q, %1-3,5Qvabs%v.s%18-19s %13-15,22Q, %1-3,5Qvadd%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvadd%v.f%28s %13-15,22Q, %17-19,7Q, %0-3rvadd%v.i%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvadd%v.i%20-21s %13-15,22Q, %17-19,7Q, %0-3rvaddlv%5A%v.%u32 %13-15l, %20-22h, %1-3Qvaddv%5A%v.%u%18-19s %13-15l, %1-3Qvadc%12I%v.i32 %13-15,22Q, %17-19,7Q, %1-3,5Qvand%v %13-15,22Q, %17-19,7Q, %1-3,5Qvbrsr%v.%20-21s %13-15,22Q, %17-19,7Q, %0-3rvcadd%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Q, #%24ovcadd%v.i%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Q, #%12ovcls%v.s%18-19s %13-15,22Q, %1-3,5Qvclz%v.i%18-19s %13-15,22Q, %1-3,5Qvcmla%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Q, #%23-24ovcmp%v.f%28s %n, %17-19Q, %1-3,5Qvcmp%v.f%28s %n, %17-19Q, %0-3Zvcmp%v.i%20-21s %n, %17-19Q, %1-3,5Qvcmp%v.u%20-21s %n, %17-19Q, %1-3,5Qvcmp%v.s%20-21s %n, %17-19Q, %1-3,5Qvcmp%v.i%20-21s %n, %17-19Q, %0-3Zvcmp%v.u%20-21s %n, %17-19Q, %0-3Zvcmp%v.s%20-21s %n, %17-19Q, %0-3Zvdup%v.%5,22s %17-19,7Q, %12-15rveor%v %13-15,22Q, %17-19,7Q, %1-3,5Qvfma%v.f%28s %13-15,22Q, %17-19,7Q, %0-3rvfma%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvfms%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvfmas%v.f%28s %13-15,22Q, %17-19,7Q, %0-3rvhadd%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvhadd%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvhsub%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvhsub%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvcmul%v.f%28s %13-15,22Q, %17-19,7Q, %1-3,5Q, #%0,12ovctp%v.%20-21s %16-19rvrhadd%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvcvt%v.%s %13-15,22Q, %1-3,5Q, #%16-21kvcvt%v.%s %13-15,22Q, %1-3,5Qvcvtb%v.%s %13-15,22Q, %1-3,5Qvcvtt%v.%s %13-15,22Q, %1-3,5Qvcvt%m%v.%s %13-15,22Q, %1-3,5Qvddup%v.u%20-21s %13-15,22Q, %17-19l, #%0,7uvdwdup%v.u%20-21s %13-15,22Q, %17-19l, %1-3h, #%0,7uvhcadd%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Q, #%12oviwdup%v.u%20-21s %13-15,22Q, %17-19l, %1-3h, #%0,7uvidup%v.u%20-21s %13-15,22Q, %17-19l, #%0,7uvld2%5d.%7-8s %B, [%16-19r]%wvld4%5-6d.%7-8s %B, [%16-19r]%wvldrb%v.%u%7-8s %13-15,22Q, [%16-19r, %1-3,5Q]vldrh%v.%u%7-8s %13-15,22Q, [%16-19r, %1-3,5Q%o]vldrw%v.u32 %13-15,22Q, [%16-19r, %1-3,5Q%o]vldrd%v.u64 %13-15,22Q, [%16-19r, %1-3,5Q%o]vldrw%v.u32 %13-15,22Q, [%17-19,7Q, #%a%0-6i]%wvldrd%v.u64 %13-15,22Q, [%17-19,7Q, #%a%0-6i]%wvldrb%v.%u%7-8s %13-15Q, %dvldrh%v.%u%7-8s %13-15Q, %dvldrb%v.u8 %13-15,22Q, %dvldrh%v.u16 %13-15,22Q, %dvldrw%v.u32 %13-15,22Q, %dvmax%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvmaxa%v.s%18-19s %13-15,22Q, %1-3,5Qvmaxnm%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvmaxnma%v.f%28s %13-15,22Q, %1-3,5Qvmaxnmv%v.f%28s %12-15r, %1-3,5Qvmaxnmav%v.f%28s %12-15r, %1-3,5Qvmaxv%v.%u%18-19s %12-15r, %1-3,5Qvmaxav%v.s%18-19s %12-15r, %1-3,5Qvmin%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvmina%v.s%18-19s %13-15,22Q, %1-3,5Qvminnm%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvminnma%v.f%28s %13-15,22Q, %1-3,5Qvminnmv%v.f%28s %12-15r, %1-3,5Qvminnmav%v.f%28s %12-15r, %1-3,5Qvminv%v.%u%18-19s %12-15r, %1-3,5Qvminav%v.s%18-19s %12-15r, %1-3,5Qvmla%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvmlaldav%5Ax%v.%u%16s %13-15l, %20-22h, %17-19,7Q, %1-3Qvmlalv%5A%v.%u%16s %13-15l, %20-22h, %17-19,7Q, %1-3Qvmlav%5A%v.%u%16s %13-15l, %17-19,7Q, %1-3Qvmlav%5A%v.%u8 %13-15l, %17-19,7Q, %1-3Qvmladav%5Ax%v.%u%16s %13-15l, %17-19,7Q, %1-3Qvmladav%5Ax%v.%u8 %13-15l, %17-19,7Q, %1-3Qvmlas%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvrmlsldavh%5A%X%v.s32 %13-15l, %20-22h, %17-19,7Q, %1-3Qvmlsldav%5A%X%v.%u%16s %13-15l, %20-22h, %17-19,7Q, %1-3Qvmlsdav%5A%X%v.s%16s %13-15l, %17-19,7Q, %1-3Qvmlsdav%5A%X%v.s8 %13-15l, %17-19,7Q, %1-3Qvmov.f16 %7,16-19F, %12-15rvmov.f16 %12-15r, %7,16-19Fvmov%c.%5-6,21-22s %17-19,7Q[%N], %12-15rvorr%v.i%8-11s %13-15,22Q, %Evqshl%v.%u%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvqshlu%v.s%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvrshr%v.%u%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvshl%v.i%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvshr%v.%u%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvsli%v.%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvsri%v.%19-21s %13-15,22Q, %1-3,5Q, #%16-18dvmov%v.%5,8-11s %13-15,22Q, %Evmov%c %0-3r, %16-19r, %13-15,22Q[2], %13-15,22Q[0]vmov%c %0-3r, %16-19r, %13-15,22Q[3], %13-15,22Q[1]vmov%c %13-15,22Q[2], %13-15,22Q[0], %0-3r, %16-19rvmov%c %13-15,22Q[3], %13-15,22Q[1], %0-3r, %16-19rvmov%c.%u%5-6,21-22s %12-15r, %17-19,7Q[%N]vshll%T%v.%u%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvmovl%T%v.%u%19-20s %13-15,22Q, %1-3,5Qvmovn%T%v.i%18-19s %13-15,22Q, %1-3,5Qvmovx.f16 %22,12-15F, %5,0-3Fvmul%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvmul%v.f%28s %13-15,22Q, %17-19,7Q, %0-3rvmul%v.i%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvmul%v.i%20-21s %13-15,22Q, %17-19,7Q, %0-3rvmulh%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvrmulh%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvmull%T%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvmull%T%v.%28s %13-15,22Q, %17-19,7Q, %1-3,5Qvmvn%v.i%8-11s %13-15,22Q, %Evmvn%v %13-15,22Q, %1-3,5Qvneg%v.f%18-19s %13-15,22Q, %1-3,5Qvneg%v.s%18-19s %13-15,22Q, %1-3,5Qvorn%v %13-15,22Q, %17-19,7Q, %1-3,5Qvorr%v %13-15,22Q, %17-19,7Q, %1-3,5Qvmov%v %13-15,22Q, %17-19,7Qvqdmull%T%v.s%28s %13-15,22Q, %17-19,7Q, %1-3,5Qvpnot%vvpsel%v %13-15,22Q, %17-19,7Q, %1-3,5Qvqabs%v.s%18-19s %13-15,22Q, %17-19,7Q, %1-3,5Qvqadd%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqadd%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqdmull%T%v.s%28s %13-15,22Q, %17-19,7Q, %0-3rvqmovn%T%v.%u%18-19s %13-15,22Q, %1-3,5Qvqmovun%T%v.s%18-19s %13-15,22Q, %1-3,5Qvqdmladh%X%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqrdmladh%X%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqdmlah%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqrdmlah%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqdmlash%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqrdmlash%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqdmlsdh%X%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqrdmlsdh%X%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqdmulh%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqrdmulh%v.s%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqdmulh%v.s%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqrdmulh%v.s%20-21s %13-15,22Q, %17-19,7Q, %0-3rvqneg%v.s%18-19s %13-15,22Q, %1-3,5Qvqrshl%v.%u%20-21s %13-15,22Q, %1-3,5Q, %17-19,7Qvqrshl%v.%u%18-19s %13-15,22Q, %0-3rvqrshrn%T%v.%u%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvqrshrun%T%v.s%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvqshl%v.%u%18-19s %13-15,22Q, %0-3rvqshl%v.%u%20-21s %13-15,22Q, %1-3,5Q, %17-19,7Qvqshrn%T%v.%u%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvqshrun%T%v.s%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvqsub%v.%u%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvqsub%v.%u%20-21s %13-15,22Q, %17-19,7Q, %0-3rvrev16%v.8 %13-15,22Q, %1-3,5Qvrev32%v.%18-19s %13-15,22Q, %1-3,5Qvrev64%v.%18-19s %13-15,22Q, %1-3,5Qvrint%m%v.f%18-19s %13-15,22Q, %1-3,5Qvrmlalvh%5A%v.%u32 %13-15l, %20-22h, %17-19,7Q, %1-3Qvrmlaldavh%5Ax%v.%u32 %13-15l, %20-22h, %17-19,7Q, %1-3Qvrshl%v.%u%20-21s %13-15,22Q, %1-3,5Q, %17-19,7Qvrshl%v.%u%18-19s %13-15,22Q, %0-3rvrshrn%T%v.i%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvsbc%12I%v.i32 %13-15,22Q, %17-19,7Q, %1-3,5Qvshl%v.%u%18-19s %13-15,22Q, %0-3rvshl%v.%u%20-21s %13-15,22Q, %1-3,5Q, %17-19,7Qvshlc%v %13-15,22Q, %0-3r, #%16-20dvshll%T%v.%u%18-19s %13-15,22Q, %1-3,5Q, #%18-19dvshrn%T%v.i%19-20s %13-15,22Q, %1-3,5Q, #%16-18dvst2%5d.%7-8s %B, [%16-19r]vst2%5d.%7-8s %B, [%16-19r]!vst4%5-6d.%7-8s %B, [%16-19r]vst4%5-6d.%7-8s %B, [%16-19r]!vstrb%v.%7-8s %13-15,22Q, [%16-19r, %1-3,5Q]vstrh%v.%7-8s %13-15,22Q, [%16-19r, %1-3,5Q%o]vstrw%v.%7-8s %13-15,22Q, [%16-19r, %1-3,5Q%o]vstrd%v.64 %13-15,22Q, [%16-19r, %1-3,5Q%o]vstrw%v.32 %13-15,22Q, [%17-19,7Q, #%a%0-6i]%wvstrd%v.64 %13-15,22Q, [%17-19,7Q, #%a%0-6i]%wvstrb%v.%7-8s %13-15Q, %dvstrh%v.%7-8s %13-15Q, %dvstrb%v.8 %13-15,22Q, %dvstrh%v.16 %13-15,22Q, %dvstrw%v.32 %13-15,22Q, %dvsub%v.f%20s %13-15,22Q, %17-19,7Q, %1-3,5Qvsub%v.f%28s %13-15,22Q, %17-19,7Q, %0-3rvsub%v.i%20-21s %13-15,22Q, %17-19,7Q, %1-3,5Qvsub%v.i%20-21s %13-15,22Q, %17-19,7Q, %0-3rasrl%c %17-19l, %9-11h, %jasrl%c %17-19l, %9-11h, %12-15Slsll%c %17-19l, %9-11h, %jlsll%c %17-19l, %9-11h, %12-15Slsrl%c %17-19l, %9-11h, %jsqrshrl%c %17-19l, %9-11h, %k, %12-15Ssqrshr%c %16-19S, %12-15Ssqshll%c %17-19l, %9-11h, %jsqshl%c %16-19S, %jsrshrl%c %17-19l, %9-11h, %jsrshr%c %16-19S, %juqrshll%c %17-19l, %9-11h, %k, %12-15Suqrshl%c %16-19S, %12-15Suqshll%c %17-19l, %9-11h, %juqshl%c %16-19S, %jurshrl%c %17-19l, %9-11h, %jurshr%c %16-19S, %jcsinc %8-11S, %16-19Z, %0-3Z, %4-7ccsinv %8-11S, %16-19Z, %0-3Z, %4-7ccset %8-11S, %4-7Ccsetm %8-11S, %4-7Ccsel %8-11S, %16-19Z, %0-3Z, %4-7ccsneg %8-11S, %16-19Z, %0-3Z, %4-7ccinc %8-11S, %16-19Z, %4-7Ccinv %8-11S, %16-19Z, %4-7Ccneg %8-11S, %16-19Z, %4-7Cvext%c.8 %12-15,22R, %16-19,7R, %0-3,5R, #%8-11dvdup%c.32 %16-19,7D, %12-15rvdup%c.16 %16-19,7D, %12-15rvdup%c.32 %16-19,7Q, %12-15rvdup%c.16 %16-19,7Q, %12-15rvdup%c.8 %16-19,7D, %12-15rvdup%c.8 %16-19,7Q, %12-15rvdup%c.32 %12-15,22R, %0-3,5D[%19d]vdup%c.16 %12-15,22R, %0-3,5D[%18-19d]vdup%c.8 %12-15,22R, %0-3,5D[%17-19d]vtbl%c.8 %12-15,22D, %F, %0-3,5Dvtbx%c.8 %12-15,22D, %F, %0-3,5Dvcvt%c.f16.f32 %12-15,22D, %0-3,5Qvcvt%c.f32.f16 %12-15,22Q, %0-3,5Dvfma%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvfma%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvfms%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvfms%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvdot.bf16 %12-15,22R, %16-19,7R, %0-3,5Rvdot.bf16 %12-15,22R, %16-19,7R, d%0-3d[%5d]vmmla.bf16 %12-15,22R, %16-19,7R, %0-3,5Rvcvt%c.bf16.f32 %12-15,22D, %0-3,5Qvfma%6?tb.bf16 %12-15,22Q, %16-19,7Q, %0-3,5Qvfma%6?tb.bf16 %12-15,22Q, %16-19,7Q, %0-2D[%3,5d]vsmmla.s8 %12-15,22R, %16-19,7R, %0-3,5Rvummla.u8 %12-15,22R, %16-19,7R, %0-3,5Rvusmmla.s8 %12-15,22R, %16-19,7R, %0-3,5Rvusdot.s8 %12-15,22R, %16-19,7R, %0-3,5Rvusdot.s8 %12-15,22R, %16-19,7R, d%0-3d[%5d]vsudot.u8 %12-15,22R, %16-19,7R, d%0-3d[%5d]vrint%7-9?p?m?zaxn%u.f32 %12-15,22R, %0-3,5Rvrint%7-9?p?m?zaxn%u.f16 %12-15,22R, %0-3,5Rvcvt%8-9?mpna%u.%7?us32.f32 %12-15,22R, %0-3,5Rvcvt%8-9?mpna%u.%7?us16.f16 %12-15,22R, %0-3,5Raese%u.8 %12-15,22Q, %0-3,5Qaesd%u.8 %12-15,22Q, %0-3,5Qaesmc%u.8 %12-15,22Q, %0-3,5Qaesimc%u.8 %12-15,22Q, %0-3,5Qsha1h%u.32 %12-15,22Q, %0-3,5Qsha1su1%u.32 %12-15,22Q, %0-3,5Qsha256su0%u.32 %12-15,22Q, %0-3,5Qvmovl%c.%24?us8 %12-15,22Q, %0-3,5Dvmovl%c.%24?us16 %12-15,22Q, %0-3,5Dvmovl%c.%24?us32 %12-15,22Q, %0-3,5Dvcnt%c.8 %12-15,22R, %0-3,5Rvmvn%c %12-15,22R, %0-3,5Rvswp%c %12-15,22R, %0-3,5Rvmovn%c.i%18-19T2 %12-15,22D, %0-3,5Qvqmovun%c.s%18-19T2 %12-15,22D, %0-3,5Qvqmovn%c.s%18-19T2 %12-15,22D, %0-3,5Qvqmovn%c.u%18-19T2 %12-15,22D, %0-3,5Qvshll%c.i%18-19S2 %12-15,22Q, %0-3,5D, #%18-19S2vrecpe%c.%8?fu%18-19S2 %12-15,22R, %0-3,5Rvrecpe%c.%8?fu16 %12-15,22R, %0-3,5Rvrsqrte%c.%8?fu%18-19S2 %12-15,22R, %0-3,5Rvrsqrte%c.%8?fu16 %12-15,22R, %0-3,5Rvrev64%c.%18-19S2 %12-15,22R, %0-3,5Rvrev32%c.%18-19S2 %12-15,22R, %0-3,5Rvrev16%c.%18-19S2 %12-15,22R, %0-3,5Rvcls%c.s%18-19S2 %12-15,22R, %0-3,5Rvclz%c.i%18-19S2 %12-15,22R, %0-3,5Rvqabs%c.s%18-19S2 %12-15,22R, %0-3,5Rvqneg%c.s%18-19S2 %12-15,22R, %0-3,5Rvtrn%c.%18-19S2 %12-15,22R, %0-3,5Rvuzp%c.%18-19S2 %12-15,22R, %0-3,5Rvzip%c.%18-19S2 %12-15,22R, %0-3,5Rvcgt%c.%10?fs%18-19S2 %12-15,22R, %0-3,5R, #0vcge%c.%10?fs%18-19S2 %12-15,22R, %0-3,5R, #0vceq%c.%10?fi%18-19S2 %12-15,22R, %0-3,5R, #0vcle%c.%10?fs%18-19S2 %12-15,22R, %0-3,5R, #0vclt%c.%10?fs%18-19S2 %12-15,22R, %0-3,5R, #0vabs%c.%10?fs%18-19S2 %12-15,22R, %0-3,5Rvneg%c.%10?fs%18-19S2 %12-15,22R, %0-3,5Rvpaddl%c.%7?us%18-19S2 %12-15,22R, %0-3,5Rvpadal%c.%7?us%18-19S2 %12-15,22R, %0-3,5Rvcvt%c.%7-8?usff%18-19Sa.%7-8?ffus%18-19Sa %12-15,22R, %0-3,5Rvcvt%c.%7-8?usff16.%7-8?ffus16 %12-15,22R, %0-3,5Rsha1c%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qsha1p%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qsha1m%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qsha1su0%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qsha256h%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qsha256h2%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qsha256su1%u.32 %12-15,22Q, %16-19,7Q, %0-3,5Qvmaxnm%u.f32 %12-15,22R, %16-19,7R, %0-3,5Rvmaxnm%u.f16 %12-15,22R, %16-19,7R, %0-3,5Rvminnm%u.f32 %12-15,22R, %16-19,7R, %0-3,5Rvminnm%u.f16 %12-15,22R, %16-19,7R, %0-3,5Rvand%c %12-15,22R, %16-19,7R, %0-3,5Rvbic%c %12-15,22R, %16-19,7R, %0-3,5Rvorr%c %12-15,22R, %16-19,7R, %0-3,5Rvorn%c %12-15,22R, %16-19,7R, %0-3,5Rveor%c %12-15,22R, %16-19,7R, %0-3,5Rvbsl%c %12-15,22R, %16-19,7R, %0-3,5Rvbit%c %12-15,22R, %16-19,7R, %0-3,5Rvbif%c %12-15,22R, %16-19,7R, %0-3,5Rvadd%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvadd%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvmla%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvmla%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvceq%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvceq%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvmax%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvmax%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvrecps%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvrecps%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvsub%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvsub%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvmls%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvmls%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvmin%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvmin%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvrsqrts%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvrsqrts%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvpadd%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvpadd%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvmul%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvmul%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvcge%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvcge%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvacge%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvacge%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvpmax%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvpmax%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvabd%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvabd%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvcgt%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvcgt%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvacgt%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvacgt%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvpmin%c.f32 %12-15,22R, %16-19,7R, %0-3,5Rvpmin%c.f16 %12-15,22R, %16-19,7R, %0-3,5Rvadd%c.i%20-21S3 %12-15,22R, %16-19,7R, %0-3,5Rvtst%c.%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvmla%c.i%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvqdmulh%c.s%20-21S6 %12-15,22R, %16-19,7R, %0-3,5Rvpadd%c.i%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvsub%c.i%20-21S3 %12-15,22R, %16-19,7R, %0-3,5Rvceq%c.i%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvmls%c.i%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvqrdmulh%c.s%20-21S6 %12-15,22R, %16-19,7R, %0-3,5Rvhadd%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvqadd%c.%24?us%20-21S3 %12-15,22R, %16-19,7R, %0-3,5Rvrhadd%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvhsub%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvqsub%c.%24?us%20-21S3 %12-15,22R, %16-19,7R, %0-3,5Rvcgt%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvcge%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvshl%c.%24?us%20-21S3 %12-15,22R, %0-3,5R, %16-19,7Rvqshl%c.%24?us%20-21S3 %12-15,22R, %0-3,5R, %16-19,7Rvrshl%c.%24?us%20-21S3 %12-15,22R, %0-3,5R, %16-19,7Rvqrshl%c.%24?us%20-21S3 %12-15,22R, %0-3,5R, %16-19,7Rvmax%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvmin%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvabd%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvaba%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvmul%c.%24?pi%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvpmax%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvpmin%c.%24?us%20-21S2 %12-15,22R, %16-19,7R, %0-3,5Rvqrdmlah%c.s%20-21S6 %12-15,22R, %16-19,7R, %0-3,5Rvqrdmlsh%c.s%20-21S6 %12-15,22R, %16-19,7R, %0-3,5Rvmov%c.i8 %12-15,22R, %Evmov%c.i64 %12-15,22R, %Evmov%c.f32 %12-15,22R, %Evmov%c.i16 %12-15,22R, %Evmvn%c.i16 %12-15,22R, %Evorr%c.i16 %12-15,22R, %Evbic%c.i16 %12-15,22R, %Evmov%c.i32 %12-15,22R, %Evmvn%c.i32 %12-15,22R, %Evorr%c.i32 %12-15,22R, %Evbic%c.i32 %12-15,22R, %Evshrn%c.i16 %12-15,22D, %0-3,5Q, #%16-18evrshrn%c.i16 %12-15,22D, %0-3,5Q, #%16-18evqshrun%c.s16 %12-15,22D, %0-3,5Q, #%16-18evqrshrun%c.s16 %12-15,22D, %0-3,5Q, #%16-18evqshrn%c.%24?us16 %12-15,22D, %0-3,5Q, #%16-18evqrshrn%c.%24?us16 %12-15,22D, %0-3,5Q, #%16-18evshll%c.%24?us8 %12-15,22Q, %0-3,5D, #%16-18dvshrn%c.i32 %12-15,22D, %0-3,5Q, #%16-19evrshrn%c.i32 %12-15,22D, %0-3,5Q, #%16-19evshl%c.%24?us8 %12-15,22R, %0-3,5R, #%16-18dvsri%c.8 %12-15,22R, %0-3,5R, #%16-18evsli%c.8 %12-15,22R, %0-3,5R, #%16-18dvqshlu%c.s8 %12-15,22R, %0-3,5R, #%16-18dvqshrun%c.s32 %12-15,22D, %0-3,5Q, #%16-19evqrshrun%c.s32 %12-15,22D, %0-3,5Q, #%16-19evqshrn%c.%24?us32 %12-15,22D, %0-3,5Q, #%16-19evqrshrn%c.%24?us32 %12-15,22D, %0-3,5Q, #%16-19evshll%c.%24?us16 %12-15,22Q, %0-3,5D, #%16-19dvshr%c.%24?us8 %12-15,22R, %0-3,5R, #%16-18evsra%c.%24?us8 %12-15,22R, %0-3,5R, #%16-18evrshr%c.%24?us8 %12-15,22R, %0-3,5R, #%16-18evrsra%c.%24?us8 %12-15,22R, %0-3,5R, #%16-18evqshl%c.%24?us8 %12-15,22R, %0-3,5R, #%16-18dvshrn%c.i64 %12-15,22D, %0-3,5Q, #%16-20evrshrn%c.i64 %12-15,22D, %0-3,5Q, #%16-20evshl%c.%24?us16 %12-15,22R, %0-3,5R, #%16-19dvsri%c.16 %12-15,22R, %0-3,5R, #%16-19evsli%c.16 %12-15,22R, %0-3,5R, #%16-19dvqshlu%c.s16 %12-15,22R, %0-3,5R, #%16-19dvshll%c.%24?us32 %12-15,22Q, %0-3,5D, #%16-20dvshr%c.%24?us16 %12-15,22R, %0-3,5R, #%16-19evsra%c.%24?us16 %12-15,22R, %0-3,5R, #%16-19evrshr%c.%24?us16 %12-15,22R, %0-3,5R, #%16-19evrsra%c.%24?us16 %12-15,22R, %0-3,5R, #%16-19evqshl%c.%24?us16 %12-15,22R, %0-3,5R, #%16-19dvqshrun%c.s64 %12-15,22D, %0-3,5Q, #%16-20evqrshrun%c.s64 %12-15,22D, %0-3,5Q, #%16-20evqshrn%c.%24?us64 %12-15,22D, %0-3,5Q, #%16-20evqrshrn%c.%24?us64 %12-15,22D, %0-3,5Q, #%16-20evshl%c.%24?us32 %12-15,22R, %0-3,5R, #%16-20dvsri%c.32 %12-15,22R, %0-3,5R, #%16-20evsli%c.32 %12-15,22R, %0-3,5R, #%16-20dvqshlu%c.s32 %12-15,22R, %0-3,5R, #%16-20dvshr%c.%24?us32 %12-15,22R, %0-3,5R, #%16-20evsra%c.%24?us32 %12-15,22R, %0-3,5R, #%16-20evrshr%c.%24?us32 %12-15,22R, %0-3,5R, #%16-20evrsra%c.%24?us32 %12-15,22R, %0-3,5R, #%16-20evqshl%c.%24?us32 %12-15,22R, %0-3,5R, #%16-20dvshl%c.%24?us64 %12-15,22R, %0-3,5R, #%16-21dvsri%c.64 %12-15,22R, %0-3,5R, #%16-21evsli%c.64 %12-15,22R, %0-3,5R, #%16-21dvqshlu%c.s64 %12-15,22R, %0-3,5R, #%16-21dvshr%c.%24?us64 %12-15,22R, %0-3,5R, #%16-21evsra%c.%24?us64 %12-15,22R, %0-3,5R, #%16-21evrshr%c.%24?us64 %12-15,22R, %0-3,5R, #%16-21evrsra%c.%24?us64 %12-15,22R, %0-3,5R, #%16-21evqshl%c.%24?us64 %12-15,22R, %0-3,5R, #%16-21dvcvt%c.%24,8?usff32.%24,8?ffus32 %12-15,22R, %0-3,5R, #%16-20evcvt%c.%24,8?usff16.%24,8?ffus16 %12-15,22R, %0-3,5R, #%16-20evmull%c.p64 %12-15,22Q, %16-19,7D, %0-3,5Dvmull%c.p%20S0 %12-15,22Q, %16-19,7D, %0-3,5Dvaddhn%c.i%20-21T2 %12-15,22D, %16-19,7Q, %0-3,5Qvsubhn%c.i%20-21T2 %12-15,22D, %16-19,7Q, %0-3,5Qvqdmlal%c.s%20-21S6 %12-15,22Q, %16-19,7D, %0-3,5Dvqdmlsl%c.s%20-21S6 %12-15,22Q, %16-19,7D, %0-3,5Dvqdmull%c.s%20-21S6 %12-15,22Q, %16-19,7D, %0-3,5Dvraddhn%c.i%20-21T2 %12-15,22D, %16-19,7Q, %0-3,5Qvrsubhn%c.i%20-21T2 %12-15,22D, %16-19,7Q, %0-3,5Qvaddl%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvaddw%c.%24?us%20-21S2 %12-15,22Q, %16-19,7Q, %0-3,5Dvsubl%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvsubw%c.%24?us%20-21S2 %12-15,22Q, %16-19,7Q, %0-3,5Dvabal%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvabdl%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvmlal%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvmlsl%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvmull%c.%24?us%20-21S2 %12-15,22Q, %16-19,7D, %0-3,5Dvmla%c.i%20-21S6 %12-15,22D, %16-19,7D, %Dvmla%c.f%20-21Sa %12-15,22D, %16-19,7D, %Dvmla%c.f16 %12-15,22D, %16-19,7D, %Dvqdmlal%c.s%20-21S6 %12-15,22Q, %16-19,7D, %Dvmls%c.i%20-21S6 %12-15,22D, %16-19,7D, %Dvmls%c.f%20-21S6 %12-15,22D, %16-19,7D, %Dvmls%c.f16 %12-15,22D, %16-19,7D, %Dvqdmlsl%c.s%20-21S6 %12-15,22Q, %16-19,7D, %Dvmul%c.i%20-21S6 %12-15,22D, %16-19,7D, %Dvmul%c.f%20-21Sa %12-15,22D, %16-19,7D, %Dvmul%c.f16 %12-15,22D, %16-19,7D, %Dvqdmull%c.s%20-21S6 %12-15,22Q, %16-19,7D, %Dvqdmulh%c.s%20-21S6 %12-15,22D, %16-19,7D, %Dvqrdmulh%c.s%20-21S6 %12-15,22D, %16-19,7D, %Dvmla%c.i%20-21S6 %12-15,22Q, %16-19,7Q, %Dvmla%c.f%20-21Sa %12-15,22Q, %16-19,7Q, %Dvmla%c.f16 %12-15,22Q, %16-19,7Q, %Dvmls%c.i%20-21S6 %12-15,22Q, %16-19,7Q, %Dvmls%c.f%20-21Sa %12-15,22Q, %16-19,7Q, %Dvmls%c.f16 %12-15,22Q, %16-19,7Q, %Dvmul%c.i%20-21S6 %12-15,22Q, %16-19,7Q, %Dvmul%c.f%20-21Sa %12-15,22Q, %16-19,7Q, %Dvmul%c.f16 %12-15,22Q, %16-19,7Q, %Dvqdmulh%c.s%20-21S6 %12-15,22Q, %16-19,7Q, %Dvqrdmulh%c.s%20-21S6 %12-15,22Q, %16-19,7Q, %Dvmlal%c.%24?us%20-21S6 %12-15,22Q, %16-19,7D, %Dvmlsl%c.%24?us%20-21S6 %12-15,22Q, %16-19,7D, %Dvmull%c.%24?us%20-21S6 %12-15,22Q, %16-19,7D, %Dvqrdmlah%c.s%20-21S6 %12-15,22D, %16-19,7D, %Dvqrdmlsh%c.s%20-21S6 %12-15,22D, %16-19,7D, %Dvqrdmlah%c.s%20-21S6 %12-15,22Q, %16-19,7Q, %Dvqrdmlsh%c.s%20-21S6 %12-15,22Q, %16-19,7Q, %Dvld4%c.32 %Cvld1%c.%6-7S2 %Cvld2%c.%6-7S2 %Cvld3%c.%6-7S2 %Cvld4%c.%6-7S2 %Cv%21?ls%21?dt1%c.%6-7S3 %Av%21?ls%21?dt2%c.%6-7S2 %Av%21?ls%21?dt3%c.%6-7S2 %Av%21?ls%21?dt4%c.%6-7S2 %Av%21?ls%21?dt1%c.%10-11S2 %Bv%21?ls%21?dt2%c.%10-11S2 %Bv%21?ls%21?dt3%c.%10-11S2 %Bv%21?ls%21?dt4%c.%10-11S2 %Bmcrr%c %8-11d, %4-7d, %12-15R, %16-19r, cr%0-3dmrrc%c %8-11d, %4-7d, %12-15Ru, %16-19Ru, cr%0-3dcdp%c %8-11d, %20-23d, cr%12-15d, cr%16-19d, cr%0-3d, {%5-7d}mrc%c %8-11d, %21-23d, APSR_nzcv, cr%16-19d, cr%0-3d, {%5-7d}mrc%c %8-11d, %21-23d, %12-15r, cr%16-19d, cr%0-3d, {%5-7d}mcr%c %8-11d, %21-23d, %12-15R, cr%16-19d, cr%0-3d, {%5-7d}stc%22'l%c %8-11d, cr%12-15d, %Aldc%22'l%c %8-11d, cr%12-15d, %Amrrc2%c %8-11d, %4-7d, %12-15Ru, %16-19Ru, cr%0-3dmcrr2%c %8-11d, %4-7d, %12-15R, %16-19R, cr%0-3dldc2%22'l%c %8-11d, cr%12-15d, %Astc2%22'l%c %8-11d, cr%12-15d, %Acdp2%c %8-11d, %20-23d, cr%12-15d, cr%16-19d, cr%0-3d, {%5-7d}mcr2%c %8-11d, %21-23d, %12-15R, cr%16-19d, cr%0-3d, {%5-7d}mrc2%c %8-11d, %21-23d, %12-15r, cr%16-19d, cr%0-3d, {%5-7d}mia%c acc0, %0-3r, %12-15rmiaph%c acc0, %0-3r, %12-15rmia%17'T%17`B%16'T%16`B%c acc0, %0-3r, %12-15rmar%c acc0, %12-15r, %16-19rmra%c %12-15r, %16-19r, acc0tandc%22-23w%c %12-15rtbcst%6-7w%c %16-19g, %12-15rtextrc%22-23w%c %12-15r, #%0-2dtextrm%3?su%22-23w%c %12-15r, %16-19g, #%0-2dtinsr%6-7w%c %16-19g, %12-15r, #%0-2dtmcr%c %16-19G, %12-15rtmcrr%c %0-3g, %12-15r, %16-19rtmia%17?tb%16?tb%c %5-8g, %0-3r, %12-15rtmia%c %5-8g, %0-3r, %12-15rtmiaph%c %5-8g, %0-3r, %12-15rtmovmsk%22-23w%c %12-15r, %16-19gtmrc%c %12-15r, %16-19Gtmrrc%c %12-15r, %16-19r, %0-3gtorc%22-23w%c %12-15rtorvsc%22-23w%c %12-15rwabs%22-23w%c %12-15g, %16-19gwacc%22-23w%c %12-15g, %16-19gwadd%20-23w%c %12-15g, %16-19g, %0-3gwaddbhus%22?ml%c %12-15g, %16-19g, %0-3gwaddsubhx%c %12-15g, %16-19g, %0-3gwaligni%c %12-15g, %16-19g, %0-3g, #%20-22dwalignr%20-21d%c %12-15g, %16-19g, %0-3gwand%20'n%c %12-15g, %16-19g, %0-3gwavg2%22?hb%20'r%c %12-15g, %16-19g, %0-3gwavg4%20'r%c %12-15g, %16-19g, %0-3gwcmpeq%22-23w%c %12-15g, %16-19g, %0-3gwcmpgt%21?su%22-23w%c %12-15g, %16-19g, %0-3gwldrd %12-15g, %rwldrw %12-15G, %Awldr%L%c %12-15g, %lwmac%21?su%20'z%c %12-15g, %16-19g, %0-3gwmadd%21?su%20'x%c %12-15g, %16-19g, %0-3gwmadd%21?sun%c %12-15g, %16-19g, %0-3gwmax%21?su%22-23w%c %12-15g, %16-19g, %0-3gwmerge%c %12-15g, %16-19g, %0-3g, #%21-23dwmia%21?tb%20?tb%22'n%c %12-15g, %16-19g, %0-3gwmiaw%21?tb%20?tb%22'n%c %12-15g, %16-19g, %0-3gwmin%21?su%22-23w%c %12-15g, %16-19g, %0-3gwmul%21?su%20?ml%23'r%c %12-15g, %16-19g, %0-3gwmul%21?sumr%c %12-15g, %16-19g, %0-3gwmulwsm%20`r%c %12-15g, %16-19g, %0-3gwmulwum%20`r%c %12-15g, %16-19g, %0-3gwmulwl%c %12-15g, %16-19g, %0-3gwqmia%21?tb%20?tb%22'n%c %12-15g, %16-19g, %0-3gwqmulm%21'r%c %12-15g, %16-19g, %0-3gwqmulwm%21'r%c %12-15g, %16-19g, %0-3gwor%c %12-15g, %16-19g, %0-3gwpack%20-23w%c %12-15g, %16-19g, %0-3gwror%22-23w %12-15g, %16-19g, #%iwror%22-23w%c %12-15g, %16-19g, %0-3gwror%22-23wg%c %12-15g, %16-19g, %0-3Gwsad%22?hb%20'z%c %12-15g, %16-19g, %0-3gwshufh%c %12-15g, %16-19g, #%Zwsll%22-23w %12-15g, %16-19g, #%iwsll%22-23w%8'g%c %12-15g, %16-19g, %0-3gwsll%22-23w%8'g%c %12-15g, %16-19g, %0-3Gwsra%22-23w %12-15g, %16-19g, #%iwsra%22-23w%8'g%c %12-15g, %16-19g, %0-3gwsra%22-23w%8'g%c %12-15g, %16-19g, %0-3Gwsrl%22-23w %12-15g, %16-19g, #%iwsrl%22-23w%8'g%c %12-15g, %16-19g, %0-3gwsrl%22-23w%8'g%c %12-15g, %16-19g, %0-3Gwstrd %12-15g, %rwstrw %12-15G, %Awstr%L%c %12-15g, %lwsub%20-23w%c %12-15g, %16-19g, %0-3gwsubaddhx%c %12-15g, %16-19g, %0-3gwabsdiff%22-23w%c %12-15g, %16-19g, %0-3gwunpckeh%21?sub%c %12-15g, %16-19gwunpckeh%21?suh%c %12-15g, %16-19gwunpckeh%21?suw%c %12-15g, %16-19gwunpckel%21?su%22-23w%c %12-15g, %16-19gwunpckih%22-23w%c %12-15g, %16-19g, %0-3gwunpckil%22-23w%c %12-15g, %16-19g, %0-3gwxor%c %12-15g, %16-19g, %0-3gadf%c%P%R %12-14f, %16-18f, %0-3fmuf%c%P%R %12-14f, %16-18f, %0-3fsuf%c%P%R %12-14f, %16-18f, %0-3frsf%c%P%R %12-14f, %16-18f, %0-3fdvf%c%P%R %12-14f, %16-18f, %0-3frdf%c%P%R %12-14f, %16-18f, %0-3fpow%c%P%R %12-14f, %16-18f, %0-3frpw%c%P%R %12-14f, %16-18f, %0-3frmf%c%P%R %12-14f, %16-18f, %0-3ffml%c%P%R %12-14f, %16-18f, %0-3ffdv%c%P%R %12-14f, %16-18f, %0-3ffrd%c%P%R %12-14f, %16-18f, %0-3fpol%c%P%R %12-14f, %16-18f, %0-3fmvf%c%P%R %12-14f, %0-3fmnf%c%P%R %12-14f, %0-3fabs%c%P%R %12-14f, %0-3frnd%c%P%R %12-14f, %0-3fsqt%c%P%R %12-14f, %0-3flog%c%P%R %12-14f, %0-3flgn%c%P%R %12-14f, %0-3fexp%c%P%R %12-14f, %0-3fsin%c%P%R %12-14f, %0-3fcos%c%P%R %12-14f, %0-3ftan%c%P%R %12-14f, %0-3fasn%c%P%R %12-14f, %0-3facs%c%P%R %12-14f, %0-3fatn%c%P%R %12-14f, %0-3furd%c%P%R %12-14f, %0-3fnrm%c%P%R %12-14f, %0-3fflt%c%P%R %16-18f, %12-15rfix%c%R %12-15r, %0-2fwfs%c %12-15rrfs%c %12-15rwfc%c %12-15rrfc%c %12-15rcmf%c %16-18f, %0-3fcnf%c %16-18f, %0-3fcmfe%c %16-18f, %0-3fcnfe%c %16-18f, %0-3fstf%c%Q %12-14f, %Aldf%c%Q %12-14f, %Asfm%c %12-14f, %F, %Alfm%c %12-14f, %F, %Avscclrm%c %Cvlldm %16-19rvlstm %16-19rvpush%c %Bvstmdb%c %16-19r!, %Bvldmdb%c %16-19r!, %Bvstmia%c %16-19r%21'!, %Bvpop%c %Bvldmia%c %16-19r%21'!, %Bvstr%c %12-15,22D, %Avldr%c %12-15,22D, %Avpush%c %y3vstmdb%c %16-19r!, %y3vldmdb%c %16-19r!, %y3vstmia%c %16-19r%21'!, %y3vpop%c %y3vldmia%c %16-19r%21'!, %y3vstr%c %y1, %Avldr%c %y1, %Avldr%c %J, %Kvstr%c %J, %Kfstmdbx%c %16-19r!, %z3 ;@ Deprecatedfldmdbx%c %16-19r!, %z3 ;@ Deprecatedfstmiax%c %16-19r%21'!, %z3 ;@ Deprecatedfldmiax%c %16-19r%21'!, %z3 ;@ Deprecatedvmov%c %0-3,5D, %12-15r, %16-19rvmov%c %12-15r, %16-19r, %0-3,5Dvmov%c.32 %16-19,7D[%21d], %12-15rvmov%c.32 %12-15r, %16-19,7D[%21d]vmov%c.16 %16-19,7D[%6,21d], %12-15rvmov%c.%23?us16 %12-15r, %16-19,7D[%6,21d]vmov%c.8 %16-19,7D[%5,6,21d], %12-15rvmov%c.%23?us8 %12-15r, %16-19,7D[%5,6,21d]vcvt%7?tb%c.f64.f16 %z1, %y0vcvt%7?tb%c.f16.f64 %y1, %z0vcvt%7?tb%c.f32.f16 %y1, %y0vcvt%7?tb%c.f16.f32 %y1, %y0vmsr%c fpsid, %12-15rvmsr%c fpscr, %12-15rvmsr%c fpscr_nzcvqc, %12-15rvmsr%c mvfr1, %12-15rvmsr%c mvfr0, %12-15rvmsr%c mvfr2, %12-15rvmsr%c fpexc, %12-15rvmsr%c fpinst, %12-15r @ Impl defvmsr%c fpinst2, %12-15r @ Impl defvmsr%c vpr, %12-15rvmsr%c p0, %12-15rvmsr%c fpcxt_ns, %12-15rvmsr%c fpcxt_s, %12-15rvmrs%c %12-15r, fpsidvmrs%c APSR_nzcv, fpscrvmrs%c %12-15r, fpscrvmrs%c %12-15r, fpscr_nzcvqcvmrs%c %12-15r, mvfr2vmrs%c %12-15r, mvfr1vmrs%c %12-15r, mvfr0vmrs%c %12-15r, fpexcvmrs%c %12-15r, fpinst @ Impl defvmrs%c %12-15r, fpinst2 @ Impl defvmrs%c %12-15r, vprvmrs%c %12-15r, p0vmrs%c %12-15r, fpcxt_nsvmrs%c %12-15r, fpcxt_svmov%c.32 %z2[%21d], %12-15rvmov%c.32 %12-15r, %z2[%21d]vmsr%c , %12-15rvmrs%c %12-15r, vmov%c %y2, %12-15rvmov%c %12-15r, %y2vcmp%7'e%c.f32 %y1, #0.0vcmp%7'e%c.f64 %z1, #0.0vmov%c.f32 %y1, %y0vabs%c.f32 %y1, %y0vmov%c.f64 %z1, %z0vabs%c.f64 %z1, %z0vneg%c.f32 %y1, %y0vsqrt%c.f32 %y1, %y0vneg%c.f64 %z1, %z0vsqrt%c.f64 %z1, %z0vcvt%c.f64.f32 %z1, %y0vcvt%c.f32.f64 %y1, %z0vcvt%c.f32.%7?su32 %y1, %y0vcvt%c.f64.%7?su32 %z1, %y0vcmp%7'e%c.f32 %y1, %y0vcmp%7'e%c.f64 %z1, %z0vcvt%c.f32.%16?us%7?31%7?26 %y1, %y1, #%5,0-3kvcvt%c.f64.%16?us%7?31%7?26 %z1, %z1, #%5,0-3kvcvt%7`r%c.%16?su32.f32 %y1, %y0vcvt%7`r%c.%16?su32.f64 %y1, %z0vcvt%c.%16?us%7?31%7?26.f32 %y1, %y1, #%5,0-3kvcvt%c.%16?us%7?31%7?26.f64 %z1, %z1, #%5,0-3kvmov%c %12-15r, %16-19r, %z0vmov%c.f32 %y1, #%0-3,16-19Evmov%c.f64 %z1, #%0-3,16-19Evmov%c %y4, %12-15r, %16-19rvmov%c %z0, %12-15r, %16-19rvmov%c %12-15r, %16-19r, %y4vmla%c.f32 %y1, %y2, %y0vmls%c.f32 %y1, %y2, %y0vmla%c.f64 %z1, %z2, %z0vmls%c.f64 %z1, %z2, %z0vnmls%c.f32 %y1, %y2, %y0vnmla%c.f32 %y1, %y2, %y0vnmls%c.f64 %z1, %z2, %z0vnmla%c.f64 %z1, %z2, %z0vmul%c.f32 %y1, %y2, %y0vnmul%c.f32 %y1, %y2, %y0vmul%c.f64 %z1, %z2, %z0vnmul%c.f64 %z1, %z2, %z0vadd%c.f32 %y1, %y2, %y0vsub%c.f32 %y1, %y2, %y0vadd%c.f64 %z1, %z2, %z0vsub%c.f64 %z1, %z2, %z0vdiv%c.f32 %y1, %y2, %y0vdiv%c.f64 %z1, %z2, %z0cfldrs%c mvf%12-15d, %Acfldrd%c mvd%12-15d, %Acfldr32%c mvfx%12-15d, %Acfldr64%c mvdx%12-15d, %Acfstrs%c mvf%12-15d, %Acfstrd%c mvd%12-15d, %Acfstr32%c mvfx%12-15d, %Acfstr64%c mvdx%12-15d, %Acfmvsr%c mvf%16-19d, %12-15rcfmvrs%c %12-15r, mvf%16-19dcfmvdlr%c mvd%16-19d, %12-15rcfmvrdl%c %12-15r, mvd%16-19dcfmvdhr%c mvd%16-19d, %12-15rcfmvrdh%c %12-15r, mvd%16-19dcfmv64lr%c mvdx%16-19d, %12-15rcfmvr64l%c %12-15r, mvdx%16-19dcfmv64hr%c mvdx%16-19d, %12-15rcfmvr64h%c %12-15r, mvdx%16-19dcfmval32%c mvax%12-15d, mvfx%16-19dcfmv32al%c mvfx%12-15d, mvax%16-19dcfmvam32%c mvax%12-15d, mvfx%16-19dcfmv32am%c mvfx%12-15d, mvax%16-19dcfmvah32%c mvax%12-15d, mvfx%16-19dcfmv32ah%c mvfx%12-15d, mvax%16-19dcfmva32%c mvax%12-15d, mvfx%16-19dcfmv32a%c mvfx%12-15d, mvax%16-19dcfmva64%c mvax%12-15d, mvdx%16-19dcfmv64a%c mvdx%12-15d, mvax%16-19dcfmvsc32%c dspsc, mvdx%12-15dcfmv32sc%c mvdx%12-15d, dspsccfcpys%c mvf%12-15d, mvf%16-19dcfcpyd%c mvd%12-15d, mvd%16-19dcfcvtsd%c mvd%12-15d, mvf%16-19dcfcvtds%c mvf%12-15d, mvd%16-19dcfcvt32s%c mvf%12-15d, mvfx%16-19dcfcvt32d%c mvd%12-15d, mvfx%16-19dcfcvt64s%c mvf%12-15d, mvdx%16-19dcfcvt64d%c mvd%12-15d, mvdx%16-19dcfcvts32%c mvfx%12-15d, mvf%16-19dcfcvtd32%c mvfx%12-15d, mvd%16-19dcftruncs32%c mvfx%12-15d, mvf%16-19dcftruncd32%c mvfx%12-15d, mvd%16-19dcfrshl32%c mvfx%16-19d, mvfx%0-3d, %12-15rcfrshl64%c mvdx%16-19d, mvdx%0-3d, %12-15rcfsh32%c mvfx%12-15d, mvfx%16-19d, #%Icfsh64%c mvdx%12-15d, mvdx%16-19d, #%Icfcmps%c %12-15r, mvf%16-19d, mvf%0-3dcfcmpd%c %12-15r, mvd%16-19d, mvd%0-3dcfcmp32%c %12-15r, mvfx%16-19d, mvfx%0-3dcfcmp64%c %12-15r, mvdx%16-19d, mvdx%0-3dcfabss%c mvf%12-15d, mvf%16-19dcfabsd%c mvd%12-15d, mvd%16-19dcfnegs%c mvf%12-15d, mvf%16-19dcfnegd%c mvd%12-15d, mvd%16-19dcfadds%c mvf%12-15d, mvf%16-19d, mvf%0-3dcfaddd%c mvd%12-15d, mvd%16-19d, mvd%0-3dcfsubs%c mvf%12-15d, mvf%16-19d, mvf%0-3dcfsubd%c mvd%12-15d, mvd%16-19d, mvd%0-3dcfmuls%c mvf%12-15d, mvf%16-19d, mvf%0-3dcfmuld%c mvd%12-15d, mvd%16-19d, mvd%0-3dcfabs32%c mvfx%12-15d, mvfx%16-19dcfabs64%c mvdx%12-15d, mvdx%16-19dcfneg32%c mvfx%12-15d, mvfx%16-19dcfneg64%c mvdx%12-15d, mvdx%16-19dcfadd32%c mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfadd64%c mvdx%12-15d, mvdx%16-19d, mvdx%0-3dcfsub32%c mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfsub64%c mvdx%12-15d, mvdx%16-19d, mvdx%0-3dcfmul32%c mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfmul64%c mvdx%12-15d, mvdx%16-19d, mvdx%0-3dcfmac32%c mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfmsc32%c mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfmadd32%c mvax%5-7d, mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfmsub32%c mvax%5-7d, mvfx%12-15d, mvfx%16-19d, mvfx%0-3dcfmadda32%c mvax%5-7d, mvax%12-15d, mvfx%16-19d, mvfx%0-3dcfmsuba32%c mvax%5-7d, mvax%12-15d, mvfx%16-19d, mvfx%0-3dvfma%c.f32 %y1, %y2, %y0vfma%c.f64 %z1, %z2, %z0vfms%c.f32 %y1, %y2, %y0vfms%c.f64 %z1, %z2, %z0vfnma%c.f32 %y1, %y2, %y0vfnma%c.f64 %z1, %z2, %z0vfnms%c.f32 %y1, %y2, %y0vfnms%c.f64 %z1, %z2, %z0vsel%20-21c%u.f32 %y1, %y2, %y0vsel%20-21c%u.f64 %z1, %z2, %z0vmaxnm%u.f32 %y1, %y2, %y0vmaxnm%u.f64 %z1, %z2, %z0vminnm%u.f32 %y1, %y2, %y0vminnm%u.f64 %z1, %z2, %z0vcvt%16-17?mpna%u.%7?su32.f32 %y1, %y0vcvt%16-17?mpna%u.%7?su32.f64 %y1, %z0vrint%7,16??xzr%c.f32 %y1, %y0vrint%7,16??xzr%c.f64 %z1, %z0vrint%16-17?mpna%u.f32 %y1, %y0vrint%16-17?mpna%u.f64 %z1, %z0vcadd%c.f16 %12-15,22V, %16-19,7V, %0-3,5V, #%24?29%24'70vcadd%c.f32 %12-15,22V, %16-19,7V, %0-3,5V, #%24?29%24'70vcmla%c.f16 %12-15,22V, %16-19,7V, %0-3,5V, #%23'90vcmla%c.f16 %12-15,22V, %16-19,7V, %0-3,5V, #%23?21%23?780vcmla%c.f32 %12-15,22V, %16-19,7V, %0-3,5V, #%23'90vcmla%c.f32 %12-15,22V, %16-19,7V, %0-3,5V, #%23?21%23?780vcmla%c.f16 %12-15,22V, %16-19,7V, %0-3D[%5?10], #%20'90vcmla%c.f16 %12-15,22V, %16-19,7V, %0-3D[%5?10], #%20?21%20?780vcmla%c.f32 %12-15,22V, %16-19,7V, %0-3,5D[0], #%20'90vcmla%c.f32 %12-15,22V, %16-19,7V, %0-3,5D[0], #%20?21%20?780vcvt%7?tb%b.bf16.f32 %y1, %y0v%4?usdot.%4?us8 %12-15,22V, %16-19,7V, %0-3,5Vv%4?usdot.%4?us8 %12-15,22V, %16-19,7V, %0-3D[%5?10]vfmal.f16 %12-15,22D, s%7,16-19d, s%5,0-3dvfmsl.f16 %12-15,22D, s%7,16-19d, s%5,0-3dvfmal.f16 %12-15,22Q, d%16-19,7d, d%0-3,5dvfmsl.f16 %12-15,22Q, d%16-19,7d, d%0-3,5dvfmal.f16 %12-15,22D, s%7,16-19d, s%5,0-2d[%3d]vfmsl.f16 %12-15,22D, s%7,16-19d, s%5,0-2d[%3d]vfmal.f16 %12-15,22Q, d%16-19,7d, d%0-2d[%3,5d]vfmsl.f16 %12-15,22Q, d%16-19,7d, d%0-2d[%3,5d]vabs%c.f16 %y1, %y0vadd%c.f16 %y1, %y2, %y0vcmp%7'e%c.f16 %y1, %y0vcmp%7'e%c.f16 %y1, #0.0vcvt%c.f16.%16?us%7?31%7?26 %y1, %y1, #%5,0-3kvcvt%c.%16?us%7?31%7?26.f16 %y1, %y1, #%5,0-3kvcvt%7`r%c.%16?su32.f16 %y1, %y0vcvt%c.f16.%7?su32 %y1, %y0vcvt%16-17?mpna%u.%7?su32.f16 %y1, %y0vdiv%c.f16 %y1, %y2, %y0vfma%c.f16 %y1, %y2, %y0vfms%c.f16 %y1, %y2, %y0vfnma%c.f16 %y1, %y2, %y0vfnms%c.f16 %y1, %y2, %y0vins.f16 %y1, %y0vmovx%c.f16 %y1, %y0vldr%c.16 %y1, %Avstr%c.16 %y1, %Avmaxnm%c.f16 %y1, %y2, %y0vminnm%c.f16 %y1, %y2, %y0vmla%c.f16 %y1, %y2, %y0vmls%c.f16 %y1, %y2, %y0vmov%c.f16 %12-15r, %y2vmov%c.f16 %y2, %12-15rvmov%c.f16 %y1, #%0-3,16-19Evmul%c.f16 %y1, %y2, %y0vneg%c.f16 %y1, %y0vnmla%c.f16 %y1, %y2, %y0vnmls%c.f16 %y1, %y2, %y0vnmul%c.f16 %y1, %y2, %y0vrint%7,16??xzr%c.f16 %y1, %y0vrint%16-17?mpna%u.f16 %y1, %y0vsel%20-21c%u.f16 %y1, %y2, %y0vsqrt%c.f16 %y1, %y0vsub%c.f16 %y1, %y2, %y0vjcvt%c.s32.f64 %y1, %z0cx1%a %p, %12-15n, #%0-5,7,16-21dcx1d%a %p, %12-15S, %12-15T, #%0-5,7,16-21dcx2%a %p, %12-15n, %16-19n, #%0-5,7,20-21dcx2d%a %p, %12-15S, %12-15T, %16-19n, #%0-5,7,20-21dcx3%a %p, %0-3n, %16-19n, %12-15n, #%4-5,7,20-22dcx3d%a %p, %0-3S, %0-3T, %16-19n, %12-15n, #%4-5,7,20-22dvcx1%a %p, %12-15,22V, #%0-5,7,16-19dvcx1%a %p, %12-15,22V, #%0-5,7,16-19,24dvcx2%a %p, %12-15,22V, %0-3,5V, #%4,7,16-19dvcx2%a %p, %12-15,22V, %0-3,5V, #%4,7,16-19,24dvcx3%a %p, %12-15,22V, %16-19,7V, %0-3,5V, #%4,20-21dvcx3%a %p, %12-15,22V, %16-19,7V, %0-3,5V, #%4,20-21,24dprint_insn_mvemark_inside_vpt_blockUnknown error %d Address 0x%s is out of bounds. ctf_arc_write(): cannot determine file position while writing to archivectf_arc_write(): cannot write CTF file to archivectf_arc_write(): cannot get current file position in archivectf_arc_write(): cannot write name table to archivectf_arc_write(): error writing named CTF to archivearc_mmap_writeout(): cannot write header to %s: %sarc_mmap_writeout(): cannot seek while writing header to %s: %sctf_arc_write(): cannot extend file while writingctf_arc_write(): cannot mmapWriting CTF archive with %lu files headersz is %lu ctf_arc_write(): cannot create %sctf_arc_write(): cannot close after writing to archivectf_arc_open(): cannot stat %sctf_arc_open(): cannot read in %sctf_arc_open(): %s: invalid magic numberctf_arc_open(): cannot open %sctf_arc_bufopen(): cannot open CTFctf_dict_open_internal(%s): opening ctf_dict_open_by_offset(%lu): opening Unknown errorFile is not in CTF or ELF format.BFD error.CTF dict version is too new for libctf.Ambiguous BFD target.Symbol table uses invalid entry size.Symbol table data buffer is not valid.String table data buffer is not valid.File data structure corruption detected.File does not contain CTF data.Buffer does not contain CTF data.Symbol table information is not available.The parent CTF dictionary is unavailable.Data model mismatch.File added to link too late.Failed to allocate (de)compression buffer.Failed to decompress CTF data.External string table is not available.String name offset is corrupt.Invalid type identifier.Type is not a struct or union.Type is not an enum.Type is not a struct, union, or enum.Type is not an integer, float, or enum.Type is not an array.Type does not reference another type.Buffer is too small to hold type name.No type found corresponding to name.Syntax error in type name.Symbol table entry or type is not a function.No function information available for function.Symbol table entry does not refer to a data object.No type information available for symbol.No label found corresponding to name.File does not contain any labels.Feature not supported.Enum element name not found.Member name not found.CTF container is read-only.CTF type is full (no more members allowed).CTF container is full.Duplicate member or variable name.Conflicting type is already defined.Attempt to roll back past a ctf_update.Failed to compress CTF data.Error creating CTF archive.Name not found in CTF archive.Overflow of type bitness or offset in slice.Unknown section number in dump.Section changed in middle of dump.Feature not yet implemented.Internal error: assertion failure.Type not representable in CTF.End of iteration.Wrong iteration function called.Iteration entity changed in mid-iterate.CTF header contains flags unknown to libctf.This feature needs a libctf with BFD support.Type is not a complete type.Type name must not be empty."-Uk(JuCb{9`2\ 7NqCcAn../../libctf/ctf-lookup.c!sym.st_nameidx_setIndex section unsorted: sorting.Looking up type of object with symtab idx %lx or name %s in indexed symtypetab cannot sort function symidxcannot sort object symidx%s not found in idx Symbol %lx (%s) is of type %x Looking up type of object with symname %s in writable dict symtypetab Looking up type of object with symtab idx %lx in writable dict symtypetab fp->ctf_flags & LCTF_RDWR!sym->st_nameidx_setLooking up object type %lx in 1:1 dict symtypetab cannot allocate memory for symbol lookup hashtab_Restrict *ctf_lookup_symbol_namectf_set_base: CU name %s ctf_set_base: parent name %s (label %s) loaded %lu symtab entries detected invalid CTF kind: %x../../libctf/ctf-open.c!(fp->ctf_flags & LCTF_RDWR)cth->cth_stroff >= cth->cth_typeoffsize == v2sizevbytes == v2bytes(size_t) t2p - (size_t) fp->ctf_buf == cth->cth_stroffCTF dict %p is a child CTF dict %p is a parent init_types(): unhandled CTF kind: %x%lu total types processed %u enum names hashed %u struct names hashed (%d long) %u union names hashed (%d long) %u base type names hashed ctf_dict_close(%p) refcnt=%u init_symtab (fp, fp->ctf_header, &fp->ctf_symtab) == 0ctf_bufopen: magic=0x%x version=%u ctf_bufopen: CTF version %d symsect not supportedctf_bufopen: invalid header flags: %xctf_bufopen: uncompressed size=%lu header offset exceeds CTF sizeoverlapping CTF sectionsCTF sections not properly alignedObject index section exists is neither empty nor the same length as the object section: %u versus %u bytesFunction index section exists is neither empty nor the same length as the function section: %u versus %u byteszlib inflate err: %szlib inflate short: got %lu of %lu bytesvbytes == 0vbytes == sizeof (ctf_array_t)vbytes == sizeof (ctf_slice_t)unhandled CTF kind in endianness conversion: %xILP32LP64init_typesupgrade_types_v1ctf_symsect_endiannessflip_types.ctf_START__END_../../libctf/ctf-serialize.citerating over linker-known symbols during serializationsymbol %s (%x) added to CTF as a function but is of type %x. The symbol type lookup tables are probably corruptedsymbol %s (%x) added to CTF as a data object but is of type %x. The symbol type lookup tables are probably corruptediterating over CTF symtypetab during serializationiterating over linker-known symbols during CTF serializationEmitting table of size %i, outmax %u, %u symtypetab entries, flags %i (((char *) dpp) - (char *) dp) < sizeEmitting index of size %i, %u entries reported by linker, flags %i !(flags & CTF_SYMTYPETAB_EMIT_PAD)this_link_sym != NULL(((char *) dpp) - (char *) dp) <= sizefp->ctf_str_num_refs == 0Object symtypetab: %i objects, max %i, unpadded size %i, %i bytes of pads, index size %i Function symtypetab: %i functions, max %i, unpadded size %i, %i bytes of pads, index size %i error serializing symtypetabsEmitting unindexed objt symtypetab Emitting indexed objt symtypetab Emitting unindexed func symtypetab Emitting indexed func symtypetab t == (unsigned char *) buf + sizeof (ctf_header_t) + hdr.cth_varoffi == nvarst == (unsigned char *) buf + sizeof (ctf_header_t) + hdr.cth_typeofft == (unsigned char *) buf + sizeof (ctf_header_t) + hdr.cth_stroffnum_missed_str_refs == 0ctf_compress_write: cannot allocate %li byteszlib deflate err: %sctf_compress_write: error writing headerctf_compress_write: error writingctf_write_mem: cannot allocate %li bytesctf_write: error writing headerctf_write: error writingctf_serialize(?)null string not found in strtab%lu bytes of strings in strtab. LIBCTF_DEBUGlibctf DEBUG: ctf_version: client using version %d CTF debugging set to %i %s: %s (%s) %s: %lu: libctf assertion failed: %sn < LCTF_INFO_VLEN (fp, tp->ctt_info)../../libctf/ctf-types.c(n + 1) * sizeof (ctf_lmember_t) <= vbytestype %lx cycle detected(i->ctn_next == NULL)(*) (struct %sunion %s(nonrepresentable type)(nonrepresentable type %s)%p: attempt to realloc() string table with %lu active refs cannot close BFD: %s.strtab.symtabcannot read symbol tablecannot read string tableCTF section is NULLcannot malloc symbol table../../libctf/ctf-open-bfd.csymhdr->sh_entsize == get_elf_backend_data (abfd)->s->sizeof_symctf_bfdopen(): %s: %sctf_bfdopen(): cannot malloc CTF section: %s(unknown file)cannot open BFD from %s: %sBFD format problem in %s: %sctf_bfdopen_ctfsectconflict due to enum %s iteration errorconflict due to enum value change: %i versus %iconflict due to struct member %s iteration errorconflict due to struct member %s offset change: %lx versus %lxkind == CTF_K_INTEGER || kind == CTF_K_FLOAT../../libctf/ctf-create.cctf_add_array: index type %lx is incompletectf_add_unknown: cannot add unknown type named %s: type of this name already defined(unnamed member)ctf_add_member_offset: cannot add member %s of incomplete type %lx to struct %lx without specifying explicit offset ctf_add_member_offset: cannot add member %s of type %lx to struct %lx without specifying explicit offset after member %s of type %lx, which is an incomplete type ctf_add_type: conflict for type %s: kinds differ, new: %i; old (ID %lx): %iconflict for type %s against ID %lx: array info differs, old %lx/%lx/%x; new: %lx/%lx/%xconflict for type %s against ID %lx: union size differs, old %li, new %liconflict for type %s against ID %lx: members differ, see aboveconflict for enum %s against ID %lx: members differ, see above../../libctf/ctf-dedup.cone_ninput < arg->ninputs && two_ninput < arg->ninputsone_type != two_typeu Marking %s as conflicted Out of memory marking %s as conflicted ctf_dynhash_elements (d->cd_output_mapping) > 0Looked up type kind by nonexistent hash %s. Counting hash %s: kind %i: num_non_forwards is %i Using synthetic forward for conflicted struct/union with hval %s Cross-TU conflicted struct: passing back forward, %lx %i/%lx: unimplemented type Mapping %i/%lx to target %p (%s) parents[input_num] <= ninputshval && td->cd_output_emission_hashescannot add synthetic forward for type %i/%lxLooking up %i/%lx, hash %s, in target Checking shared parent for target (target != output) && (target->ctf_flags & LCTF_CHILD)target_idfunction argsfloat/intpointer or cvr-qualstructure/union%i: Emitting type with hash %s from %s: determining target %i: Type %s in %i/%lx is conflicted: inserting into per-CU target. cannot create per-CU CTF archive for CU %sunnamed-CU%s: lookup failure for type %lx%i: Emitting type with hash %s (%s), into target %i/%p %s (%i): cannot add enumeration value %s from input type %lx%i: Noting need to emit members of %p -> %p %s: unknown type kind for input type %lxout of memory tracking deduplicated global type IDsout of memory creating emission-tracking hashes%s (%i): while emitting deduplicated %s, error getting input type %lx%s (%i): while emitting deduplicated %s, error emitting target type from input type %lx%i: Inserted %s, %i/%lx -> %lx into emission hash for target %p (%s) looked up type kind by nonexistent hash %sout of memory tracking already-visited typescannot walk conflicted typeerror during func type info lookuperror doing memory allocationerror doing func arg type lookuperror during array info lookupCTF dict corruption: unknown type kind%lu: Starting walk over type %s, %i/%lx (%p), from %s, kind %i Walking: unimplemented type Looking up ID %i/%lx in type hashes hashval%s in input file %s at type ID %lxID %i/%lx has hash %s error doing array contents type hashingerror doing array index type hashingerror getting func type infoerror getting func arg typeerror getting func return typeerror doing func arg type hashingerror getting encodingerror getting array infoerror doing enum member iterationerror doing struct/union member type hashingerror doing struct/union member iterationerror doing referenced type hashingerror doing slice-referenced type hashingerror: unknown type kinderror tracking citerserror updating citerscannot intern hash%s (%i): out of memory during forwarding-stub hashing for type with GID %p%s (%i): %s: during type hashing for type %lx, kind %ierror hash cachingerror calling population function00000000000000000000%s (%i): lookup failure for type %lx: flags %x%s (%i): %s: during type hashing, type %lx, kind %ierror finding commonest conflicting typemarking uncommon conflicting typeserror marking conflicting structs/unionsscanning for ambiguous namesctf_dedup_init: cannot initialize: out of memoryInput %i: %s ctf_dedup: cannot initialize: %s Computing type hashes iteration failure computing type hashesDetecting type name ambiguity Marking %p, with hash %s, conflicting: one of many non-forward GIDs for %s Marking %s, an uncommon hash for %s, conflicting error marking hashes as conflictingiteration failed: %sConflictifying unshared types type_idsiteration error propagating conflictednessconflictifying unshared typesTriggering emission. cannot recurse over output mappingPopulating struct members. %s (%i): error emitting members for structure type %lxiteration failure emitting structure members!cu_mapped || (cu_mapped && num_outputs == 1)out of memory allocating link outputs arraydict %p passed to ctf_dedup_type_mapping is not a deduplicated outputfound != 0hval != NULLsort_output_mappingid_to_packed_idcannot create per-CU CTF archive for input CU %sopening CTF %s failediteration error counting deduplicating CTF link inputserror in deduplicating CTF link input allocationiteration error in deduplicating link input freeingiterating over function symbolsiterating over data symbolsctf_type_isparent (fp, dst_type)../../libctf/ctf-link.ctype %lx for symbol %s in input file %s not found: skippedsymbol %s in input file %s found conflicting even when trying in per-CU dict.Inexpressible duplicate variable %s skipped. Variable %s in input file %s depends on a type %lx hidden due to conflicts: skipped. type %lx for variable %s in input file %s not found: skipped(unnamed)iteration error creating empty CUsallocating CTF dedup atoms tablecannot open archive %s in CU-mapped CTF linkcannot add intermediate files to linkcannot create per-CU CTF archive for %sCU-mapped deduplication failed for %sCU-mapped deduplicating link type emission failed for %snoutputs == 1CU-mapped deduplicating link variable emission failed for %siteration error in CU-mapped deduplicating linkoutputs[0] == fpout of memory allocating link outputsdeduplicating link symbol emission failed for %sdid->cid_sym.st_name != NULLsymbol from linker: %s (%x) No symbols: not a final link. symp->st_symidx <= fp->ctf_dynsymmaxerror iterating over shuffled symbolsname reallocationctf_dict reallocationtempfile creationseeking to endfilesize determinationfilepos resettingCTF archive buffer allocationreading archive from temporary filehash creationarchive writinglinker input %s has CTF func info but uses an old, unreleased func info format: this func info section will be dropped.error checking for outdated inputscannot write archive in link: %s failure0123456789abcdef../../bfd/archive.c%-10lu! ! __.SYMDEF __.SYMDEF/ / /SYM64/ #1/20 __.SYMDEF SORTED__.SYMDEFARFILENAMES/ // %-ld:%-ldARFILENAMES/#1/%lu%pB: plugin needed to handle lto object__gnu_lto_slim%-12ld%-8lowarning: writing archive was slow: rewriting timestampReading archive file mod timestampWriting updated armap timestamp%-7lobfd_dont_truncate_arnameUNKNOWN!error reading %s: %s(GNU Binutils) 2.37.50BFD %s assertion fail %s:%dBFD %s internal error, aborting at %s:%d in %s BFD %s internal error, aborting at %s:%d Please report this bug. ../../bfd/bfd.c-+ #0'IhlLBFD: %s[%s]coff-go32aixcoff-rs6000aix5coff64-rs6000mach-oZLIB.note.gnu.propertyno errorsystem call errorinvalid bfd targetarchive object file in wrong formatinvalid operationno symbolsarchive has no index; run ranlib to add oneno more archived filesmalformed archiveDSO missing from command linefile format not recognizedfile format is ambiguoussection has no contentsnonrepresentable section on outputsymbol needs debug section which does not existfile truncatedfile too bigsorry, cannot handle this file#bfd_set_errorbfd_set_input_error_bfd_doprnt_scanerror_handler_internal_bfd_doprnt_bfd_set_gp_valuebfd_update_compression_header../../bfd/bfdio.cZ ../../bfd/cache.cr+reopening %pB: %s cache_bmmapbfd_cache_lookup_worker1.2.11error: %pB(%pA) section size (%#llx bytes) is larger than file size (%#llx bytes)error: %pB(%pA) is too large (%#llx bytes)../../bfd/compress.cbfd_get_full_section_contentsbfd_is_section_compressed_with_headerbfd_compress_section_contentsbfd_init_section_decompress_status../../bfd/elf-properties.c%pB: out of memory in _bfd_elf_get_propertywarning: %pB: corrupt GNU_PROPERTY_TYPE (%ld) size: %#lxwarning: %pB: corrupt GNU_PROPERTY_TYPE (%ld) type (0x%x) datasz: 0x%xwarning: %pB: corrupt stack size: 0x%xwarning: %pB: corrupt no copy on protected size: 0x%xerror: %pB: warning: %pB: unsupported GNU_PROPERTY_TYPE (%ld) type: 0x%xMerging program properties Removed property %W to merge %pB (0x%v) and %pB (0x%v) Removed property %W to merge %pB (0x%v) and %pB (not found) Removed property %W to merge %pB and %pB Removed property %W to merge %pB and %pB (not found) Updated property %W (0x%v) to merge %pB (0x%v) and %pB (0x%v) Updated property %W (%v) to merge %pB (0x%v) and %pB (not found) Removed property %W to merge %pB (not found) and %pB (0x%v) elf_merge_gnu_propertieself_write_gnu_properties_bfd_elf_get_propertyelf_merge_gnu_property_list../../bfd/format.c../../bfd/hash.c=???bfd_hash_renamebfd_hash_replace../../bfd/libbfd.c%pB: unable to get decompressed section %pADeprecated %s called at %s line %d in %s Deprecated %s called bfd_put_bitsbfd_get_bits_bfd_generic_get_section_contents_in_window../../bfd/opncls.c.gnu_debuglink%s.debug/%s/usr/lib/debug/usr.note.gnu.build-id.gnu_debugaltlink0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-bfd_fdopenr../../bfd/section.c*ABS**COM**UND**IND*bfd_get_unique_section_namebfd_map_over_sectionsunknown file formata.outXCOFFTekhexSrecVerilogIhexSOMOS9KVersadosMSDOSOvaxEvaxmmoMACH_OPEFPEF_XLIB../../bfd/targets.carm-*-fuchsia*armeb-*-netbsdelf*arm-*-netbsdelf*arm-*-nto*nto*arm*arm-*-phoenix*armeb-*-elfarm*b-*-freebsd*arm*b-*-linux-*armeb-*-eabi*arm-*-kaos*arm-*-elfarm*-*-freebsd*arm*-*-linux-*arm*-*-conix*arm*-*-uclinux*arm-*-kfreebsd*-gnuarm*-*-eabi*arm-*-rtems*arm*-*-uclinuxfdpiceabiarm9e-*-elfbfd_flavour_name_binary_%s_%s%pB: address %#llx out of range for Intel Hex file\%03o%pB:%d: unexpected character `%s' in Intel Hex file../../bfd/ihex.c%pB: internal error in ihex_read_section%pB: bad section length in ihex_read_section%pB:%u: bad checksum in Intel Hex file (expected %u, found %u).sec%d%pB:%u: bad extended address record length in Intel Hex file%pB:%u: bad extended start address length in Intel Hex file%pB:%u: bad extended linear address record length in Intel Hex file%pB:%u: bad extended linear start address length in Intel Hex file%pB:%u: unrecognized ihex type %u in Intel Hex file0123456789ABCDEF %-5s %s../../bfd/srec.c%pB:%d: unexpected character `%s' in S-record file$$ $$ %pB:%d: byte count %d too small%pB:%d: bad checksum in S-record filesymbolsrec0123456789ABCDEF../../bfd/tekhex.c%0781010 0123456789ABCDEFouttekhex_write_object_contents0123456789ABCDEF../../bfd/elf32-arm.c%pB: error: Cortex-A8 erratum stub is allocated in unsafe location%pB: error: Cortex-A8 erratum stub out of range (input file too large)error: %pB: unknown CPU architectureerror: %pB: conflicting CPU architectures %d/%dSHF_ARM_PURECODE%08x_%s+%x_%d%08x_%x:%x+%x_%dERROR: CMSE stub (%s section) too far (%#llx) from destination (%#llx).note.gnu.arm.ident_TLS_MODULE_BASE___stacksize.rofixupIWMMXT2IWMMXTXSCALEprivate flags = 0x%lx: [interworking enabled] [APCS-26] [APCS-32] [VFP float format] [Maverick float format] [FPA float format] [floats passed in float registers] [position independent] [new ABI] [old ABI] [software FP] [Version1 EABI] [sorted symbol table] [unsorted symbol table] [Version2 EABI] [dynamic symbols use segment index] [mapping symbols precede others] [Version3 EABI] [Version4 EABI] [Version5 EABI] [soft-float ABI] [hard-float ABI] [BE8] [LE8] [relocatable executable] [FDPIC ABI supplement] warning: clearing the interworking flag of %pB because non-interworking code in %pB has been linked with it%pB: unsupported relocation type %#x%pB: unknown mandatory EABI object attribute %dwarning: %pB: unknown EABI object attribute %dwarning: not setting interworking flag of %pB since it has already been specified as non-interworkingwarning: clearing the interworking flag of %pB due to outside requestno address assigned to the veneers output section %s.__stub%pB: cannot create stub entry %s__%s_from_thumb__%s_from_arm__%s_veneer.rel.plt+0x.gnu.linkonce.armexidx.Error: %pB has both the current and legacy Tag_MPextension_use attributeserror: %pB uses VFP register arguments, %pB does noterror: %pB: unable to merge virtualization attributes with %pBerror: %pB: conflicting architecture profiles %c/%cwarning: %pB: conflicting platform configurationerror: %pB: conflicting use of R9error: %pB: SB relative addressing conflicts with use of R9warning: %pB uses %u-byte wchar_t yet the output is to use %u-byte wchar_t; use of wchar_t values across objects may failwarning: %pB uses %s enums yet the output is to use %s enums; use of enum values across objects may failerror: %pB uses iWMMXt register arguments, %pB does noterror: fp16 format mismatch between %pB and %pBerror: %pB is already in final BE8 format.glue_7.glue_7terror: source object %pB has EABI version %d, but target %pB has EABI version %derror: %pB is compiled for APCS-%d, whereas target %pB uses APCS-%derror: %pB passes floats in float registers, whereas %pB passes them in integer registerserror: %pB passes floats in integer registers, whereas %pB passes them in float registersVFPerror: %pB uses %s instructions, whereas %pB does notFPAMaverickerror: %pB does not use %s instructions, whereas %pB doeserror: %pB uses software FP, whereas %pB uses hardware FPerror: %pB uses hardware FP, whereas %pB uses software FPwarning: %pB supports interworking, whereas %pB does notwarning: %pB does not support interworking, whereas %pB doesThumbunable to find %s glue '%s' for '%s'%pB: error: VFP11 veneer out of range%pB(%#llx): error: cannot create STM32L4XX veneer; jump out of range by %lld bytes; cannot encode branch instruction%pB: error: cannot create STM32L4XX veneer.vfp11_veneer.text.stm32l4xx_veneer.v4_bxARM%pB(%s): warning: interworking not enabled; first occurrence: %pB: %s call to %s%pB(%pA): warning: long branch veneers used in section with SHF_ARM_PURECODE section attribute is only supported for M-profile targets that implement the movw instruction.rel.iplt.rela.iplta local symbol.igot.plt%pB: bad symbol index: %d%pB: relocation %s against `%s' can not be used when making a shared object; recompile with -fPICFDPIC does not yet support %s relocation to become dynamic for executable%pB: Number of symbols in input file has increased from %lu to %u %pB: warning: thumb-1 mode PLT generation not currently supported__real_%s.tls_vars.rela.pltcould not find section %sPIE executable(local)local symbol index too bigdynamic index information not available%pB: relocation %s against external or undefined symbol `%s' can not be used when making a %s; recompile with -fPIC%pB: warning: %s BLX instruction targets %s function '%s'%pB: expected symbol index in range 0..%lu but found local symbol with index %lu%pB(%pA+%#llx): unexpected %s instruction '%#lx' referenced by TLS_GOTDESC%pB(%pA+%#llx): %s relocation not permitted in shared object%pB(%pA+%#llx): only ADD or SUB instructions are allowed for ALU group relocations%pB(%pA+%#llx): overflow whilst splitting %#llx for group relocation %sno dynamic index information availableinvalid dynamic index%F%P: Could not assign '%pA' to an output section. Retry without --enable-non-contiguous-regions. %pB(%pA+%#llx): %s used with TLS symbol %s%pB(%pA+%#llx): %s used with non-TLS symbol %s%pB(%pA+%#llx): %s relocation against SEC_MERGE section%pB(%pA+%#llx): unexpected %s instruction '%#lx' in TLS trampoline%pB(%pA+%#llx): unresolvable %s relocation against symbol `%s'unsupported relocation%pB: special symbol `%s' only allowed for ARMv8-M architecture or later%pB: invalid special symbol `%s'; it must be a global or weak function symbol%pB: invalid standard symbol `%s'; it must be a global or weak function symbol%pB: absent standard symbol `%s'%pB: `%s' and its special symbol are in different sections%pB: entry function `%s' not output%pB: entry function `%s' is empty%pB: --in-implib only supported for Secure Gateway import libraries%pB: invalid import library entry: `%s'; symbol should be absolute, global and refer to Thumb functionsentry function `%s' disappeared from secure code`%s' refers to a non entry function%pB: visibility of symbol `%s' has changed%pB: incorrect size for symbol `%s'offset of veneer for entry function `%s' not a multiple of its sizenew entry function(s) introduced but no output import library specified:start address of `%s' is different from previous link%pB: BE8 images only valid in big-endian mode__bx_r%d%pB: warning: selected VFP11 erratum workaround is not necessary for target architecture%pB: warning: selected STM32L4XX erratum workaround is not necessary for target architecture__vfp11_veneer_%x__vfp11_veneer_%x_r$aVFP11%pB: unable to find %s veneer `%s'__stm32l4xx_veneer_%xSTM32L4XX__stm32l4xx_veneer_%x_r%pB(%pA+%#x): error: multiple load detected in non-last IT block instruction: STM32L4XX veneer cannot be generated; use gcc option -mrestrict-it to generate only one instruction per IT block$terrors encountered processing file %pB.relgot-relinvalid TARGET2 relocation type '%s'variable-size32-bitPre v4ARM v4ARM v4TARM v5TARM v5TEARM v5TEJARM v6ARM v6KZARM v6T2ARM v6KARM v7ARM v6-MARM v6S-MARM v8ARM v8-M.baselineARM v8-M.mainline$delf32-littlearm-vxworkself32-bigarm-vxworksaeabi.ARM.attributeself32-littlearm-fdpicelf32-bigarm-fdpicelf32-littlearm-naclelf32-bigarm-naclelf32-littlearmelf32-bigarmR_ARM_RREL32R_ARM_RABS32R_ARM_RPC24R_ARM_RBASER_ARM_IRELATIVER_ARM_GOTFUNCDESCR_ARM_GOTOFFFUNCDESCR_ARM_FUNCDESCR_ARM_FUNCDESC_VALUER_ARM_TLS_GD32_FDPICR_ARM_TLS_LDM32_FDPICR_ARM_TLS_IE32_FDPICR_ARM_NONER_ARM_PC24R_ARM_ABS32R_ARM_REL32R_ARM_LDR_PC_G0R_ARM_ABS16R_ARM_ABS12R_ARM_THM_ABS5R_ARM_ABS8R_ARM_SBREL32R_ARM_THM_CALLR_ARM_THM_PC8R_ARM_BREL_ADJR_ARM_TLS_DESCR_ARM_SWI8R_ARM_XPC25R_ARM_THM_XPC22R_ARM_TLS_DTPMOD32R_ARM_TLS_DTPOFF32R_ARM_TLS_TPOFF32R_ARM_COPYR_ARM_GLOB_DATR_ARM_JUMP_SLOTR_ARM_RELATIVER_ARM_GOTOFF32R_ARM_GOTPCR_ARM_GOT32R_ARM_PLT32R_ARM_CALLR_ARM_JUMP24R_ARM_THM_JUMP24R_ARM_BASE_ABSR_ARM_ALU_PCREL_7_0R_ARM_ALU_PCREL_15_8R_ARM_ALU_PCREL_23_15R_ARM_LDR_SBREL_11_0R_ARM_ALU_SBREL_19_12R_ARM_ALU_SBREL_27_20R_ARM_TARGET1R_ARM_ROSEGREL32R_ARM_V4BXR_ARM_TARGET2R_ARM_PREL31R_ARM_MOVW_ABS_NCR_ARM_MOVT_ABSR_ARM_MOVW_PREL_NCR_ARM_MOVT_PRELR_ARM_THM_MOVW_ABS_NCR_ARM_THM_MOVT_ABSR_ARM_THM_MOVW_PREL_NCR_ARM_THM_MOVT_PRELR_ARM_THM_JUMP19R_ARM_THM_JUMP6R_ARM_THM_ALU_PREL_11_0R_ARM_THM_PC12R_ARM_ABS32_NOIR_ARM_REL32_NOIR_ARM_ALU_PC_G0_NCR_ARM_ALU_PC_G0R_ARM_ALU_PC_G1_NCR_ARM_ALU_PC_G1R_ARM_ALU_PC_G2R_ARM_LDR_PC_G1R_ARM_LDR_PC_G2R_ARM_LDRS_PC_G0R_ARM_LDRS_PC_G1R_ARM_LDRS_PC_G2R_ARM_LDC_PC_G0R_ARM_LDC_PC_G1R_ARM_LDC_PC_G2R_ARM_ALU_SB_G0_NCR_ARM_ALU_SB_G0R_ARM_ALU_SB_G1_NCR_ARM_ALU_SB_G1R_ARM_ALU_SB_G2R_ARM_LDR_SB_G0R_ARM_LDR_SB_G1R_ARM_LDR_SB_G2R_ARM_LDRS_SB_G0R_ARM_LDRS_SB_G1R_ARM_LDRS_SB_G2R_ARM_LDC_SB_G0R_ARM_LDC_SB_G1R_ARM_LDC_SB_G2R_ARM_MOVW_BREL_NCR_ARM_MOVT_BRELR_ARM_MOVW_BRELR_ARM_THM_MOVW_BREL_NCR_ARM_THM_MOVT_BRELR_ARM_THM_MOVW_BRELR_ARM_TLS_GOTDESCR_ARM_TLS_CALLR_ARM_TLS_DESCSEQR_ARM_THM_TLS_CALLR_ARM_PLT32_ABSR_ARM_GOT_ABSR_ARM_GOT_PRELR_ARM_GOT_BREL12R_ARM_GOTOFF12R_ARM_GNU_VTENTRYR_ARM_GNU_VTINHERITR_ARM_THM_JUMP11R_ARM_THM_JUMP8R_ARM_TLS_GD32R_ARM_TLS_LDM32R_ARM_TLS_LDO32R_ARM_TLS_IE32R_ARM_TLS_LE32R_ARM_TLS_LDO12R_ARM_TLS_LE12R_ARM_TLS_IE12GPR_ARM_THM_TLS_DESCSEQR_ARM_THM_ALU_ABS_G0_NCR_ARM_THM_ALU_ABS_G1_NCR_ARM_THM_ALU_ABS_G2_NCR_ARM_THM_ALU_ABS_G3_NCR_ARM_THM_BF16R_ARM_THM_BF12R_ARM_THM_BF18      GX[\YZ ijhg eff3dgc4`k&l'm o*n)Z[]\ hjiklxyz{|}~edp+q,r-s.t/u0v1w29:;<=>?@ABCDEFGHIJKLMNOPQRS(_`aarm_dedicated_stub_output_section_requiredarm_dedicated_stub_output_section_namearm_dedicated_stub_input_section_ptrarm_dedicated_stub_output_section_required_alignmentarm_stub_sym_claimedelf32_arm_update_relocsbfd_arm_vfp11_insn_decodeelf32_arm_create_dynamic_sections   elf32_arm_add_dynrelocelf32_arm_allocate_dynrelocself32_arm_write_sectionelf32_arm_check_relocs _M  - allocate_dynrelocs_for_symbol@-?/  ?/ -  //elf32_arm_final_link_relocatearm_stub_required_alignmentbfd_elf32_arm_vfp11_erratum_scanrecord_vfp11_erratum_veneerbfd_elf32_arm_vfp11_fix_veneer_locationsbfd_elf32_arm_stm32l4xx_fix_veneer_locationsrecord_stm32l4xx_erratum_veneer ?/p% ?/ p%xGxG /HFD`GxG / / xGxGxG/ @/ 0`G_HF`G/../../bfd/elfcode.hwarning: %pB has a section extending past end of file%pB: version count (%lld) does not match symbol count (%ld)%pB(%pA): relocation %d has invalid symbol index %ldwarning: %pB has a corrupt string table index - ignoringwarning: %pB has a program header with invalid alignmentwarning: %pB is truncated: expected core file size >= %llu, found: %llubfd_elf32_swap_symbol_outbfd_elf32_write_relocs../../bfd/elf-nacl.c__GOTT_BASE____GOTT_INDEX__.rela.plt.unloaded.rel.plt.unloaded.tls_dataINTERPEH_FRAMESTACKRELRO../../bfd/elf.c%pB: invalid sh_link field (%d) in section number %d%pB: failed to find link section for section %d%pB: failed to find info section for section %d%pB: GNU_MBIND section `%pA' has invalid sh_info field: %dstapsdt.rela.shstrtab%pB: attempt to load strings from a non-string section (number %d)%pB: invalid string offset %u >= %llu for section `%s'%pB symbol number %lu references nonexistent SHT_SYMTAB_SHNDX section%pB: sh_link [%d] in section `%pA' is incorrect%pB: SHT_GROUP section [index %d] has no SHF_GROUP sections%pB: section group entry number %u is corrupt%pB: unknown type [%#x] section `%s' in group [%pA]Base(*none*)elf %s %-11s .internal .hidden .protected 0x%02x%pB: warning: loop in section dependencies detected%pB: warning: multiple symbol tables detected - ignoring the table in section %u%pB: warning: multiple dynamic symbol tables detected - ignoring the table in section %u%pB: invalid link %u for reloc section %s (index %u)%pB: warning: secondary relocation section '%s' for section %pA found - ignoring%pB: unknown type [%#x] section `%s'%pB: invalid size field in group section header: %#llx%pB: invalid entry in SHT_GROUP section [%u]%pB: no valid group sections found%pB: group section '%pA' has no contents%pB: no group info for section '%pA'.gnu.debuglto_.debug_.gnu.linkonce.wi..zdebug.gnu.build.attributes.note.gnu.line.gnu.linkonce%pB: unable to initialize compress status for section %s%pB: unable to initialize decompress status for section %s.gnu.lto_.lto.%s%d%s%pB: error: alignment power %d of section `%pA' is too bigwarning: section `%pA' type changed to PROGBITS%pB: TLS sections are not adjacent: TLS: %pA non-TLS: %pA.gnu.libstr*unknown*.symtab_shndx%pB: too many sections: %u%pB: sh_link of section `%pA' points to discarded section `%pA' of `%pB'%pB: sh_link of section `%pA' points to removed section `%pA' of `%pB'%pB: Unable to handle section index %x in ELF symbol. Using ABS instead.unable to find equivalent output section for symbol '%s' from section '%s'%pB: The first section in the PT_DYNAMIC segment is not the .dynamic section%pB: not enough room for program headers, try linking with -N%pB: section %pA lma %#llx adjusted to %#llx%pB: error: PHDR segment not covered by LOAD segment%pB: section `%pA' can't be allocated in segment %dLOPROC+%7.7xLOOS+%7.7x%8.8x__ehdr_start%pB: warning: allocated section `%s' not in segment%pB: error: non-load segment %d includes file header and/or program header%pB: symbol `%s' required but not present%pB: warning: segment alignment of %#llx is too large%pB: warning: empty loadable segment detected at vaddr=%#llx, is this intentional?%pB: .gnu.version_r invalid entry%pB: .gnu.version_d invalid entryNEEDEDPLTGOTRELASZRELAENTSTRSZSYMENTINITFINISONAMERPATHSYMBOLICRELENTRELRSZRELRENTJMPRELFINI_ARRAYFINI_ARRAYSZRUNPATHPREINIT_ARRAYPREINIT_ARRAYSZCHECKSUMPLTPADSZMOVEENTMOVESZFEATUREPOSFLAG_1SYMINSZSYMINENTCONFIGDEPAUDITPLTPADMOVETABSYMINFORELACOUNTRELCOUNTFLAGS_1VERSYMVERDEFVERDEFNUMVERNEEDVERNEEDNUMAUXILIARYUSEDFILTERGNU_HASHPLTRELSZ Program Header: %8s off 0x vaddr 0x paddr 0x align 2**%u filesz 0x memsz 0x flags %c%c%c Dynamic Section: %-20s Version definitions: %d 0x%2.2x 0x%8.8lx %s Version References: required from %s: 0x%8.8lx 0x%2.2x %2.2d %s %pB:%pA: error: attempting to write into an unallocated compressed section%pB:%pA: error: attempting to write over the end of the section%pB:%pA: error: attempting to write section into an empty buffer%pB: %s unsupported%s/%d.qnx_core_info.qnx_core_status/%ld.qnx_core_status.reg-xfp.note.netbsdcore.lwpstatus.thrmisc.note.freebsdcore.proc.note.freebsdcore.files.note.freebsdcore.vmmap.reg-xstate.note.freebsdcore.lwpinfowin32%pB: warning: win32pstatus %s of size %lu bytes is too small.reg/%ld.module/%08lx.module/%016lx%pB: win32pstatus NOTE_INFO_MODULE of size %lu is too small to contain a name of size %uLINUX.reg-ppc-vmx.reg-ppc-vsx.reg-ppc-tar.reg-ppc-ppr.reg-ppc-dscr.reg-ppc-ebb.reg-ppc-pmu.reg-ppc-tm-cgpr.reg-ppc-tm-cfpr.reg-ppc-tm-cvmx.reg-ppc-tm-cvsx.reg-ppc-tm-spr.reg-ppc-tm-ctar.reg-ppc-tm-cppr.reg-ppc-tm-cdscr.reg-s390-high-gprs.reg-s390-timer.reg-s390-todcmp.reg-s390-todpreg.reg-s390-ctrs.reg-s390-prefix.reg-s390-last-break.reg-s390-system-call.reg-s390-tdb.reg-s390-vxrs-low.reg-s390-vxrs-high.reg-s390-gs-cb.reg-s390-gs-bc.reg-arc-v2.reg-aarch-tls.reg-aarch-hw-break.reg-aarch-hw-watch.reg-aarch-sve.reg-aarch-pauth.reg-aarch-mte.reg-riscv-csrphdreh_frame_hdrrelroGNU_MBIND section is supported only by GNU and FreeBSD targetssymbol type STT_GNU_IFUNC is supported only by GNU and FreeBSD targetssymbol binding STB_GNU_UNIQUE is supported only by GNU and FreeBSD targetsGNU_RETAIN section is supported only by GNU and FreeBSD targets%pB(%pA): link section cannot be set because the output file does not have a symbol table%pB(%pA): info section index is invalid%pB(%pA): info section index cannot be set because the section is not in the output%pB(%pA): error: secondary reloc section processed twice%pB(%pA): error: secondary reloc section has zero sized entries%pB(%pA): error: secondary reloc section has non-standard sized entries%pB(%pA): error: secondary reloc section is empty!%pB(%pA): error: internal relocs missing for secondary reloc section%pB(%pA): error: secondary reloc %u references a missing symbol%pB(%pA): error: secondary reloc %u references a deleted symbol%pB(%pA): error: secondary reloc %u is of an unknown typeNOTE_INFO_PROCESSNOTE_INFO_THREADNOTE_INFO_MODULENOTE_INFO_MODULE64NetBSD-COREQNXSPU/LARGE_COMMON.tbss.tdata.rodata1.persistent.bss.persistent.preinit_array.noinit.note.GNU-stack.note.init_array.gnu.linkonce.b.gnu.linkonce.n.gnu.linkonce.p.gnu.lto_.gnu.version.gnu.version_d.gnu.version_r.gnu.hash.fini_array.data1.commentSHT_NULLSHT_PROGBITSSHT_SYMTABSHT_STRTABSHT_RELASHT_HASHSHT_DYNAMICSHT_NOTESHT_NOBITSSHT_RELSHT_SHLIBSHT_DYNSYMget_program_header_sizebfd_elf_get_elf_symsassign_file_positions_for_non_load_sections_bfd_elf_assign_file_positions_for_non_load_bfd_elf_get_lineno_bfd_elf_no_info_to_howto../../bfd/elflink.c%P%X: can not read symbols: %E %pB:%pA: error: relocation references symbol %s which was removed by garbage collection%pB:%pA: error: try relinking with --gc-keep-exported enabled%pB: bad reloc symbol index (%#llx >= %#lx) for offset %#llx in section `%pA'%pB: non-zero symbol index (%#llx) for offset %#llx in section `%pA' when the object file has no symbol table%pB: too many sections: %d (>= %d)%pB: internal symbol `%s' in %pB is referenced by DSO%pB: hidden symbol `%s' in %pB is referenced by DSO%pB: local symbol `%s' in %pB is referenced by DSO%pB: protected symbol `%s' isn't defined%pB: internal symbol `%s' isn't defined%pB: hidden symbol `%s' isn't defined%pB: could not find output section %pA for input section %pA%pB: no symbol version section for versioned symbol `%s'undefined %s reference in complex symbol: %s0-division by zerounknown operator '%c' in complex symbol.rela.got.rel.got.rela.bss.rel.bss.rela.data.rel.ro.rel.data.rel.ro_PROCEDURE_LINKAGE_TABLE_%pB: version node not found for symbol %swarning: type and size of dynamic symbol `%s' are not defined%s: TLS definition in %pB section %pA mismatches non-TLS definition in %pB section %pA%s: TLS reference in %pB mismatches non-TLS reference in %pB%s: TLS definition in %pB section %pA mismatches non-TLS reference in %pB%s: TLS reference in %pB mismatches non-TLS definition in %pB section %pA%pB: relocation size mismatch in %pB section %pA%P: copy reloc against protected `%pT' is dangerous .rela.dyn.rel.dynalternate ELF machine code found (%d) in %pB, expecting %d.gnu.warning.%pB: invalid version offset %lx (max %lx)%pB: %s local symbol at index %lu (>= sh_info of %lu).tcommon%pB: not enough version information%pB: %s: invalid version %u (max %d)%pB: %s: invalid needed version %d%pB: unexpected redefinition of indirect versioned symbol `%s'warning: alignment %u of common symbol `%s' in %pB is greater than the alignment (%u) of its section %pAwarning: alignment %u of symbol `%s' in %pB is smaller than %u in %pBwarning: size of symbol `%s' changed from %llu in %pB to %llu in %pBwarning: type of symbol `%s' changed from %d to %d in %pB%!%pB: undefined reference to symbol '%s'%pB: stack size specified and %s set%pB: %s not absolute%s: undefined version: %s%pB: .preinit_array section is not allowed in DSO.MIPS.xhash.gcc_except_tablewarning: --enable-non-contiguous-regions discards section `%s' from '%s' .ctors.dtorserror: %pB: size of section %pA is not multiple of address sizeerror: %pB contains a reloc (%#llx) for section %pA that references a non-existent global symbol%X`%s' referenced in section `%pA' of %pB: defined in discarded section `%pA' of %pB ELFCLASS32ELFCLASSNONE.gnu.attributes%pB: file class %s incompatible with %s%pB: failed to generate import library%pB: no symbol found for import library%pB: unable to sort relocs - they are in more than one size%pB: unable to sort relocs - they are of an unknown sizenot enough memory to sort relocationswarning: %s section has zero sizewarning: section '%s' is being made into a note%P%X: read-only segment has dynamic relocations %P: warning: creating DT_TEXTREL in a shared object %P: warning: creating DT_TEXTREL in a PDE %P: warning: creating DT_TEXTREL in a PIE %F%P: corrupt input: %pB .debug_line.__patchable_function_entries%F%P: %pB(%pA): error: need linked-to section for --gc-sections .eh_frame_entrywarning: gc-sections option ignoredremoving unused section '%pA' in file '%pB'%pB: %pA+%#llx: no symbol found for INHERIT%pB: section '%pA': corrupt VTENTRY entryunrecognized INPUT_SECTION_FLAG %s .gnu.linkonce..gnu.linkonce.t.%F%P: already_linked_table: %E .gnu.linkonce.r.%pB: dynamic relocation against `%pT' in read-only section `%pA' %P: %pB: warning: relocation against `%s' in read-only section `%pA' -fPIE%P: warning: GNU indirect functions with DT_TEXTREL may result in a segfault at runtime; recompile with %s SHF_WRITESHF_ALLOCSHF_EXECINSTRSHF_MERGESHF_STRINGSSHF_INFO_LINKSHF_LINK_ORDERSHF_OS_NONCONFORMINGSHF_GROUPSHF_TLSSHF_MASKOSSHF_EXCLUDEelf_link_adjust_relocself_link_convert_common_typeelf_link_check_versioned_symbol%Ca  @elf_link_output_extsymelf_link_add_object_symbolsbfd_elf_size_dynsym_hash_dynstrget_valueput_valueelf_link_input_bfdbfd_elf_final_linkelf_reloc_link_order../../bfd/elf-attrs.c%pB: error: attribute section '%pA' too big: %#llx%pB: error: attribute section length too small: %lderror: %pB: object has vendor-specific contents that must be processed by the '%s' toolchainerror: %pB: object tag '%d, %s' is incompatible with tag '%d, %s'bfd_elf_set_obj_attr_contents_bfd_elf_obj_attrs_arg_type_bfd_elf_copy_obj_attributes_bfd_elf_parse_attributes../../bfd/elf-strtab.c../../bfd/elf-eh-frame.cehdiscarding zero address range FDE in %pB(%pA). error in %pB(%pA); no .eh_frame_hdr table will be createdFDE encoding in %pB(%pA) prevents .eh_frame_hdr table being createdfurther warnings about FDE encoding preventing .eh_frame_hdr generation dropped__GNU_EH_FRAME_HDR%pB: %pA not in order%pB: %pA invalid input section size%pB: %pA points past end of text sectionDW_EH_PE_datarel unspecified for this architectureinvalid output section for .eh_frame_entry: %pAinvalid contents in %pA section.eh_frame_hdr entry overflow.eh_frame_hdr refers to overlapping FDEs_bfd_elf_fixup_eh_frame_hdrwrite_compact_eh_frame_hdrDWARF error: can't find %s section.DWARF error: section %s is larger than its filesize! (0x%lx vs 0x%lx)DWARF error: offset (%llu) greater than or equal to %s size (%llu)../../bfd/dwarf2.cDWARF error: mangled line number section (bad file number)%s/%s/%sDWARF error: info pointer extends beyond end of attributesDWARF error: invalid or unhandled FORM value: %#xDWARF error: zero format countDWARF error: data count (%llx) larger than buffer sizeDWARF error: unknown format content type %lluDWARF error: found dwarf version '%u', this reader only handles version 2, 3, 4 and 5 informationDWARF error: found address size '%u', this reader can not handle sizes greater than '%u'DWARF error: found address size '%u', this reader can only handle address sizes '2', '4' and '8'DWARF error: could not find abbrev number %uDWARF error: DW_AT_comp_dir attribute encountered with a non-string formDWARF error: abstract instance recursion detectedDWARF error: invalid abstract instance DIE refDWARF error: unable to read alt ref %lluDWARF error: unable to locate abstract instance DIE ref %lluDWARF error: line info section is too small (%lld)DWARF error: line info data is bigger (%#llx) than the space remaining in the section (%#lx)DWARF error: unhandled .debug_line version %dDWARF error: ran out of room reading prologueDWARF error: line info unsupported segment selector size %uDWARF error: invalid maximum operations per instructionDWARF error: ran out of room reading opcodesDWARF error: mangled line number sectionDWARF error: could not find variable specification at offset 0x%lx.debug_pubnames.zdebug_pubnames.debug_pubtypes.zdebug_pubtypes.zdebug_rnglist.debug_static_func.zdebug_static_func.debug_static_vars.zdebug_static_vars.debug_sfnames.zdebug_sfnames.debug_srcinfo.zebug_srcinfo.debug_funcnames.zdebug_funcnames.debug_typenames.zdebug_typenames.debug_varnames.zdebug_varnames.debug_weaknames.zdebug_weaknamesread_addressscan_unit_for_symbols%pB: relocations in generic ELF (EM: %d)elf32-littleelf32-big../../bfd/plugin.cbfd plugin: plugin framework: out of file descriptors. Try using fewer objects/archives Failed to load plugin '%s', reason: %s onload/usr/lib/bfd-plugins/usr/bin/../lib/bfd-pluginsplugpluginarch: error: %pB is compiled for the EP9312, whereas %pB is compiled for XScalearmv2armv2aarmv3armv3Marmv4armv4tarmv5armv5tarmv5teep9312iWMMXtiWMMXt2warning: unable to update contents of %s section in %pBarm_anyarmv3mxscaleiwmmxt2armv5tejarmv6armv6kzarmv6t2armv6karmv7armv6-marmv6s-marmv7e-marmv8-aarmv8-rarmv8-m.basearmv8-m.mainarmv8.1-m.mainarm2arm250arm3arm6arm60arm600arm610arm620arm7arm70arm700arm700iarm710arm7100arm710carm710tarm720arm720tarm740tarm7500arm7500fearm7darm7diarm7dmarm7dmiarm7tarm7tdmiarm7tdmi-sarm7marm8arm810arm9arm920arm920tarm922tarm926ejarm926ejsarm926ej-sarm940tarm946earm946e-r0arm946e-sarm966earm966e-r0arm966e-sarm968e-sarm9earm9e-r0arm9tdmiarm1020arm1020tarm1020earm1022earm1026ejsarm1026ej-sarm10earm10tarm10tdmiarm1136j-sarm1136jsarm1136jf-sarm1136jfsarm1176jz-sarm1176jzf-sarm1156t2-sarm1156t2f-scortex-a5cortex-a7cortex-a8cortex-a9cortex-a12cortex-a15cortex-a17cortex-a32cortex-a35cortex-a53cortex-a55cortex-a57cortex-a72cortex-a73cortex-a75cortex-a76cortex-a76aecortex-a77cortex-a78cortex-a78aecortex-a78ccortex-m0cortex-m0pluscortex-m1cortex-m23cortex-m3cortex-m33cortex-m35pcortex-m4cortex-m7cortex-r4cortex-r4fcortex-r5cortex-r52cortex-r7cortex-r8cortex-x1exynos-m1fa526fa606tefa616tefa626fa626tefa726tefmp626i80200marvell-pj4marvell-whitneympcorempcorenovfpsa1strongarmstrongarm1strongarm110strongarm1100strongarm1110xgene1xgene2../../bfd/linker.c__wrap___real_attempt to do relocatable link with %s input and %s output%pB: indirect symbol `%s' to `%s' is a loop%pB: ignoring duplicate section `%pA' %pB: duplicate section `%pA' has different size %pB: could not read contents of section `%pA' %pB: duplicate section `%pA' has different contents %pB: compiled for a big endian system and target is little endian%pB: compiled for a little endian system and target is big endianset_symbol_from_hash_bfd_generic_link_write_global_symbol           _bfd_generic_link_add_one_symbol_bfd_generic_link_output_symbols_bfd_generic_reloc_link_order_bfd_default_link_order_bfd_handle_already_linked../../bfd/merge.c%pB: access beyond end of merged section (%lld)_bfd_add_merge_section_bfd_write_merged_section_bfd_merged_section_offset../../bfd/reloc.ccoff-Intel-littlecoff-Intel-bigcoff-z8k%P%F: --relax and -r may not be used together INPUT_SECTION_FLAGS are not supported%X%P: %pB(%pA): error: relocation for offset %V has no value %X%P: %pB(%pA): relocation "%pR" goes out of range %X%P: %pB(%pA): relocation "%pR" is not supported %X%P: %pB(%pA): relocation "%pR" returns an unrecognized value %x %pB: unrecognized relocation type %#x in section `%pA'is this version of the linker - %s - out of date ?unusedVRT32@@uninitialized@@BFD_RELOC_64BFD_RELOC_32BFD_RELOC_26BFD_RELOC_24BFD_RELOC_16BFD_RELOC_14BFD_RELOC_8BFD_RELOC_64_PCRELBFD_RELOC_32_PCRELBFD_RELOC_24_PCRELBFD_RELOC_16_PCRELBFD_RELOC_12_PCRELBFD_RELOC_8_PCRELBFD_RELOC_32_SECRELBFD_RELOC_32_GOT_PCRELBFD_RELOC_16_GOT_PCRELBFD_RELOC_8_GOT_PCRELBFD_RELOC_32_GOTOFFBFD_RELOC_16_GOTOFFBFD_RELOC_LO16_GOTOFFBFD_RELOC_HI16_GOTOFFBFD_RELOC_HI16_S_GOTOFFBFD_RELOC_8_GOTOFFBFD_RELOC_64_PLT_PCRELBFD_RELOC_32_PLT_PCRELBFD_RELOC_24_PLT_PCRELBFD_RELOC_16_PLT_PCRELBFD_RELOC_8_PLT_PCRELBFD_RELOC_64_PLTOFFBFD_RELOC_32_PLTOFFBFD_RELOC_16_PLTOFFBFD_RELOC_LO16_PLTOFFBFD_RELOC_HI16_PLTOFFBFD_RELOC_HI16_S_PLTOFFBFD_RELOC_8_PLTOFFBFD_RELOC_SIZE32BFD_RELOC_SIZE64BFD_RELOC_68K_GLOB_DATBFD_RELOC_68K_JMP_SLOTBFD_RELOC_68K_RELATIVEBFD_RELOC_68K_TLS_GD32BFD_RELOC_68K_TLS_GD16BFD_RELOC_68K_TLS_GD8BFD_RELOC_68K_TLS_LDM32BFD_RELOC_68K_TLS_LDM16BFD_RELOC_68K_TLS_LDM8BFD_RELOC_68K_TLS_LDO32BFD_RELOC_68K_TLS_LDO16BFD_RELOC_68K_TLS_LDO8BFD_RELOC_68K_TLS_IE32BFD_RELOC_68K_TLS_IE16BFD_RELOC_68K_TLS_IE8BFD_RELOC_68K_TLS_LE32BFD_RELOC_68K_TLS_LE16BFD_RELOC_68K_TLS_LE8BFD_RELOC_32_BASERELBFD_RELOC_16_BASERELBFD_RELOC_LO16_BASERELBFD_RELOC_HI16_BASERELBFD_RELOC_HI16_S_BASERELBFD_RELOC_8_BASERELBFD_RELOC_RVABFD_RELOC_8_FFnnBFD_RELOC_32_PCREL_S2BFD_RELOC_16_PCREL_S2BFD_RELOC_23_PCREL_S2BFD_RELOC_HI22BFD_RELOC_LO10BFD_RELOC_GPREL16BFD_RELOC_GPREL32BFD_RELOC_NONEBFD_RELOC_SPARC_WDISP22BFD_RELOC_SPARC22BFD_RELOC_SPARC13BFD_RELOC_SPARC_GOT10BFD_RELOC_SPARC_GOT13BFD_RELOC_SPARC_GOT22BFD_RELOC_SPARC_PC10BFD_RELOC_SPARC_PC22BFD_RELOC_SPARC_WPLT30BFD_RELOC_SPARC_COPYBFD_RELOC_SPARC_GLOB_DATBFD_RELOC_SPARC_JMP_SLOTBFD_RELOC_SPARC_RELATIVEBFD_RELOC_SPARC_UA16BFD_RELOC_SPARC_UA32BFD_RELOC_SPARC_UA64BFD_RELOC_SPARC_GOTDATA_HIX22BFD_RELOC_SPARC_GOTDATA_LOX10BFD_RELOC_SPARC_GOTDATA_OP_HIX22BFD_RELOC_SPARC_GOTDATA_OP_LOX10BFD_RELOC_SPARC_GOTDATA_OPBFD_RELOC_SPARC_JMP_IRELBFD_RELOC_SPARC_IRELATIVEBFD_RELOC_SPARC_BASE13BFD_RELOC_SPARC_BASE22BFD_RELOC_SPARC_10BFD_RELOC_SPARC_11BFD_RELOC_SPARC_OLO10BFD_RELOC_SPARC_HH22BFD_RELOC_SPARC_HM10BFD_RELOC_SPARC_LM22BFD_RELOC_SPARC_PC_HH22BFD_RELOC_SPARC_PC_HM10BFD_RELOC_SPARC_PC_LM22BFD_RELOC_SPARC_WDISP16BFD_RELOC_SPARC_WDISP19BFD_RELOC_SPARC_7BFD_RELOC_SPARC_6BFD_RELOC_SPARC_5BFD_RELOC_SPARC_PLT32BFD_RELOC_SPARC_PLT64BFD_RELOC_SPARC_HIX22BFD_RELOC_SPARC_LOX10BFD_RELOC_SPARC_H44BFD_RELOC_SPARC_M44BFD_RELOC_SPARC_L44BFD_RELOC_SPARC_REGISTERBFD_RELOC_SPARC_H34BFD_RELOC_SPARC_SIZE32BFD_RELOC_SPARC_SIZE64BFD_RELOC_SPARC_WDISP10BFD_RELOC_SPARC_REV32BFD_RELOC_SPARC_TLS_GD_HI22BFD_RELOC_SPARC_TLS_GD_LO10BFD_RELOC_SPARC_TLS_GD_ADDBFD_RELOC_SPARC_TLS_GD_CALLBFD_RELOC_SPARC_TLS_LDM_HI22BFD_RELOC_SPARC_TLS_LDM_LO10BFD_RELOC_SPARC_TLS_LDM_ADDBFD_RELOC_SPARC_TLS_LDM_CALLBFD_RELOC_SPARC_TLS_LDO_HIX22BFD_RELOC_SPARC_TLS_LDO_LOX10BFD_RELOC_SPARC_TLS_LDO_ADDBFD_RELOC_SPARC_TLS_IE_HI22BFD_RELOC_SPARC_TLS_IE_LO10BFD_RELOC_SPARC_TLS_IE_LDBFD_RELOC_SPARC_TLS_IE_LDXBFD_RELOC_SPARC_TLS_IE_ADDBFD_RELOC_SPARC_TLS_LE_HIX22BFD_RELOC_SPARC_TLS_LE_LOX10BFD_RELOC_SPARC_TLS_DTPMOD32BFD_RELOC_SPARC_TLS_DTPMOD64BFD_RELOC_SPARC_TLS_DTPOFF32BFD_RELOC_SPARC_TLS_DTPOFF64BFD_RELOC_SPARC_TLS_TPOFF32BFD_RELOC_SPARC_TLS_TPOFF64BFD_RELOC_SPU_IMM7BFD_RELOC_SPU_IMM8BFD_RELOC_SPU_IMM10BFD_RELOC_SPU_IMM10WBFD_RELOC_SPU_IMM16BFD_RELOC_SPU_IMM16WBFD_RELOC_SPU_IMM18BFD_RELOC_SPU_PCREL9aBFD_RELOC_SPU_PCREL9bBFD_RELOC_SPU_PCREL16BFD_RELOC_SPU_LO16BFD_RELOC_SPU_HI16BFD_RELOC_SPU_PPU32BFD_RELOC_SPU_PPU64BFD_RELOC_SPU_ADD_PICBFD_RELOC_ALPHA_GPDISP_HI16BFD_RELOC_ALPHA_GPDISP_LO16BFD_RELOC_ALPHA_GPDISPBFD_RELOC_ALPHA_LITERALBFD_RELOC_ALPHA_ELF_LITERALBFD_RELOC_ALPHA_LITUSEBFD_RELOC_ALPHA_HINTBFD_RELOC_ALPHA_LINKAGEBFD_RELOC_ALPHA_CODEADDRBFD_RELOC_ALPHA_GPREL_HI16BFD_RELOC_ALPHA_GPREL_LO16BFD_RELOC_ALPHA_BRSGPBFD_RELOC_ALPHA_NOPBFD_RELOC_ALPHA_BSRBFD_RELOC_ALPHA_LDABFD_RELOC_ALPHA_BOHBFD_RELOC_ALPHA_TLSGDBFD_RELOC_ALPHA_TLSLDMBFD_RELOC_ALPHA_DTPMOD64BFD_RELOC_ALPHA_GOTDTPREL16BFD_RELOC_ALPHA_DTPREL64BFD_RELOC_ALPHA_DTPREL_HI16BFD_RELOC_ALPHA_DTPREL_LO16BFD_RELOC_ALPHA_DTPREL16BFD_RELOC_ALPHA_GOTTPREL16BFD_RELOC_ALPHA_TPREL64BFD_RELOC_ALPHA_TPREL_HI16BFD_RELOC_ALPHA_TPREL_LO16BFD_RELOC_ALPHA_TPREL16BFD_RELOC_MIPS_JMPBFD_RELOC_MICROMIPS_JMPBFD_RELOC_MIPS16_JMPBFD_RELOC_MIPS16_GPRELBFD_RELOC_HI16BFD_RELOC_HI16_SBFD_RELOC_LO16BFD_RELOC_HI16_PCRELBFD_RELOC_HI16_S_PCRELBFD_RELOC_LO16_PCRELBFD_RELOC_MIPS16_GOT16BFD_RELOC_MIPS16_CALL16BFD_RELOC_MIPS16_HI16BFD_RELOC_MIPS16_HI16_SBFD_RELOC_MIPS16_LO16BFD_RELOC_MIPS16_TLS_GDBFD_RELOC_MIPS16_TLS_LDMBFD_RELOC_MIPS16_TLS_DTPREL_HI16BFD_RELOC_MIPS16_TLS_DTPREL_LO16BFD_RELOC_MIPS16_TLS_GOTTPRELBFD_RELOC_MIPS16_TLS_TPREL_HI16BFD_RELOC_MIPS16_TLS_TPREL_LO16BFD_RELOC_MIPS_LITERALBFD_RELOC_MICROMIPS_LITERALBFD_RELOC_MICROMIPS_7_PCREL_S1BFD_RELOC_MICROMIPS_10_PCREL_S1BFD_RELOC_MICROMIPS_16_PCREL_S1BFD_RELOC_MIPS16_16_PCREL_S1BFD_RELOC_MIPS_21_PCREL_S2BFD_RELOC_MIPS_26_PCREL_S2BFD_RELOC_MIPS_18_PCREL_S3BFD_RELOC_MIPS_19_PCREL_S2BFD_RELOC_MICROMIPS_GPREL16BFD_RELOC_MICROMIPS_HI16BFD_RELOC_MICROMIPS_HI16_SBFD_RELOC_MICROMIPS_LO16BFD_RELOC_MIPS_GOT16BFD_RELOC_MICROMIPS_GOT16BFD_RELOC_MIPS_CALL16BFD_RELOC_MICROMIPS_CALL16BFD_RELOC_MIPS_GOT_HI16BFD_RELOC_MICROMIPS_GOT_HI16BFD_RELOC_MIPS_GOT_LO16BFD_RELOC_MICROMIPS_GOT_LO16BFD_RELOC_MIPS_CALL_HI16BFD_RELOC_MICROMIPS_CALL_HI16BFD_RELOC_MIPS_CALL_LO16BFD_RELOC_MICROMIPS_CALL_LO16BFD_RELOC_MIPS_SUBBFD_RELOC_MICROMIPS_SUBBFD_RELOC_MIPS_GOT_PAGEBFD_RELOC_MICROMIPS_GOT_PAGEBFD_RELOC_MIPS_GOT_OFSTBFD_RELOC_MICROMIPS_GOT_OFSTBFD_RELOC_MIPS_GOT_DISPBFD_RELOC_MICROMIPS_GOT_DISPBFD_RELOC_MIPS_SHIFT5BFD_RELOC_MIPS_SHIFT6BFD_RELOC_MIPS_INSERT_ABFD_RELOC_MIPS_INSERT_BBFD_RELOC_MIPS_DELETEBFD_RELOC_MIPS_HIGHESTBFD_RELOC_MICROMIPS_HIGHESTBFD_RELOC_MIPS_HIGHERBFD_RELOC_MICROMIPS_HIGHERBFD_RELOC_MIPS_SCN_DISPBFD_RELOC_MICROMIPS_SCN_DISPBFD_RELOC_MIPS_REL16BFD_RELOC_MIPS_RELGOTBFD_RELOC_MIPS_JALRBFD_RELOC_MICROMIPS_JALRBFD_RELOC_MIPS_TLS_DTPMOD32BFD_RELOC_MIPS_TLS_DTPREL32BFD_RELOC_MIPS_TLS_DTPMOD64BFD_RELOC_MIPS_TLS_DTPREL64BFD_RELOC_MIPS_TLS_GDBFD_RELOC_MICROMIPS_TLS_GDBFD_RELOC_MIPS_TLS_LDMBFD_RELOC_MICROMIPS_TLS_LDMBFD_RELOC_MIPS_TLS_DTPREL_HI16BFD_RELOC_MICROMIPS_TLS_DTPREL_HI16BFD_RELOC_MIPS_TLS_DTPREL_LO16BFD_RELOC_MICROMIPS_TLS_DTPREL_LO16BFD_RELOC_MIPS_TLS_GOTTPRELBFD_RELOC_MICROMIPS_TLS_GOTTPRELBFD_RELOC_MIPS_TLS_TPREL32BFD_RELOC_MIPS_TLS_TPREL64BFD_RELOC_MIPS_TLS_TPREL_HI16BFD_RELOC_MICROMIPS_TLS_TPREL_HI16BFD_RELOC_MIPS_TLS_TPREL_LO16BFD_RELOC_MICROMIPS_TLS_TPREL_LO16BFD_RELOC_MIPS_EHBFD_RELOC_MIPS_COPYBFD_RELOC_MIPS_JUMP_SLOTBFD_RELOC_MOXIE_10_PCRELBFD_RELOC_FT32_10BFD_RELOC_FT32_20BFD_RELOC_FT32_17BFD_RELOC_FT32_18BFD_RELOC_FT32_RELAXBFD_RELOC_FT32_SC0BFD_RELOC_FT32_SC1BFD_RELOC_FT32_15BFD_RELOC_FT32_DIFF32BFD_RELOC_FRV_LABEL16BFD_RELOC_FRV_LABEL24BFD_RELOC_FRV_LO16BFD_RELOC_FRV_HI16BFD_RELOC_FRV_GPREL12BFD_RELOC_FRV_GPRELU12BFD_RELOC_FRV_GPREL32BFD_RELOC_FRV_GPRELHIBFD_RELOC_FRV_GPRELLOBFD_RELOC_FRV_GOT12BFD_RELOC_FRV_GOTHIBFD_RELOC_FRV_GOTLOBFD_RELOC_FRV_FUNCDESCBFD_RELOC_FRV_FUNCDESC_GOT12BFD_RELOC_FRV_FUNCDESC_GOTHIBFD_RELOC_FRV_FUNCDESC_GOTLOBFD_RELOC_FRV_FUNCDESC_VALUEBFD_RELOC_FRV_FUNCDESC_GOTOFF12BFD_RELOC_FRV_FUNCDESC_GOTOFFHIBFD_RELOC_FRV_FUNCDESC_GOTOFFLOBFD_RELOC_FRV_GOTOFF12BFD_RELOC_FRV_GOTOFFHIBFD_RELOC_FRV_GOTOFFLOBFD_RELOC_FRV_GETTLSOFFBFD_RELOC_FRV_TLSDESC_VALUEBFD_RELOC_FRV_GOTTLSDESC12BFD_RELOC_FRV_GOTTLSDESCHIBFD_RELOC_FRV_GOTTLSDESCLOBFD_RELOC_FRV_TLSMOFF12BFD_RELOC_FRV_TLSMOFFHIBFD_RELOC_FRV_TLSMOFFLOBFD_RELOC_FRV_GOTTLSOFF12BFD_RELOC_FRV_GOTTLSOFFHIBFD_RELOC_FRV_GOTTLSOFFLOBFD_RELOC_FRV_TLSOFFBFD_RELOC_FRV_TLSDESC_RELAXBFD_RELOC_FRV_GETTLSOFF_RELAXBFD_RELOC_FRV_TLSOFF_RELAXBFD_RELOC_FRV_TLSMOFFBFD_RELOC_MN10300_GOTOFF24BFD_RELOC_MN10300_GOT32BFD_RELOC_MN10300_GOT24BFD_RELOC_MN10300_GOT16BFD_RELOC_MN10300_COPYBFD_RELOC_MN10300_GLOB_DATBFD_RELOC_MN10300_JMP_SLOTBFD_RELOC_MN10300_RELATIVEBFD_RELOC_MN10300_SYM_DIFFBFD_RELOC_MN10300_ALIGNBFD_RELOC_MN10300_TLS_GDBFD_RELOC_MN10300_TLS_LDBFD_RELOC_MN10300_TLS_LDOBFD_RELOC_MN10300_TLS_GOTIEBFD_RELOC_MN10300_TLS_IEBFD_RELOC_MN10300_TLS_LEBFD_RELOC_MN10300_TLS_DTPMODBFD_RELOC_MN10300_TLS_DTPOFFBFD_RELOC_MN10300_TLS_TPOFFBFD_RELOC_MN10300_32_PCRELBFD_RELOC_MN10300_16_PCRELBFD_RELOC_386_GOT32BFD_RELOC_386_PLT32BFD_RELOC_386_COPYBFD_RELOC_386_GLOB_DATBFD_RELOC_386_JUMP_SLOTBFD_RELOC_386_RELATIVEBFD_RELOC_386_GOTOFFBFD_RELOC_386_GOTPCBFD_RELOC_386_TLS_TPOFFBFD_RELOC_386_TLS_IEBFD_RELOC_386_TLS_GOTIEBFD_RELOC_386_TLS_LEBFD_RELOC_386_TLS_GDBFD_RELOC_386_TLS_LDMBFD_RELOC_386_TLS_LDO_32BFD_RELOC_386_TLS_IE_32BFD_RELOC_386_TLS_LE_32BFD_RELOC_386_TLS_DTPMOD32BFD_RELOC_386_TLS_DTPOFF32BFD_RELOC_386_TLS_TPOFF32BFD_RELOC_386_TLS_GOTDESCBFD_RELOC_386_TLS_DESC_CALLBFD_RELOC_386_TLS_DESCBFD_RELOC_386_IRELATIVEBFD_RELOC_386_GOT32XBFD_RELOC_X86_64_GOT32BFD_RELOC_X86_64_PLT32BFD_RELOC_X86_64_COPYBFD_RELOC_X86_64_GLOB_DATBFD_RELOC_X86_64_JUMP_SLOTBFD_RELOC_X86_64_RELATIVEBFD_RELOC_X86_64_GOTPCRELBFD_RELOC_X86_64_32SBFD_RELOC_X86_64_DTPMOD64BFD_RELOC_X86_64_DTPOFF64BFD_RELOC_X86_64_TPOFF64BFD_RELOC_X86_64_TLSGDBFD_RELOC_X86_64_TLSLDBFD_RELOC_X86_64_DTPOFF32BFD_RELOC_X86_64_GOTTPOFFBFD_RELOC_X86_64_TPOFF32BFD_RELOC_X86_64_GOTOFF64BFD_RELOC_X86_64_GOTPC32BFD_RELOC_X86_64_GOT64BFD_RELOC_X86_64_GOTPCREL64BFD_RELOC_X86_64_GOTPC64BFD_RELOC_X86_64_GOTPLT64BFD_RELOC_X86_64_PLTOFF64BFD_RELOC_X86_64_GOTPC32_TLSDESCBFD_RELOC_X86_64_TLSDESC_CALLBFD_RELOC_X86_64_TLSDESCBFD_RELOC_X86_64_IRELATIVEBFD_RELOC_X86_64_PC32_BNDBFD_RELOC_X86_64_PLT32_BNDBFD_RELOC_X86_64_GOTPCRELXBFD_RELOC_X86_64_REX_GOTPCRELXBFD_RELOC_NS32K_IMM_8BFD_RELOC_NS32K_IMM_16BFD_RELOC_NS32K_IMM_32BFD_RELOC_NS32K_IMM_8_PCRELBFD_RELOC_NS32K_IMM_16_PCRELBFD_RELOC_NS32K_IMM_32_PCRELBFD_RELOC_NS32K_DISP_8BFD_RELOC_NS32K_DISP_16BFD_RELOC_NS32K_DISP_32BFD_RELOC_NS32K_DISP_8_PCRELBFD_RELOC_NS32K_DISP_16_PCRELBFD_RELOC_NS32K_DISP_32_PCRELBFD_RELOC_PDP11_DISP_8_PCRELBFD_RELOC_PDP11_DISP_6_PCRELBFD_RELOC_PJ_CODE_HI16BFD_RELOC_PJ_CODE_LO16BFD_RELOC_PJ_CODE_DIR16BFD_RELOC_PJ_CODE_DIR32BFD_RELOC_PJ_CODE_REL16BFD_RELOC_PJ_CODE_REL32BFD_RELOC_PPC_B26BFD_RELOC_PPC_BA26BFD_RELOC_PPC_TOC16BFD_RELOC_PPC_TOC16_LOBFD_RELOC_PPC_TOC16_HIBFD_RELOC_PPC_B16BFD_RELOC_PPC_B16_BRTAKENBFD_RELOC_PPC_B16_BRNTAKENBFD_RELOC_PPC_BA16BFD_RELOC_PPC_BA16_BRTAKENBFD_RELOC_PPC_BA16_BRNTAKENBFD_RELOC_PPC_COPYBFD_RELOC_PPC_GLOB_DATBFD_RELOC_PPC_JMP_SLOTBFD_RELOC_PPC_RELATIVEBFD_RELOC_PPC_LOCAL24PCBFD_RELOC_PPC_EMB_NADDR32BFD_RELOC_PPC_EMB_NADDR16BFD_RELOC_PPC_EMB_NADDR16_LOBFD_RELOC_PPC_EMB_NADDR16_HIBFD_RELOC_PPC_EMB_NADDR16_HABFD_RELOC_PPC_EMB_SDAI16BFD_RELOC_PPC_EMB_SDA2I16BFD_RELOC_PPC_EMB_SDA2RELBFD_RELOC_PPC_EMB_SDA21BFD_RELOC_PPC_EMB_MRKREFBFD_RELOC_PPC_EMB_RELSEC16BFD_RELOC_PPC_EMB_RELST_LOBFD_RELOC_PPC_EMB_RELST_HIBFD_RELOC_PPC_EMB_RELST_HABFD_RELOC_PPC_EMB_BIT_FLDBFD_RELOC_PPC_EMB_RELSDABFD_RELOC_PPC_VLE_REL8BFD_RELOC_PPC_VLE_REL15BFD_RELOC_PPC_VLE_REL24BFD_RELOC_PPC_VLE_LO16ABFD_RELOC_PPC_VLE_LO16DBFD_RELOC_PPC_VLE_HI16ABFD_RELOC_PPC_VLE_HI16DBFD_RELOC_PPC_VLE_HA16ABFD_RELOC_PPC_VLE_HA16DBFD_RELOC_PPC_VLE_SDA21BFD_RELOC_PPC_VLE_SDA21_LOBFD_RELOC_PPC_VLE_SDAREL_LO16ABFD_RELOC_PPC_VLE_SDAREL_LO16DBFD_RELOC_PPC_VLE_SDAREL_HI16ABFD_RELOC_PPC_VLE_SDAREL_HI16DBFD_RELOC_PPC_VLE_SDAREL_HA16ABFD_RELOC_PPC_VLE_SDAREL_HA16DBFD_RELOC_PPC_16DX_HABFD_RELOC_PPC_REL16DX_HABFD_RELOC_PPC_NEGBFD_RELOC_PPC64_HIGHERBFD_RELOC_PPC64_HIGHER_SBFD_RELOC_PPC64_HIGHESTBFD_RELOC_PPC64_HIGHEST_SBFD_RELOC_PPC64_TOC16_LOBFD_RELOC_PPC64_TOC16_HIBFD_RELOC_PPC64_TOC16_HABFD_RELOC_PPC64_TOCBFD_RELOC_PPC64_PLTGOT16BFD_RELOC_PPC64_PLTGOT16_LOBFD_RELOC_PPC64_PLTGOT16_HIBFD_RELOC_PPC64_PLTGOT16_HABFD_RELOC_PPC64_ADDR16_DSBFD_RELOC_PPC64_ADDR16_LO_DSBFD_RELOC_PPC64_GOT16_DSBFD_RELOC_PPC64_GOT16_LO_DSBFD_RELOC_PPC64_PLT16_LO_DSBFD_RELOC_PPC64_SECTOFF_DSBFD_RELOC_PPC64_SECTOFF_LO_DSBFD_RELOC_PPC64_TOC16_DSBFD_RELOC_PPC64_TOC16_LO_DSBFD_RELOC_PPC64_PLTGOT16_DSBFD_RELOC_PPC64_PLTGOT16_LO_DSBFD_RELOC_PPC64_ADDR16_HIGHBFD_RELOC_PPC64_ADDR16_HIGHABFD_RELOC_PPC64_REL16_HIGHBFD_RELOC_PPC64_REL16_HIGHABFD_RELOC_PPC64_REL16_HIGHERBFD_RELOC_PPC64_REL16_HIGHERABFD_RELOC_PPC64_REL16_HIGHESTBFD_RELOC_PPC64_REL16_HIGHESTABFD_RELOC_PPC64_ADDR64_LOCALBFD_RELOC_PPC64_ENTRYBFD_RELOC_PPC64_REL24_NOTOCBFD_RELOC_PPC64_D34BFD_RELOC_PPC64_D34_LOBFD_RELOC_PPC64_D34_HI30BFD_RELOC_PPC64_D34_HA30BFD_RELOC_PPC64_PCREL34BFD_RELOC_PPC64_GOT_PCREL34BFD_RELOC_PPC64_PLT_PCREL34BFD_RELOC_PPC64_ADDR16_HIGHER34BFD_RELOC_PPC64_ADDR16_HIGHERA34BFD_RELOC_PPC64_ADDR16_HIGHEST34BFD_RELOC_PPC64_ADDR16_HIGHESTA34BFD_RELOC_PPC64_REL16_HIGHER34BFD_RELOC_PPC64_REL16_HIGHERA34BFD_RELOC_PPC64_REL16_HIGHEST34BFD_RELOC_PPC64_REL16_HIGHESTA34BFD_RELOC_PPC64_D28BFD_RELOC_PPC64_PCREL28BFD_RELOC_PPC_TLSBFD_RELOC_PPC_TLSGDBFD_RELOC_PPC_TLSLDBFD_RELOC_PPC_TLSLEBFD_RELOC_PPC_TLSIEBFD_RELOC_PPC_TLSMBFD_RELOC_PPC_TLSMLBFD_RELOC_PPC_DTPMODBFD_RELOC_PPC_TPREL16BFD_RELOC_PPC_TPREL16_LOBFD_RELOC_PPC_TPREL16_HIBFD_RELOC_PPC_TPREL16_HABFD_RELOC_PPC_TPRELBFD_RELOC_PPC_DTPREL16BFD_RELOC_PPC_DTPREL16_LOBFD_RELOC_PPC_DTPREL16_HIBFD_RELOC_PPC_DTPREL16_HABFD_RELOC_PPC_DTPRELBFD_RELOC_PPC_GOT_TLSGD16BFD_RELOC_PPC_GOT_TLSGD16_LOBFD_RELOC_PPC_GOT_TLSGD16_HIBFD_RELOC_PPC_GOT_TLSGD16_HABFD_RELOC_PPC_GOT_TLSLD16BFD_RELOC_PPC_GOT_TLSLD16_LOBFD_RELOC_PPC_GOT_TLSLD16_HIBFD_RELOC_PPC_GOT_TLSLD16_HABFD_RELOC_PPC_GOT_TPREL16BFD_RELOC_PPC_GOT_TPREL16_LOBFD_RELOC_PPC_GOT_TPREL16_HIBFD_RELOC_PPC_GOT_TPREL16_HABFD_RELOC_PPC_GOT_DTPREL16BFD_RELOC_PPC_GOT_DTPREL16_LOBFD_RELOC_PPC_GOT_DTPREL16_HIBFD_RELOC_PPC_GOT_DTPREL16_HABFD_RELOC_PPC64_TLSGDBFD_RELOC_PPC64_TLSLDBFD_RELOC_PPC64_TLSLEBFD_RELOC_PPC64_TLSIEBFD_RELOC_PPC64_TLSMBFD_RELOC_PPC64_TLSMLBFD_RELOC_PPC64_TPREL16_DSBFD_RELOC_PPC64_TPREL16_LO_DSBFD_RELOC_PPC64_TPREL16_HIGHBFD_RELOC_PPC64_TPREL16_HIGHABFD_RELOC_PPC64_TPREL16_HIGHERBFD_RELOC_PPC64_TPREL16_HIGHERABFD_RELOC_PPC64_TPREL16_HIGHESTBFD_RELOC_PPC64_TPREL16_HIGHESTABFD_RELOC_PPC64_DTPREL16_DSBFD_RELOC_PPC64_DTPREL16_LO_DSBFD_RELOC_PPC64_DTPREL16_HIGHBFD_RELOC_PPC64_DTPREL16_HIGHABFD_RELOC_PPC64_DTPREL16_HIGHERBFD_RELOC_PPC64_DTPREL16_HIGHERABFD_RELOC_PPC64_DTPREL16_HIGHESTBFD_RELOC_PPC64_DTPREL16_HIGHESTABFD_RELOC_PPC64_TPREL34BFD_RELOC_PPC64_DTPREL34BFD_RELOC_PPC64_GOT_TLSGD_PCREL34BFD_RELOC_PPC64_GOT_TLSLD_PCREL34BFD_RELOC_PPC64_GOT_TPREL_PCREL34BFD_RELOC_PPC64_GOT_DTPREL_PCREL34BFD_RELOC_PPC64_TLS_PCRELBFD_RELOC_I370_D12BFD_RELOC_CTORBFD_RELOC_ARM_PCREL_BRANCHBFD_RELOC_ARM_PCREL_BLXBFD_RELOC_THUMB_PCREL_BLXBFD_RELOC_ARM_PCREL_CALLBFD_RELOC_ARM_PCREL_JUMPBFD_RELOC_THUMB_PCREL_BRANCH5BFD_RELOC_THUMB_PCREL_BFCSELBFD_RELOC_ARM_THUMB_BF17BFD_RELOC_ARM_THUMB_BF13BFD_RELOC_ARM_THUMB_BF19BFD_RELOC_ARM_THUMB_LOOP12BFD_RELOC_THUMB_PCREL_BRANCH7BFD_RELOC_THUMB_PCREL_BRANCH9BFD_RELOC_THUMB_PCREL_BRANCH12BFD_RELOC_THUMB_PCREL_BRANCH20BFD_RELOC_THUMB_PCREL_BRANCH23BFD_RELOC_THUMB_PCREL_BRANCH25BFD_RELOC_ARM_OFFSET_IMMBFD_RELOC_ARM_THUMB_OFFSETBFD_RELOC_ARM_TARGET1BFD_RELOC_ARM_ROSEGREL32BFD_RELOC_ARM_SBREL32BFD_RELOC_ARM_TARGET2BFD_RELOC_ARM_PREL31BFD_RELOC_ARM_MOVWBFD_RELOC_ARM_MOVTBFD_RELOC_ARM_MOVW_PCRELBFD_RELOC_ARM_MOVT_PCRELBFD_RELOC_ARM_THUMB_MOVWBFD_RELOC_ARM_THUMB_MOVTBFD_RELOC_ARM_THUMB_MOVW_PCRELBFD_RELOC_ARM_THUMB_MOVT_PCRELBFD_RELOC_ARM_GOTFUNCDESCBFD_RELOC_ARM_GOTOFFFUNCDESCBFD_RELOC_ARM_FUNCDESCBFD_RELOC_ARM_FUNCDESC_VALUEBFD_RELOC_ARM_TLS_GD32_FDPICBFD_RELOC_ARM_TLS_LDM32_FDPICBFD_RELOC_ARM_TLS_IE32_FDPICBFD_RELOC_ARM_JUMP_SLOTBFD_RELOC_ARM_GLOB_DATBFD_RELOC_ARM_GOT32BFD_RELOC_ARM_PLT32BFD_RELOC_ARM_RELATIVEBFD_RELOC_ARM_GOTOFFBFD_RELOC_ARM_GOTPCBFD_RELOC_ARM_GOT_PRELBFD_RELOC_ARM_TLS_GD32BFD_RELOC_ARM_TLS_LDO32BFD_RELOC_ARM_TLS_LDM32BFD_RELOC_ARM_TLS_DTPOFF32BFD_RELOC_ARM_TLS_DTPMOD32BFD_RELOC_ARM_TLS_TPOFF32BFD_RELOC_ARM_TLS_IE32BFD_RELOC_ARM_TLS_LE32BFD_RELOC_ARM_TLS_GOTDESCBFD_RELOC_ARM_TLS_CALLBFD_RELOC_ARM_THM_TLS_CALLBFD_RELOC_ARM_TLS_DESCSEQBFD_RELOC_ARM_THM_TLS_DESCSEQBFD_RELOC_ARM_TLS_DESCBFD_RELOC_ARM_ALU_PC_G0_NCBFD_RELOC_ARM_ALU_PC_G0BFD_RELOC_ARM_ALU_PC_G1_NCBFD_RELOC_ARM_ALU_PC_G1BFD_RELOC_ARM_ALU_PC_G2BFD_RELOC_ARM_LDR_PC_G0BFD_RELOC_ARM_LDR_PC_G1BFD_RELOC_ARM_LDR_PC_G2BFD_RELOC_ARM_LDRS_PC_G0BFD_RELOC_ARM_LDRS_PC_G1BFD_RELOC_ARM_LDRS_PC_G2BFD_RELOC_ARM_LDC_PC_G0BFD_RELOC_ARM_LDC_PC_G1BFD_RELOC_ARM_LDC_PC_G2BFD_RELOC_ARM_ALU_SB_G0_NCBFD_RELOC_ARM_ALU_SB_G0BFD_RELOC_ARM_ALU_SB_G1_NCBFD_RELOC_ARM_ALU_SB_G1BFD_RELOC_ARM_ALU_SB_G2BFD_RELOC_ARM_LDR_SB_G0BFD_RELOC_ARM_LDR_SB_G1BFD_RELOC_ARM_LDR_SB_G2BFD_RELOC_ARM_LDRS_SB_G0BFD_RELOC_ARM_LDRS_SB_G1BFD_RELOC_ARM_LDRS_SB_G2BFD_RELOC_ARM_LDC_SB_G0BFD_RELOC_ARM_LDC_SB_G1BFD_RELOC_ARM_LDC_SB_G2BFD_RELOC_ARM_V4BXBFD_RELOC_ARM_IRELATIVEBFD_RELOC_ARM_THUMB_ALU_ABS_G0_NCBFD_RELOC_ARM_THUMB_ALU_ABS_G1_NCBFD_RELOC_ARM_THUMB_ALU_ABS_G2_NCBFD_RELOC_ARM_THUMB_ALU_ABS_G3_NCBFD_RELOC_ARM_IMMEDIATEBFD_RELOC_ARM_ADRL_IMMEDIATEBFD_RELOC_ARM_T32_IMMEDIATEBFD_RELOC_ARM_T32_ADD_IMMBFD_RELOC_ARM_T32_IMM12BFD_RELOC_ARM_T32_ADD_PC12BFD_RELOC_ARM_SHIFT_IMMBFD_RELOC_ARM_SMCBFD_RELOC_ARM_HVCBFD_RELOC_ARM_SWIBFD_RELOC_ARM_MULTIBFD_RELOC_ARM_CP_OFF_IMMBFD_RELOC_ARM_CP_OFF_IMM_S2BFD_RELOC_ARM_T32_CP_OFF_IMMBFD_RELOC_ARM_T32_CP_OFF_IMM_S2BFD_RELOC_ARM_T32_VLDR_VSTR_OFF_IMMBFD_RELOC_ARM_ADR_IMMBFD_RELOC_ARM_LDR_IMMBFD_RELOC_ARM_LITERALBFD_RELOC_ARM_IN_POOLBFD_RELOC_ARM_OFFSET_IMM8BFD_RELOC_ARM_T32_OFFSET_U8BFD_RELOC_ARM_T32_OFFSET_IMMBFD_RELOC_ARM_HWLITERALBFD_RELOC_ARM_THUMB_ADDBFD_RELOC_ARM_THUMB_IMMBFD_RELOC_ARM_THUMB_SHIFTBFD_RELOC_SH_PCDISP8BY2BFD_RELOC_SH_PCDISP12BY2BFD_RELOC_SH_IMM3BFD_RELOC_SH_IMM3UBFD_RELOC_SH_DISP12BFD_RELOC_SH_DISP12BY2BFD_RELOC_SH_DISP12BY4BFD_RELOC_SH_DISP12BY8BFD_RELOC_SH_DISP20BFD_RELOC_SH_DISP20BY8BFD_RELOC_SH_IMM4BFD_RELOC_SH_IMM4BY2BFD_RELOC_SH_IMM4BY4BFD_RELOC_SH_IMM8BFD_RELOC_SH_IMM8BY2BFD_RELOC_SH_IMM8BY4BFD_RELOC_SH_PCRELIMM8BY2BFD_RELOC_SH_PCRELIMM8BY4BFD_RELOC_SH_SWITCH16BFD_RELOC_SH_SWITCH32BFD_RELOC_SH_USESBFD_RELOC_SH_COUNTBFD_RELOC_SH_ALIGNBFD_RELOC_SH_CODEBFD_RELOC_SH_DATABFD_RELOC_SH_LABELBFD_RELOC_SH_LOOP_STARTBFD_RELOC_SH_LOOP_ENDBFD_RELOC_SH_COPYBFD_RELOC_SH_GLOB_DATBFD_RELOC_SH_JMP_SLOTBFD_RELOC_SH_RELATIVEBFD_RELOC_SH_GOTPCBFD_RELOC_SH_GOT_LOW16BFD_RELOC_SH_GOT_MEDLOW16BFD_RELOC_SH_GOT_MEDHI16BFD_RELOC_SH_GOT_HI16BFD_RELOC_SH_GOTPLT_LOW16BFD_RELOC_SH_GOTPLT_MEDLOW16BFD_RELOC_SH_GOTPLT_MEDHI16BFD_RELOC_SH_GOTPLT_HI16BFD_RELOC_SH_PLT_LOW16BFD_RELOC_SH_PLT_MEDLOW16BFD_RELOC_SH_PLT_MEDHI16BFD_RELOC_SH_PLT_HI16BFD_RELOC_SH_GOTOFF_LOW16BFD_RELOC_SH_GOTOFF_MEDLOW16BFD_RELOC_SH_GOTOFF_MEDHI16BFD_RELOC_SH_GOTOFF_HI16BFD_RELOC_SH_GOTPC_LOW16BFD_RELOC_SH_GOTPC_MEDLOW16BFD_RELOC_SH_GOTPC_MEDHI16BFD_RELOC_SH_GOTPC_HI16BFD_RELOC_SH_COPY64BFD_RELOC_SH_GLOB_DAT64BFD_RELOC_SH_JMP_SLOT64BFD_RELOC_SH_RELATIVE64BFD_RELOC_SH_GOT10BY4BFD_RELOC_SH_GOT10BY8BFD_RELOC_SH_GOTPLT10BY4BFD_RELOC_SH_GOTPLT10BY8BFD_RELOC_SH_GOTPLT32BFD_RELOC_SH_SHMEDIA_CODEBFD_RELOC_SH_IMMU5BFD_RELOC_SH_IMMS6BFD_RELOC_SH_IMMS6BY32BFD_RELOC_SH_IMMU6BFD_RELOC_SH_IMMS10BFD_RELOC_SH_IMMS10BY2BFD_RELOC_SH_IMMS10BY4BFD_RELOC_SH_IMMS10BY8BFD_RELOC_SH_IMMS16BFD_RELOC_SH_IMMU16BFD_RELOC_SH_IMM_LOW16BFD_RELOC_SH_IMM_LOW16_PCRELBFD_RELOC_SH_IMM_MEDLOW16BFD_RELOC_SH_IMM_MEDLOW16_PCRELBFD_RELOC_SH_IMM_MEDHI16BFD_RELOC_SH_IMM_MEDHI16_PCRELBFD_RELOC_SH_IMM_HI16BFD_RELOC_SH_IMM_HI16_PCRELBFD_RELOC_SH_PT_16BFD_RELOC_SH_TLS_GD_32BFD_RELOC_SH_TLS_LD_32BFD_RELOC_SH_TLS_LDO_32BFD_RELOC_SH_TLS_IE_32BFD_RELOC_SH_TLS_LE_32BFD_RELOC_SH_TLS_DTPMOD32BFD_RELOC_SH_TLS_DTPOFF32BFD_RELOC_SH_TLS_TPOFF32BFD_RELOC_SH_GOT20BFD_RELOC_SH_GOTOFF20BFD_RELOC_SH_GOTFUNCDESCBFD_RELOC_SH_GOTFUNCDESC20BFD_RELOC_SH_GOTOFFFUNCDESCBFD_RELOC_SH_GOTOFFFUNCDESC20BFD_RELOC_SH_FUNCDESCBFD_RELOC_ARC_NONEBFD_RELOC_ARC_8BFD_RELOC_ARC_16BFD_RELOC_ARC_24BFD_RELOC_ARC_32BFD_RELOC_ARC_N8BFD_RELOC_ARC_N16BFD_RELOC_ARC_N24BFD_RELOC_ARC_N32BFD_RELOC_ARC_SDABFD_RELOC_ARC_SECTOFFBFD_RELOC_ARC_S21H_PCRELBFD_RELOC_ARC_S21W_PCRELBFD_RELOC_ARC_S25H_PCRELBFD_RELOC_ARC_S25W_PCRELBFD_RELOC_ARC_SDA32BFD_RELOC_ARC_SDA_LDSTBFD_RELOC_ARC_SDA_LDST1BFD_RELOC_ARC_SDA_LDST2BFD_RELOC_ARC_SDA16_LDBFD_RELOC_ARC_SDA16_LD1BFD_RELOC_ARC_SDA16_LD2BFD_RELOC_ARC_S13_PCRELBFD_RELOC_ARC_WBFD_RELOC_ARC_32_MEBFD_RELOC_ARC_32_ME_SBFD_RELOC_ARC_N32_MEBFD_RELOC_ARC_SECTOFF_MEBFD_RELOC_ARC_SDA32_MEBFD_RELOC_ARC_W_MEBFD_RELOC_AC_SECTOFF_U8BFD_RELOC_AC_SECTOFF_U8_1BFD_RELOC_AC_SECTOFF_U8_2BFD_RELOC_AC_SECTOFF_S9BFD_RELOC_AC_SECTOFF_S9_1BFD_RELOC_AC_SECTOFF_S9_2BFD_RELOC_ARC_SECTOFF_ME_1BFD_RELOC_ARC_SECTOFF_ME_2BFD_RELOC_ARC_SECTOFF_1BFD_RELOC_ARC_SECTOFF_2BFD_RELOC_ARC_SDA_12BFD_RELOC_ARC_SDA16_ST2BFD_RELOC_ARC_32_PCRELBFD_RELOC_ARC_PC32BFD_RELOC_ARC_GOT32BFD_RELOC_ARC_GOTPC32BFD_RELOC_ARC_PLT32BFD_RELOC_ARC_COPYBFD_RELOC_ARC_GLOB_DATBFD_RELOC_ARC_JMP_SLOTBFD_RELOC_ARC_RELATIVEBFD_RELOC_ARC_GOTOFFBFD_RELOC_ARC_GOTPCBFD_RELOC_ARC_S21W_PCREL_PLTBFD_RELOC_ARC_S25H_PCREL_PLTBFD_RELOC_ARC_TLS_DTPMODBFD_RELOC_ARC_TLS_TPOFFBFD_RELOC_ARC_TLS_GD_GOTBFD_RELOC_ARC_TLS_GD_LDBFD_RELOC_ARC_TLS_GD_CALLBFD_RELOC_ARC_TLS_IE_GOTBFD_RELOC_ARC_TLS_DTPOFFBFD_RELOC_ARC_TLS_DTPOFF_S9BFD_RELOC_ARC_TLS_LE_S9BFD_RELOC_ARC_TLS_LE_32BFD_RELOC_ARC_S25W_PCREL_PLTBFD_RELOC_ARC_S21H_PCREL_PLTBFD_RELOC_ARC_NPS_CMEM16BFD_RELOC_ARC_JLI_SECTOFFBFD_RELOC_BFIN_16_IMMBFD_RELOC_BFIN_16_HIGHBFD_RELOC_BFIN_4_PCRELBFD_RELOC_BFIN_5_PCRELBFD_RELOC_BFIN_16_LOWBFD_RELOC_BFIN_10_PCRELBFD_RELOC_BFIN_11_PCRELBFD_RELOC_BFIN_12_PCREL_JUMPBFD_RELOC_BFIN_12_PCREL_JUMP_SBFD_RELOC_BFIN_24_PCREL_CALL_XBFD_RELOC_BFIN_24_PCREL_JUMP_LBFD_RELOC_BFIN_GOT17M4BFD_RELOC_BFIN_GOTHIBFD_RELOC_BFIN_GOTLOBFD_RELOC_BFIN_FUNCDESCBFD_RELOC_BFIN_FUNCDESC_GOT17M4BFD_RELOC_BFIN_FUNCDESC_GOTHIBFD_RELOC_BFIN_FUNCDESC_GOTLOBFD_RELOC_BFIN_FUNCDESC_VALUEBFD_RELOC_BFIN_FUNCDESC_GOTOFF17M4BFD_RELOC_BFIN_FUNCDESC_GOTOFFHIBFD_RELOC_BFIN_FUNCDESC_GOTOFFLOBFD_RELOC_BFIN_GOTOFF17M4BFD_RELOC_BFIN_GOTOFFHIBFD_RELOC_BFIN_GOTOFFLOBFD_RELOC_BFIN_GOTBFD_RELOC_BFIN_PLTPCBFD_ARELOC_BFIN_PUSHBFD_ARELOC_BFIN_CONSTBFD_ARELOC_BFIN_ADDBFD_ARELOC_BFIN_SUBBFD_ARELOC_BFIN_MULTBFD_ARELOC_BFIN_DIVBFD_ARELOC_BFIN_MODBFD_ARELOC_BFIN_LSHIFTBFD_ARELOC_BFIN_RSHIFTBFD_ARELOC_BFIN_ANDBFD_ARELOC_BFIN_ORBFD_ARELOC_BFIN_XORBFD_ARELOC_BFIN_LANDBFD_ARELOC_BFIN_LORBFD_ARELOC_BFIN_LENBFD_ARELOC_BFIN_NEGBFD_ARELOC_BFIN_COMPBFD_ARELOC_BFIN_PAGEBFD_ARELOC_BFIN_HWPAGEBFD_ARELOC_BFIN_ADDRBFD_RELOC_D10V_10_PCREL_RBFD_RELOC_D10V_10_PCREL_LBFD_RELOC_D10V_18BFD_RELOC_D10V_18_PCRELBFD_RELOC_D30V_6BFD_RELOC_D30V_9_PCRELBFD_RELOC_D30V_9_PCREL_RBFD_RELOC_D30V_15BFD_RELOC_D30V_15_PCRELBFD_RELOC_D30V_15_PCREL_RBFD_RELOC_D30V_21BFD_RELOC_D30V_21_PCRELBFD_RELOC_D30V_21_PCREL_RBFD_RELOC_D30V_32BFD_RELOC_D30V_32_PCRELBFD_RELOC_DLX_HI16_SBFD_RELOC_DLX_LO16BFD_RELOC_DLX_JMP26BFD_RELOC_M32C_HI8BFD_RELOC_M32C_RL_JUMPBFD_RELOC_M32C_RL_1ADDRBFD_RELOC_M32C_RL_2ADDRBFD_RELOC_M32R_24BFD_RELOC_M32R_10_PCRELBFD_RELOC_M32R_18_PCRELBFD_RELOC_M32R_26_PCRELBFD_RELOC_M32R_HI16_ULOBFD_RELOC_M32R_HI16_SLOBFD_RELOC_M32R_LO16BFD_RELOC_M32R_SDA16BFD_RELOC_M32R_GOT24BFD_RELOC_M32R_26_PLTRELBFD_RELOC_M32R_COPYBFD_RELOC_M32R_GLOB_DATBFD_RELOC_M32R_JMP_SLOTBFD_RELOC_M32R_RELATIVEBFD_RELOC_M32R_GOTOFFBFD_RELOC_M32R_GOTOFF_HI_ULOBFD_RELOC_M32R_GOTOFF_HI_SLOBFD_RELOC_M32R_GOTOFF_LOBFD_RELOC_M32R_GOTPC24BFD_RELOC_M32R_GOT16_HI_ULOBFD_RELOC_M32R_GOT16_HI_SLOBFD_RELOC_M32R_GOT16_LOBFD_RELOC_M32R_GOTPC_HI_ULOBFD_RELOC_M32R_GOTPC_HI_SLOBFD_RELOC_M32R_GOTPC_LOBFD_RELOC_NDS32_20BFD_RELOC_NDS32_9_PCRELBFD_RELOC_NDS32_WORD_9_PCRELBFD_RELOC_NDS32_15_PCRELBFD_RELOC_NDS32_17_PCRELBFD_RELOC_NDS32_25_PCRELBFD_RELOC_NDS32_HI20BFD_RELOC_NDS32_LO12S3BFD_RELOC_NDS32_LO12S2BFD_RELOC_NDS32_LO12S1BFD_RELOC_NDS32_LO12S0BFD_RELOC_NDS32_LO12S0_ORIBFD_RELOC_NDS32_SDA15S3BFD_RELOC_NDS32_SDA15S2BFD_RELOC_NDS32_SDA15S1BFD_RELOC_NDS32_SDA15S0BFD_RELOC_NDS32_SDA16S3BFD_RELOC_NDS32_SDA17S2BFD_RELOC_NDS32_SDA18S1BFD_RELOC_NDS32_SDA19S0BFD_RELOC_NDS32_GOT20BFD_RELOC_NDS32_9_PLTRELBFD_RELOC_NDS32_25_PLTRELBFD_RELOC_NDS32_COPYBFD_RELOC_NDS32_GLOB_DATBFD_RELOC_NDS32_JMP_SLOTBFD_RELOC_NDS32_RELATIVEBFD_RELOC_NDS32_GOTOFFBFD_RELOC_NDS32_GOTOFF_HI20BFD_RELOC_NDS32_GOTOFF_LO12BFD_RELOC_NDS32_GOTPC20BFD_RELOC_NDS32_GOT_HI20BFD_RELOC_NDS32_GOT_LO12BFD_RELOC_NDS32_GOTPC_HI20BFD_RELOC_NDS32_GOTPC_LO12BFD_RELOC_NDS32_INSN16BFD_RELOC_NDS32_LABELBFD_RELOC_NDS32_LONGCALL1BFD_RELOC_NDS32_LONGCALL2BFD_RELOC_NDS32_LONGCALL3BFD_RELOC_NDS32_LONGJUMP1BFD_RELOC_NDS32_LONGJUMP2BFD_RELOC_NDS32_LONGJUMP3BFD_RELOC_NDS32_LOADSTOREBFD_RELOC_NDS32_9_FIXEDBFD_RELOC_NDS32_15_FIXEDBFD_RELOC_NDS32_17_FIXEDBFD_RELOC_NDS32_25_FIXEDBFD_RELOC_NDS32_LONGCALL4BFD_RELOC_NDS32_LONGCALL5BFD_RELOC_NDS32_LONGCALL6BFD_RELOC_NDS32_LONGJUMP4BFD_RELOC_NDS32_LONGJUMP5BFD_RELOC_NDS32_LONGJUMP6BFD_RELOC_NDS32_LONGJUMP7BFD_RELOC_NDS32_PLTREL_HI20BFD_RELOC_NDS32_PLTREL_LO12BFD_RELOC_NDS32_PLT_GOTREL_HI20BFD_RELOC_NDS32_PLT_GOTREL_LO12BFD_RELOC_NDS32_SDA12S2_DPBFD_RELOC_NDS32_SDA12S2_SPBFD_RELOC_NDS32_LO12S2_DPBFD_RELOC_NDS32_LO12S2_SPBFD_RELOC_NDS32_DWARF2_OP1BFD_RELOC_NDS32_DWARF2_OP2BFD_RELOC_NDS32_DWARF2_LEBBFD_RELOC_NDS32_UPDATE_TABFD_RELOC_NDS32_PLT_GOTREL_LO20BFD_RELOC_NDS32_PLT_GOTREL_LO15BFD_RELOC_NDS32_PLT_GOTREL_LO19BFD_RELOC_NDS32_GOT_LO15BFD_RELOC_NDS32_GOT_LO19BFD_RELOC_NDS32_GOTOFF_LO15BFD_RELOC_NDS32_GOTOFF_LO19BFD_RELOC_NDS32_GOT15S2BFD_RELOC_NDS32_GOT17S2BFD_RELOC_NDS32_5BFD_RELOC_NDS32_10_UPCRELBFD_RELOC_NDS32_SDA_FP7U2_RELABFD_RELOC_NDS32_RELAX_ENTRYBFD_RELOC_NDS32_GOT_SUFFBFD_RELOC_NDS32_GOTOFF_SUFFBFD_RELOC_NDS32_PLT_GOT_SUFFBFD_RELOC_NDS32_MULCALL_SUFFBFD_RELOC_NDS32_PTRBFD_RELOC_NDS32_PTR_COUNTBFD_RELOC_NDS32_PTR_RESOLVEDBFD_RELOC_NDS32_PLTBLOCKBFD_RELOC_NDS32_RELAX_REGION_BEGINBFD_RELOC_NDS32_RELAX_REGION_ENDBFD_RELOC_NDS32_MINUENDBFD_RELOC_NDS32_SUBTRAHENDBFD_RELOC_NDS32_DIFF8BFD_RELOC_NDS32_DIFF16BFD_RELOC_NDS32_DIFF32BFD_RELOC_NDS32_DIFF_ULEB128BFD_RELOC_NDS32_EMPTYBFD_RELOC_NDS32_25_ABSBFD_RELOC_NDS32_DATABFD_RELOC_NDS32_TRANBFD_RELOC_NDS32_17IFC_PCRELBFD_RELOC_NDS32_10IFCU_PCRELBFD_RELOC_NDS32_TPOFFBFD_RELOC_NDS32_GOTTPOFFBFD_RELOC_NDS32_TLS_LE_HI20BFD_RELOC_NDS32_TLS_LE_LO12BFD_RELOC_NDS32_TLS_LE_20BFD_RELOC_NDS32_TLS_LE_15S0BFD_RELOC_NDS32_TLS_LE_15S1BFD_RELOC_NDS32_TLS_LE_15S2BFD_RELOC_NDS32_TLS_LE_ADDBFD_RELOC_NDS32_TLS_LE_LSBFD_RELOC_NDS32_TLS_IE_HI20BFD_RELOC_NDS32_TLS_IE_LO12BFD_RELOC_NDS32_TLS_IE_LO12S2BFD_RELOC_NDS32_TLS_IEGP_HI20BFD_RELOC_NDS32_TLS_IEGP_LO12BFD_RELOC_NDS32_TLS_IEGP_LO12S2BFD_RELOC_NDS32_TLS_IEGP_LWBFD_RELOC_NDS32_TLS_DESCBFD_RELOC_NDS32_TLS_DESC_HI20BFD_RELOC_NDS32_TLS_DESC_LO12BFD_RELOC_NDS32_TLS_DESC_20BFD_RELOC_NDS32_TLS_DESC_SDA17S2BFD_RELOC_NDS32_TLS_DESC_ADDBFD_RELOC_NDS32_TLS_DESC_FUNCBFD_RELOC_NDS32_TLS_DESC_CALLBFD_RELOC_NDS32_TLS_DESC_MEMBFD_RELOC_NDS32_REMOVEBFD_RELOC_NDS32_GROUPBFD_RELOC_NDS32_LSIBFD_RELOC_V850_9_PCRELBFD_RELOC_V850_22_PCRELBFD_RELOC_V850_SDA_16_16_OFFSETBFD_RELOC_V850_SDA_15_16_OFFSETBFD_RELOC_V850_ZDA_16_16_OFFSETBFD_RELOC_V850_ZDA_15_16_OFFSETBFD_RELOC_V850_TDA_6_8_OFFSETBFD_RELOC_V850_TDA_7_8_OFFSETBFD_RELOC_V850_TDA_7_7_OFFSETBFD_RELOC_V850_TDA_16_16_OFFSETBFD_RELOC_V850_TDA_4_5_OFFSETBFD_RELOC_V850_TDA_4_4_OFFSETBFD_RELOC_V850_SDA_16_16_SPLIT_OFFSETBFD_RELOC_V850_ZDA_16_16_SPLIT_OFFSETBFD_RELOC_V850_CALLT_6_7_OFFSETBFD_RELOC_V850_CALLT_16_16_OFFSETBFD_RELOC_V850_LONGCALLBFD_RELOC_V850_LONGJUMPBFD_RELOC_V850_ALIGNBFD_RELOC_V850_LO16_SPLIT_OFFSETBFD_RELOC_V850_16_PCRELBFD_RELOC_V850_17_PCRELBFD_RELOC_V850_23BFD_RELOC_V850_32_PCRELBFD_RELOC_V850_32_ABSBFD_RELOC_V850_16_SPLIT_OFFSETBFD_RELOC_V850_16_S1BFD_RELOC_V850_LO16_S1BFD_RELOC_V850_CALLT_15_16_OFFSETBFD_RELOC_V850_32_GOTPCRELBFD_RELOC_V850_16_GOTBFD_RELOC_V850_32_GOTBFD_RELOC_V850_22_PLT_PCRELBFD_RELOC_V850_32_PLT_PCRELBFD_RELOC_V850_COPYBFD_RELOC_V850_GLOB_DATBFD_RELOC_V850_JMP_SLOTBFD_RELOC_V850_RELATIVEBFD_RELOC_V850_16_GOTOFFBFD_RELOC_V850_32_GOTOFFBFD_RELOC_V850_CODEBFD_RELOC_V850_DATABFD_RELOC_TIC30_LDPBFD_RELOC_TIC54X_PARTLS7BFD_RELOC_TIC54X_PARTMS9BFD_RELOC_TIC54X_23BFD_RELOC_TIC54X_16_OF_23BFD_RELOC_TIC54X_MS7_OF_23BFD_RELOC_C6000_PCR_S21BFD_RELOC_C6000_PCR_S12BFD_RELOC_C6000_PCR_S10BFD_RELOC_C6000_PCR_S7BFD_RELOC_C6000_ABS_S16BFD_RELOC_C6000_ABS_L16BFD_RELOC_C6000_ABS_H16BFD_RELOC_C6000_SBR_U15_BBFD_RELOC_C6000_SBR_U15_HBFD_RELOC_C6000_SBR_U15_WBFD_RELOC_C6000_SBR_S16BFD_RELOC_C6000_SBR_L16_BBFD_RELOC_C6000_SBR_L16_HBFD_RELOC_C6000_SBR_L16_WBFD_RELOC_C6000_SBR_H16_BBFD_RELOC_C6000_SBR_H16_HBFD_RELOC_C6000_SBR_H16_WBFD_RELOC_C6000_SBR_GOT_U15_WBFD_RELOC_C6000_SBR_GOT_L16_WBFD_RELOC_C6000_SBR_GOT_H16_WBFD_RELOC_C6000_DSBT_INDEXBFD_RELOC_C6000_PREL31BFD_RELOC_C6000_COPYBFD_RELOC_C6000_JUMP_SLOTBFD_RELOC_C6000_EHTYPEBFD_RELOC_C6000_PCR_H16BFD_RELOC_C6000_PCR_L16BFD_RELOC_C6000_ALIGNBFD_RELOC_C6000_FPHEADBFD_RELOC_C6000_NOCMPBFD_RELOC_FR30_48BFD_RELOC_FR30_20BFD_RELOC_FR30_6_IN_4BFD_RELOC_FR30_8_IN_8BFD_RELOC_FR30_9_IN_8BFD_RELOC_FR30_10_IN_8BFD_RELOC_FR30_9_PCRELBFD_RELOC_FR30_12_PCRELBFD_RELOC_MCORE_PCREL_IMM8BY4BFD_RELOC_MCORE_PCREL_IMM11BY2BFD_RELOC_MCORE_PCREL_IMM4BY2BFD_RELOC_MCORE_PCREL_32BFD_RELOC_MCORE_PCREL_JSR_IMM11BY2BFD_RELOC_MCORE_RVABFD_RELOC_MEP_8BFD_RELOC_MEP_16BFD_RELOC_MEP_32BFD_RELOC_MEP_PCREL8A2BFD_RELOC_MEP_PCREL12A2BFD_RELOC_MEP_PCREL17A2BFD_RELOC_MEP_PCREL24A2BFD_RELOC_MEP_PCABS24A2BFD_RELOC_MEP_LOW16BFD_RELOC_MEP_HI16UBFD_RELOC_MEP_HI16SBFD_RELOC_MEP_GPRELBFD_RELOC_MEP_TPRELBFD_RELOC_MEP_TPREL7BFD_RELOC_MEP_TPREL7A2BFD_RELOC_MEP_TPREL7A4BFD_RELOC_MEP_UIMM24BFD_RELOC_MEP_ADDR24A4BFD_RELOC_MEP_GNU_VTINHERITBFD_RELOC_MEP_GNU_VTENTRYBFD_RELOC_METAG_HIADDR16BFD_RELOC_METAG_LOADDR16BFD_RELOC_METAG_RELBRANCHBFD_RELOC_METAG_GETSETOFFBFD_RELOC_METAG_HIOGBFD_RELOC_METAG_LOOGBFD_RELOC_METAG_REL8BFD_RELOC_METAG_REL16BFD_RELOC_METAG_HI16_GOTOFFBFD_RELOC_METAG_LO16_GOTOFFBFD_RELOC_METAG_GETSET_GOTOFFBFD_RELOC_METAG_GETSET_GOTBFD_RELOC_METAG_HI16_GOTPCBFD_RELOC_METAG_LO16_GOTPCBFD_RELOC_METAG_HI16_PLTBFD_RELOC_METAG_LO16_PLTBFD_RELOC_METAG_RELBRANCH_PLTBFD_RELOC_METAG_GOTOFFBFD_RELOC_METAG_PLTBFD_RELOC_METAG_COPYBFD_RELOC_METAG_JMP_SLOTBFD_RELOC_METAG_RELATIVEBFD_RELOC_METAG_GLOB_DATBFD_RELOC_METAG_TLS_GDBFD_RELOC_METAG_TLS_LDMBFD_RELOC_METAG_TLS_LDO_HI16BFD_RELOC_METAG_TLS_LDO_LO16BFD_RELOC_METAG_TLS_LDOBFD_RELOC_METAG_TLS_IEBFD_RELOC_METAG_TLS_IENONPICBFD_RELOC_METAG_TLS_IENONPIC_HI16BFD_RELOC_METAG_TLS_IENONPIC_LO16BFD_RELOC_METAG_TLS_TPOFFBFD_RELOC_METAG_TLS_DTPMODBFD_RELOC_METAG_TLS_DTPOFFBFD_RELOC_METAG_TLS_LEBFD_RELOC_METAG_TLS_LE_HI16BFD_RELOC_METAG_TLS_LE_LO16BFD_RELOC_MMIX_GETABFD_RELOC_MMIX_GETA_1BFD_RELOC_MMIX_GETA_2BFD_RELOC_MMIX_GETA_3BFD_RELOC_MMIX_CBRANCHBFD_RELOC_MMIX_CBRANCH_JBFD_RELOC_MMIX_CBRANCH_1BFD_RELOC_MMIX_CBRANCH_2BFD_RELOC_MMIX_CBRANCH_3BFD_RELOC_MMIX_PUSHJBFD_RELOC_MMIX_PUSHJ_1BFD_RELOC_MMIX_PUSHJ_2BFD_RELOC_MMIX_PUSHJ_3BFD_RELOC_MMIX_PUSHJ_STUBBABLEBFD_RELOC_MMIX_JMPBFD_RELOC_MMIX_JMP_1BFD_RELOC_MMIX_JMP_2BFD_RELOC_MMIX_JMP_3BFD_RELOC_MMIX_ADDR19BFD_RELOC_MMIX_ADDR27BFD_RELOC_MMIX_REG_OR_BYTEBFD_RELOC_MMIX_REGBFD_RELOC_MMIX_BASE_PLUS_OFFSETBFD_RELOC_MMIX_LOCALBFD_RELOC_AVR_7_PCRELBFD_RELOC_AVR_13_PCRELBFD_RELOC_AVR_16_PMBFD_RELOC_AVR_LO8_LDIBFD_RELOC_AVR_HI8_LDIBFD_RELOC_AVR_HH8_LDIBFD_RELOC_AVR_MS8_LDIBFD_RELOC_AVR_LO8_LDI_NEGBFD_RELOC_AVR_HI8_LDI_NEGBFD_RELOC_AVR_HH8_LDI_NEGBFD_RELOC_AVR_MS8_LDI_NEGBFD_RELOC_AVR_LO8_LDI_PMBFD_RELOC_AVR_LO8_LDI_GSBFD_RELOC_AVR_HI8_LDI_PMBFD_RELOC_AVR_HI8_LDI_GSBFD_RELOC_AVR_HH8_LDI_PMBFD_RELOC_AVR_LO8_LDI_PM_NEGBFD_RELOC_AVR_HI8_LDI_PM_NEGBFD_RELOC_AVR_HH8_LDI_PM_NEGBFD_RELOC_AVR_CALLBFD_RELOC_AVR_LDIBFD_RELOC_AVR_6BFD_RELOC_AVR_6_ADIWBFD_RELOC_AVR_8_LOBFD_RELOC_AVR_8_HIBFD_RELOC_AVR_8_HLOBFD_RELOC_AVR_DIFF8BFD_RELOC_AVR_DIFF16BFD_RELOC_AVR_DIFF32BFD_RELOC_AVR_LDS_STS_16BFD_RELOC_AVR_PORT6BFD_RELOC_AVR_PORT5BFD_RELOC_RISCV_HI20BFD_RELOC_RISCV_PCREL_HI20BFD_RELOC_RISCV_PCREL_LO12_IBFD_RELOC_RISCV_PCREL_LO12_SBFD_RELOC_RISCV_LO12_IBFD_RELOC_RISCV_LO12_SBFD_RELOC_RISCV_GPREL12_IBFD_RELOC_RISCV_GPREL12_SBFD_RELOC_RISCV_TPREL_HI20BFD_RELOC_RISCV_TPREL_LO12_IBFD_RELOC_RISCV_TPREL_LO12_SBFD_RELOC_RISCV_TPREL_ADDBFD_RELOC_RISCV_CALLBFD_RELOC_RISCV_CALL_PLTBFD_RELOC_RISCV_ADD8BFD_RELOC_RISCV_ADD16BFD_RELOC_RISCV_ADD32BFD_RELOC_RISCV_ADD64BFD_RELOC_RISCV_SUB8BFD_RELOC_RISCV_SUB16BFD_RELOC_RISCV_SUB32BFD_RELOC_RISCV_SUB64BFD_RELOC_RISCV_GOT_HI20BFD_RELOC_RISCV_TLS_GOT_HI20BFD_RELOC_RISCV_TLS_GD_HI20BFD_RELOC_RISCV_JMPBFD_RELOC_RISCV_TLS_DTPMOD32BFD_RELOC_RISCV_TLS_DTPREL32BFD_RELOC_RISCV_TLS_DTPMOD64BFD_RELOC_RISCV_TLS_DTPREL64BFD_RELOC_RISCV_TLS_TPREL32BFD_RELOC_RISCV_TLS_TPREL64BFD_RELOC_RISCV_ALIGNBFD_RELOC_RISCV_RVC_BRANCHBFD_RELOC_RISCV_RVC_JUMPBFD_RELOC_RISCV_RVC_LUIBFD_RELOC_RISCV_GPREL_IBFD_RELOC_RISCV_GPREL_SBFD_RELOC_RISCV_TPREL_IBFD_RELOC_RISCV_TPREL_SBFD_RELOC_RISCV_RELAXBFD_RELOC_RISCV_CFABFD_RELOC_RISCV_SUB6BFD_RELOC_RISCV_SET6BFD_RELOC_RISCV_SET8BFD_RELOC_RISCV_SET16BFD_RELOC_RISCV_SET32BFD_RELOC_RISCV_32_PCRELBFD_RELOC_RL78_NEG8BFD_RELOC_RL78_NEG16BFD_RELOC_RL78_NEG24BFD_RELOC_RL78_NEG32BFD_RELOC_RL78_16_OPBFD_RELOC_RL78_24_OPBFD_RELOC_RL78_32_OPBFD_RELOC_RL78_8UBFD_RELOC_RL78_16UBFD_RELOC_RL78_24UBFD_RELOC_RL78_DIR3U_PCRELBFD_RELOC_RL78_DIFFBFD_RELOC_RL78_GPRELBBFD_RELOC_RL78_GPRELWBFD_RELOC_RL78_GPRELLBFD_RELOC_RL78_SYMBFD_RELOC_RL78_OP_SUBTRACTBFD_RELOC_RL78_OP_NEGBFD_RELOC_RL78_OP_ANDBFD_RELOC_RL78_OP_SHRABFD_RELOC_RL78_ABS8BFD_RELOC_RL78_ABS16BFD_RELOC_RL78_ABS16_REVBFD_RELOC_RL78_ABS32BFD_RELOC_RL78_ABS32_REVBFD_RELOC_RL78_ABS16UBFD_RELOC_RL78_ABS16UWBFD_RELOC_RL78_ABS16ULBFD_RELOC_RL78_RELAXBFD_RELOC_RL78_HI16BFD_RELOC_RL78_HI8BFD_RELOC_RL78_LO16BFD_RELOC_RL78_CODEBFD_RELOC_RL78_SADDRBFD_RELOC_RX_NEG8BFD_RELOC_RX_NEG16BFD_RELOC_RX_NEG24BFD_RELOC_RX_NEG32BFD_RELOC_RX_16_OPBFD_RELOC_RX_24_OPBFD_RELOC_RX_32_OPBFD_RELOC_RX_8UBFD_RELOC_RX_16UBFD_RELOC_RX_24UBFD_RELOC_RX_DIR3U_PCRELBFD_RELOC_RX_DIFFBFD_RELOC_RX_GPRELBBFD_RELOC_RX_GPRELWBFD_RELOC_RX_GPRELLBFD_RELOC_RX_SYMBFD_RELOC_RX_OP_SUBTRACTBFD_RELOC_RX_OP_NEGBFD_RELOC_RX_ABS8BFD_RELOC_RX_ABS16BFD_RELOC_RX_ABS16_REVBFD_RELOC_RX_ABS32BFD_RELOC_RX_ABS32_REVBFD_RELOC_RX_ABS16UBFD_RELOC_RX_ABS16UWBFD_RELOC_RX_ABS16ULBFD_RELOC_RX_RELAXBFD_RELOC_390_12BFD_RELOC_390_GOT12BFD_RELOC_390_PLT32BFD_RELOC_390_COPYBFD_RELOC_390_GLOB_DATBFD_RELOC_390_JMP_SLOTBFD_RELOC_390_RELATIVEBFD_RELOC_390_GOTPCBFD_RELOC_390_GOT16BFD_RELOC_390_PC12DBLBFD_RELOC_390_PLT12DBLBFD_RELOC_390_PC16DBLBFD_RELOC_390_PLT16DBLBFD_RELOC_390_PC24DBLBFD_RELOC_390_PLT24DBLBFD_RELOC_390_PC32DBLBFD_RELOC_390_PLT32DBLBFD_RELOC_390_GOTPCDBLBFD_RELOC_390_GOT64BFD_RELOC_390_PLT64BFD_RELOC_390_GOTENTBFD_RELOC_390_GOTOFF64BFD_RELOC_390_GOTPLT12BFD_RELOC_390_GOTPLT16BFD_RELOC_390_GOTPLT32BFD_RELOC_390_GOTPLT64BFD_RELOC_390_GOTPLTENTBFD_RELOC_390_PLTOFF16BFD_RELOC_390_PLTOFF32BFD_RELOC_390_PLTOFF64BFD_RELOC_390_TLS_LOADBFD_RELOC_390_TLS_GDCALLBFD_RELOC_390_TLS_LDCALLBFD_RELOC_390_TLS_GD32BFD_RELOC_390_TLS_GD64BFD_RELOC_390_TLS_GOTIE12BFD_RELOC_390_TLS_GOTIE32BFD_RELOC_390_TLS_GOTIE64BFD_RELOC_390_TLS_LDM32BFD_RELOC_390_TLS_LDM64BFD_RELOC_390_TLS_IE32BFD_RELOC_390_TLS_IE64BFD_RELOC_390_TLS_IEENTBFD_RELOC_390_TLS_LE32BFD_RELOC_390_TLS_LE64BFD_RELOC_390_TLS_LDO32BFD_RELOC_390_TLS_LDO64BFD_RELOC_390_TLS_DTPMODBFD_RELOC_390_TLS_DTPOFFBFD_RELOC_390_TLS_TPOFFBFD_RELOC_390_20BFD_RELOC_390_GOT20BFD_RELOC_390_GOTPLT20BFD_RELOC_390_TLS_GOTIE20BFD_RELOC_390_IRELATIVEBFD_RELOC_SCORE_GPREL15BFD_RELOC_SCORE_DUMMY2BFD_RELOC_SCORE_JMPBFD_RELOC_SCORE_BRANCHBFD_RELOC_SCORE_IMM30BFD_RELOC_SCORE_IMM32BFD_RELOC_SCORE16_JMPBFD_RELOC_SCORE16_BRANCHBFD_RELOC_SCORE_BCMPBFD_RELOC_SCORE_GOT15BFD_RELOC_SCORE_GOT_LO16BFD_RELOC_SCORE_CALL15BFD_RELOC_SCORE_DUMMY_HI16BFD_RELOC_IP2K_FR9BFD_RELOC_IP2K_BANKBFD_RELOC_IP2K_ADDR16CJPBFD_RELOC_IP2K_PAGE3BFD_RELOC_IP2K_LO8DATABFD_RELOC_IP2K_HI8DATABFD_RELOC_IP2K_EX8DATABFD_RELOC_IP2K_LO8INSNBFD_RELOC_IP2K_HI8INSNBFD_RELOC_IP2K_PC_SKIPBFD_RELOC_IP2K_TEXTBFD_RELOC_IP2K_FR_OFFSETBFD_RELOC_VPE4KMATH_DATABFD_RELOC_VPE4KMATH_INSNBFD_RELOC_VTABLE_INHERITBFD_RELOC_VTABLE_ENTRYBFD_RELOC_IA64_IMM14BFD_RELOC_IA64_IMM22BFD_RELOC_IA64_IMM64BFD_RELOC_IA64_DIR32MSBBFD_RELOC_IA64_DIR32LSBBFD_RELOC_IA64_DIR64MSBBFD_RELOC_IA64_DIR64LSBBFD_RELOC_IA64_GPREL22BFD_RELOC_IA64_GPREL64IBFD_RELOC_IA64_GPREL32MSBBFD_RELOC_IA64_GPREL32LSBBFD_RELOC_IA64_GPREL64MSBBFD_RELOC_IA64_GPREL64LSBBFD_RELOC_IA64_LTOFF22BFD_RELOC_IA64_LTOFF64IBFD_RELOC_IA64_PLTOFF22BFD_RELOC_IA64_PLTOFF64IBFD_RELOC_IA64_PLTOFF64MSBBFD_RELOC_IA64_PLTOFF64LSBBFD_RELOC_IA64_FPTR64IBFD_RELOC_IA64_FPTR32MSBBFD_RELOC_IA64_FPTR32LSBBFD_RELOC_IA64_FPTR64MSBBFD_RELOC_IA64_FPTR64LSBBFD_RELOC_IA64_PCREL21BBFD_RELOC_IA64_PCREL21BIBFD_RELOC_IA64_PCREL21MBFD_RELOC_IA64_PCREL21FBFD_RELOC_IA64_PCREL22BFD_RELOC_IA64_PCREL60BBFD_RELOC_IA64_PCREL64IBFD_RELOC_IA64_PCREL32MSBBFD_RELOC_IA64_PCREL32LSBBFD_RELOC_IA64_PCREL64MSBBFD_RELOC_IA64_PCREL64LSBBFD_RELOC_IA64_LTOFF_FPTR22BFD_RELOC_IA64_LTOFF_FPTR64IBFD_RELOC_IA64_LTOFF_FPTR32MSBBFD_RELOC_IA64_LTOFF_FPTR32LSBBFD_RELOC_IA64_LTOFF_FPTR64MSBBFD_RELOC_IA64_LTOFF_FPTR64LSBBFD_RELOC_IA64_SEGREL32MSBBFD_RELOC_IA64_SEGREL32LSBBFD_RELOC_IA64_SEGREL64MSBBFD_RELOC_IA64_SEGREL64LSBBFD_RELOC_IA64_SECREL32MSBBFD_RELOC_IA64_SECREL32LSBBFD_RELOC_IA64_SECREL64MSBBFD_RELOC_IA64_SECREL64LSBBFD_RELOC_IA64_REL32MSBBFD_RELOC_IA64_REL32LSBBFD_RELOC_IA64_REL64MSBBFD_RELOC_IA64_REL64LSBBFD_RELOC_IA64_LTV32MSBBFD_RELOC_IA64_LTV32LSBBFD_RELOC_IA64_LTV64MSBBFD_RELOC_IA64_LTV64LSBBFD_RELOC_IA64_IPLTMSBBFD_RELOC_IA64_IPLTLSBBFD_RELOC_IA64_COPYBFD_RELOC_IA64_LTOFF22XBFD_RELOC_IA64_LDXMOVBFD_RELOC_IA64_TPREL14BFD_RELOC_IA64_TPREL22BFD_RELOC_IA64_TPREL64IBFD_RELOC_IA64_TPREL64MSBBFD_RELOC_IA64_TPREL64LSBBFD_RELOC_IA64_LTOFF_TPREL22BFD_RELOC_IA64_DTPMOD64MSBBFD_RELOC_IA64_DTPMOD64LSBBFD_RELOC_IA64_LTOFF_DTPMOD22BFD_RELOC_IA64_DTPREL14BFD_RELOC_IA64_DTPREL22BFD_RELOC_IA64_DTPREL64IBFD_RELOC_IA64_DTPREL32MSBBFD_RELOC_IA64_DTPREL32LSBBFD_RELOC_IA64_DTPREL64MSBBFD_RELOC_IA64_DTPREL64LSBBFD_RELOC_IA64_LTOFF_DTPREL22BFD_RELOC_M68HC11_HI8BFD_RELOC_M68HC11_LO8BFD_RELOC_M68HC11_3BBFD_RELOC_M68HC11_RL_JUMPBFD_RELOC_M68HC11_RL_GROUPBFD_RELOC_M68HC11_LO16BFD_RELOC_M68HC11_PAGEBFD_RELOC_M68HC11_24BFD_RELOC_M68HC12_5BBFD_RELOC_XGATE_RL_JUMPBFD_RELOC_XGATE_RL_GROUPBFD_RELOC_XGATE_LO16BFD_RELOC_XGATE_GPAGEBFD_RELOC_XGATE_24BFD_RELOC_XGATE_PCREL_9BFD_RELOC_XGATE_PCREL_10BFD_RELOC_XGATE_IMM8_LOBFD_RELOC_XGATE_IMM8_HIBFD_RELOC_XGATE_IMM3BFD_RELOC_XGATE_IMM4BFD_RELOC_XGATE_IMM5BFD_RELOC_M68HC12_9BBFD_RELOC_M68HC12_16BBFD_RELOC_M68HC12_9_PCRELBFD_RELOC_M68HC12_10_PCRELBFD_RELOC_M68HC12_LO8XGBFD_RELOC_M68HC12_HI8XGBFD_RELOC_S12Z_15_PCRELBFD_RELOC_CR16_NUM8BFD_RELOC_CR16_NUM16BFD_RELOC_CR16_NUM32BFD_RELOC_CR16_NUM32aBFD_RELOC_CR16_REGREL0BFD_RELOC_CR16_REGREL4BFD_RELOC_CR16_REGREL4aBFD_RELOC_CR16_REGREL14BFD_RELOC_CR16_REGREL14aBFD_RELOC_CR16_REGREL16BFD_RELOC_CR16_REGREL20BFD_RELOC_CR16_REGREL20aBFD_RELOC_CR16_ABS20BFD_RELOC_CR16_ABS24BFD_RELOC_CR16_IMM4BFD_RELOC_CR16_IMM8BFD_RELOC_CR16_IMM16BFD_RELOC_CR16_IMM20BFD_RELOC_CR16_IMM24BFD_RELOC_CR16_IMM32BFD_RELOC_CR16_IMM32aBFD_RELOC_CR16_DISP4BFD_RELOC_CR16_DISP8BFD_RELOC_CR16_DISP16BFD_RELOC_CR16_DISP20BFD_RELOC_CR16_DISP24BFD_RELOC_CR16_DISP24aBFD_RELOC_CR16_SWITCH8BFD_RELOC_CR16_SWITCH16BFD_RELOC_CR16_SWITCH32BFD_RELOC_CR16_GOT_REGREL20BFD_RELOC_CR16_GOTC_REGREL20BFD_RELOC_CR16_GLOB_DATBFD_RELOC_CRX_REL4BFD_RELOC_CRX_REL8BFD_RELOC_CRX_REL8_CMPBFD_RELOC_CRX_REL16BFD_RELOC_CRX_REL24BFD_RELOC_CRX_REL32BFD_RELOC_CRX_REGREL12BFD_RELOC_CRX_REGREL22BFD_RELOC_CRX_REGREL28BFD_RELOC_CRX_REGREL32BFD_RELOC_CRX_ABS16BFD_RELOC_CRX_ABS32BFD_RELOC_CRX_NUM8BFD_RELOC_CRX_NUM16BFD_RELOC_CRX_NUM32BFD_RELOC_CRX_IMM16BFD_RELOC_CRX_IMM32BFD_RELOC_CRX_SWITCH8BFD_RELOC_CRX_SWITCH16BFD_RELOC_CRX_SWITCH32BFD_RELOC_CRIS_BDISP8BFD_RELOC_CRIS_UNSIGNED_5BFD_RELOC_CRIS_SIGNED_6BFD_RELOC_CRIS_UNSIGNED_6BFD_RELOC_CRIS_SIGNED_8BFD_RELOC_CRIS_UNSIGNED_8BFD_RELOC_CRIS_SIGNED_16BFD_RELOC_CRIS_UNSIGNED_16BFD_RELOC_CRIS_LAPCQ_OFFSETBFD_RELOC_CRIS_UNSIGNED_4BFD_RELOC_CRIS_COPYBFD_RELOC_CRIS_GLOB_DATBFD_RELOC_CRIS_JUMP_SLOTBFD_RELOC_CRIS_RELATIVEBFD_RELOC_CRIS_32_GOTBFD_RELOC_CRIS_16_GOTBFD_RELOC_CRIS_32_GOTPLTBFD_RELOC_CRIS_16_GOTPLTBFD_RELOC_CRIS_32_GOTRELBFD_RELOC_CRIS_32_PLT_GOTRELBFD_RELOC_CRIS_32_PLT_PCRELBFD_RELOC_CRIS_32_GOT_GDBFD_RELOC_CRIS_16_GOT_GDBFD_RELOC_CRIS_32_GDBFD_RELOC_CRIS_DTPBFD_RELOC_CRIS_32_DTPRELBFD_RELOC_CRIS_16_DTPRELBFD_RELOC_CRIS_32_GOT_TPRELBFD_RELOC_CRIS_16_GOT_TPRELBFD_RELOC_CRIS_32_TPRELBFD_RELOC_CRIS_16_TPRELBFD_RELOC_CRIS_DTPMODBFD_RELOC_CRIS_32_IEBFD_RELOC_OR1K_REL_26BFD_RELOC_OR1K_SLO16BFD_RELOC_OR1K_PCREL_PG21BFD_RELOC_OR1K_LO13BFD_RELOC_OR1K_SLO13BFD_RELOC_OR1K_GOTPC_HI16BFD_RELOC_OR1K_GOTPC_LO16BFD_RELOC_OR1K_GOT_AHI16BFD_RELOC_OR1K_GOT16BFD_RELOC_OR1K_GOT_PG21BFD_RELOC_OR1K_GOT_LO13BFD_RELOC_OR1K_PLT26BFD_RELOC_OR1K_PLTA26BFD_RELOC_OR1K_GOTOFF_SLO16BFD_RELOC_OR1K_COPYBFD_RELOC_OR1K_GLOB_DATBFD_RELOC_OR1K_JMP_SLOTBFD_RELOC_OR1K_RELATIVEBFD_RELOC_OR1K_TLS_GD_HI16BFD_RELOC_OR1K_TLS_GD_LO16BFD_RELOC_OR1K_TLS_GD_PG21BFD_RELOC_OR1K_TLS_GD_LO13BFD_RELOC_OR1K_TLS_LDM_HI16BFD_RELOC_OR1K_TLS_LDM_LO16BFD_RELOC_OR1K_TLS_LDM_PG21BFD_RELOC_OR1K_TLS_LDM_LO13BFD_RELOC_OR1K_TLS_LDO_HI16BFD_RELOC_OR1K_TLS_LDO_LO16BFD_RELOC_OR1K_TLS_IE_HI16BFD_RELOC_OR1K_TLS_IE_AHI16BFD_RELOC_OR1K_TLS_IE_LO16BFD_RELOC_OR1K_TLS_IE_PG21BFD_RELOC_OR1K_TLS_IE_LO13BFD_RELOC_OR1K_TLS_LE_HI16BFD_RELOC_OR1K_TLS_LE_AHI16BFD_RELOC_OR1K_TLS_LE_LO16BFD_RELOC_OR1K_TLS_LE_SLO16BFD_RELOC_OR1K_TLS_TPOFFBFD_RELOC_OR1K_TLS_DTPOFFBFD_RELOC_OR1K_TLS_DTPMODBFD_RELOC_H8_DIR16A8BFD_RELOC_H8_DIR16R8BFD_RELOC_H8_DIR24A8BFD_RELOC_H8_DIR24R8BFD_RELOC_H8_DIR32A16BFD_RELOC_H8_DISP32A16BFD_RELOC_XSTORMY16_REL_12BFD_RELOC_XSTORMY16_12BFD_RELOC_XSTORMY16_24BFD_RELOC_XSTORMY16_FPTR16BFD_RELOC_RELCBFD_RELOC_XC16X_PAGBFD_RELOC_XC16X_POFBFD_RELOC_XC16X_SEGBFD_RELOC_XC16X_SOFBFD_RELOC_VAX_GLOB_DATBFD_RELOC_VAX_JMP_SLOTBFD_RELOC_VAX_RELATIVEBFD_RELOC_MT_PC16BFD_RELOC_MT_HI16BFD_RELOC_MT_LO16BFD_RELOC_MT_GNU_VTINHERITBFD_RELOC_MT_GNU_VTENTRYBFD_RELOC_MT_PCINSN8BFD_RELOC_MSP430_10_PCRELBFD_RELOC_MSP430_16_PCRELBFD_RELOC_MSP430_16BFD_RELOC_MSP430_16_PCREL_BYTEBFD_RELOC_MSP430_16_BYTEBFD_RELOC_MSP430_2X_PCRELBFD_RELOC_MSP430_RL_PCRELBFD_RELOC_MSP430_ABS8BFD_RELOC_MSP430X_PCR20_EXT_SRCBFD_RELOC_MSP430X_PCR20_EXT_DSTBFD_RELOC_MSP430X_PCR20_EXT_ODSTBFD_RELOC_MSP430X_ABS20_EXT_SRCBFD_RELOC_MSP430X_ABS20_EXT_DSTBFD_RELOC_MSP430X_ABS20_EXT_ODSTBFD_RELOC_MSP430X_ABS20_ADR_SRCBFD_RELOC_MSP430X_ABS20_ADR_DSTBFD_RELOC_MSP430X_PCR16BFD_RELOC_MSP430X_PCR20_CALLBFD_RELOC_MSP430X_ABS16BFD_RELOC_MSP430_ABS_HI16BFD_RELOC_MSP430_PREL31BFD_RELOC_MSP430_SYM_DIFFBFD_RELOC_MSP430_SET_ULEB128BFD_RELOC_MSP430_SUB_ULEB128BFD_RELOC_NIOS2_S16BFD_RELOC_NIOS2_U16BFD_RELOC_NIOS2_CALL26BFD_RELOC_NIOS2_IMM5BFD_RELOC_NIOS2_CACHE_OPXBFD_RELOC_NIOS2_IMM6BFD_RELOC_NIOS2_IMM8BFD_RELOC_NIOS2_HI16BFD_RELOC_NIOS2_LO16BFD_RELOC_NIOS2_HIADJ16BFD_RELOC_NIOS2_GPRELBFD_RELOC_NIOS2_UJMPBFD_RELOC_NIOS2_CJMPBFD_RELOC_NIOS2_CALLRBFD_RELOC_NIOS2_ALIGNBFD_RELOC_NIOS2_GOT16BFD_RELOC_NIOS2_CALL16BFD_RELOC_NIOS2_GOTOFF_LOBFD_RELOC_NIOS2_GOTOFF_HABFD_RELOC_NIOS2_PCREL_LOBFD_RELOC_NIOS2_PCREL_HABFD_RELOC_NIOS2_TLS_GD16BFD_RELOC_NIOS2_TLS_LDM16BFD_RELOC_NIOS2_TLS_LDO16BFD_RELOC_NIOS2_TLS_IE16BFD_RELOC_NIOS2_TLS_LE16BFD_RELOC_NIOS2_TLS_DTPMODBFD_RELOC_NIOS2_TLS_DTPRELBFD_RELOC_NIOS2_TLS_TPRELBFD_RELOC_NIOS2_COPYBFD_RELOC_NIOS2_GLOB_DATBFD_RELOC_NIOS2_JUMP_SLOTBFD_RELOC_NIOS2_RELATIVEBFD_RELOC_NIOS2_GOTOFFBFD_RELOC_NIOS2_CALL26_NOATBFD_RELOC_NIOS2_GOT_LOBFD_RELOC_NIOS2_GOT_HABFD_RELOC_NIOS2_CALL_LOBFD_RELOC_NIOS2_CALL_HABFD_RELOC_NIOS2_R2_S12BFD_RELOC_NIOS2_R2_I10_1_PCRELBFD_RELOC_NIOS2_R2_T1I7_1_PCRELBFD_RELOC_NIOS2_R2_T1I7_2BFD_RELOC_NIOS2_R2_T2I4BFD_RELOC_NIOS2_R2_T2I4_1BFD_RELOC_NIOS2_R2_T2I4_2BFD_RELOC_NIOS2_R2_X1I7_2BFD_RELOC_NIOS2_R2_X2L5BFD_RELOC_NIOS2_R2_F1I5_2BFD_RELOC_NIOS2_R2_L5I4X1BFD_RELOC_NIOS2_R2_T1X1I6BFD_RELOC_NIOS2_R2_T1X1I6_2BFD_RELOC_PRU_U16BFD_RELOC_PRU_U16_PMEMIMMBFD_RELOC_PRU_LDI32BFD_RELOC_PRU_S10_PCRELBFD_RELOC_PRU_U8_PCRELBFD_RELOC_PRU_32_PMEMBFD_RELOC_PRU_16_PMEMBFD_RELOC_PRU_GNU_DIFF8BFD_RELOC_PRU_GNU_DIFF16BFD_RELOC_PRU_GNU_DIFF32BFD_RELOC_PRU_GNU_DIFF16_PMEMBFD_RELOC_PRU_GNU_DIFF32_PMEMBFD_RELOC_IQ2000_OFFSET_16BFD_RELOC_IQ2000_OFFSET_21BFD_RELOC_IQ2000_UHI16BFD_RELOC_XTENSA_RTLDBFD_RELOC_XTENSA_GLOB_DATBFD_RELOC_XTENSA_JMP_SLOTBFD_RELOC_XTENSA_RELATIVEBFD_RELOC_XTENSA_PLTBFD_RELOC_XTENSA_DIFF8BFD_RELOC_XTENSA_DIFF16BFD_RELOC_XTENSA_DIFF32BFD_RELOC_XTENSA_SLOT0_OPBFD_RELOC_XTENSA_SLOT1_OPBFD_RELOC_XTENSA_SLOT2_OPBFD_RELOC_XTENSA_SLOT3_OPBFD_RELOC_XTENSA_SLOT4_OPBFD_RELOC_XTENSA_SLOT5_OPBFD_RELOC_XTENSA_SLOT6_OPBFD_RELOC_XTENSA_SLOT7_OPBFD_RELOC_XTENSA_SLOT8_OPBFD_RELOC_XTENSA_SLOT9_OPBFD_RELOC_XTENSA_SLOT10_OPBFD_RELOC_XTENSA_SLOT11_OPBFD_RELOC_XTENSA_SLOT12_OPBFD_RELOC_XTENSA_SLOT13_OPBFD_RELOC_XTENSA_SLOT14_OPBFD_RELOC_XTENSA_SLOT0_ALTBFD_RELOC_XTENSA_SLOT1_ALTBFD_RELOC_XTENSA_SLOT2_ALTBFD_RELOC_XTENSA_SLOT3_ALTBFD_RELOC_XTENSA_SLOT4_ALTBFD_RELOC_XTENSA_SLOT5_ALTBFD_RELOC_XTENSA_SLOT6_ALTBFD_RELOC_XTENSA_SLOT7_ALTBFD_RELOC_XTENSA_SLOT8_ALTBFD_RELOC_XTENSA_SLOT9_ALTBFD_RELOC_XTENSA_SLOT10_ALTBFD_RELOC_XTENSA_SLOT11_ALTBFD_RELOC_XTENSA_SLOT12_ALTBFD_RELOC_XTENSA_SLOT13_ALTBFD_RELOC_XTENSA_SLOT14_ALTBFD_RELOC_XTENSA_OP0BFD_RELOC_XTENSA_OP1BFD_RELOC_XTENSA_OP2BFD_RELOC_XTENSA_ASM_EXPANDBFD_RELOC_XTENSA_ASM_SIMPLIFYBFD_RELOC_XTENSA_TLSDESC_FNBFD_RELOC_XTENSA_TLSDESC_ARGBFD_RELOC_XTENSA_TLS_DTPOFFBFD_RELOC_XTENSA_TLS_TPOFFBFD_RELOC_XTENSA_TLS_FUNCBFD_RELOC_XTENSA_TLS_ARGBFD_RELOC_XTENSA_TLS_CALLBFD_RELOC_XTENSA_PDIFF8BFD_RELOC_XTENSA_PDIFF16BFD_RELOC_XTENSA_PDIFF32BFD_RELOC_XTENSA_NDIFF8BFD_RELOC_XTENSA_NDIFF16BFD_RELOC_XTENSA_NDIFF32BFD_RELOC_Z80_DISP8BFD_RELOC_Z80_BYTE0BFD_RELOC_Z80_BYTE1BFD_RELOC_Z80_BYTE2BFD_RELOC_Z80_BYTE3BFD_RELOC_Z80_WORD0BFD_RELOC_Z80_WORD1BFD_RELOC_Z80_16_BEBFD_RELOC_Z8K_DISP7BFD_RELOC_Z8K_CALLRBFD_RELOC_Z8K_IMM4LBFD_RELOC_LM32_CALLBFD_RELOC_LM32_BRANCHBFD_RELOC_LM32_16_GOTBFD_RELOC_LM32_GOTOFF_HI16BFD_RELOC_LM32_GOTOFF_LO16BFD_RELOC_LM32_COPYBFD_RELOC_LM32_GLOB_DATBFD_RELOC_LM32_JMP_SLOTBFD_RELOC_LM32_RELATIVEBFD_RELOC_MACH_O_SECTDIFFBFD_RELOC_MACH_O_LOCAL_SECTDIFFBFD_RELOC_MACH_O_PAIRBFD_RELOC_MACH_O_SUBTRACTOR32BFD_RELOC_MACH_O_SUBTRACTOR64BFD_RELOC_MACH_O_X86_64_BRANCH32BFD_RELOC_MACH_O_X86_64_BRANCH8BFD_RELOC_MACH_O_X86_64_GOTBFD_RELOC_MACH_O_X86_64_GOT_LOADBFD_RELOC_MACH_O_X86_64_PCREL32_1BFD_RELOC_MACH_O_X86_64_PCREL32_2BFD_RELOC_MACH_O_X86_64_PCREL32_4BFD_RELOC_MACH_O_X86_64_TLVBFD_RELOC_MACH_O_ARM64_ADDENDBFD_RELOC_MACH_O_ARM64_GOT_LOAD_PAGE21BFD_RELOC_MACH_O_ARM64_GOT_LOAD_PAGEOFF12BFD_RELOC_MACH_O_ARM64_POINTER_TO_GOTBFD_RELOC_MICROBLAZE_32_LOBFD_RELOC_MICROBLAZE_32_LO_PCRELBFD_RELOC_MICROBLAZE_32_ROSDABFD_RELOC_MICROBLAZE_32_RWSDABFD_RELOC_MICROBLAZE_32_SYM_OP_SYMBFD_RELOC_MICROBLAZE_64_NONEBFD_RELOC_MICROBLAZE_64_GOTPCBFD_RELOC_MICROBLAZE_64_GOTBFD_RELOC_MICROBLAZE_64_PLTBFD_RELOC_MICROBLAZE_64_GOTOFFBFD_RELOC_MICROBLAZE_32_GOTOFFBFD_RELOC_MICROBLAZE_COPYBFD_RELOC_MICROBLAZE_64_TLSBFD_RELOC_MICROBLAZE_64_TLSGDBFD_RELOC_MICROBLAZE_64_TLSLDBFD_RELOC_MICROBLAZE_32_TLSDTPMODBFD_RELOC_MICROBLAZE_32_TLSDTPRELBFD_RELOC_MICROBLAZE_64_TLSDTPRELBFD_RELOC_MICROBLAZE_64_TLSGOTTPRELBFD_RELOC_MICROBLAZE_64_TLSTPRELBFD_RELOC_MICROBLAZE_64_TEXTPCRELBFD_RELOC_MICROBLAZE_64_TEXTRELBFD_RELOC_AARCH64_RELOC_STARTBFD_RELOC_AARCH64_NULLBFD_RELOC_AARCH64_NONEBFD_RELOC_AARCH64_64BFD_RELOC_AARCH64_32BFD_RELOC_AARCH64_16BFD_RELOC_AARCH64_64_PCRELBFD_RELOC_AARCH64_32_PCRELBFD_RELOC_AARCH64_16_PCRELBFD_RELOC_AARCH64_MOVW_G0BFD_RELOC_AARCH64_MOVW_G0_NCBFD_RELOC_AARCH64_MOVW_G1BFD_RELOC_AARCH64_MOVW_G1_NCBFD_RELOC_AARCH64_MOVW_G2BFD_RELOC_AARCH64_MOVW_G2_NCBFD_RELOC_AARCH64_MOVW_G3BFD_RELOC_AARCH64_MOVW_G0_SBFD_RELOC_AARCH64_MOVW_G1_SBFD_RELOC_AARCH64_MOVW_G2_SBFD_RELOC_AARCH64_MOVW_PREL_G0BFD_RELOC_AARCH64_MOVW_PREL_G0_NCBFD_RELOC_AARCH64_MOVW_PREL_G1BFD_RELOC_AARCH64_MOVW_PREL_G1_NCBFD_RELOC_AARCH64_MOVW_PREL_G2BFD_RELOC_AARCH64_MOVW_PREL_G2_NCBFD_RELOC_AARCH64_MOVW_PREL_G3BFD_RELOC_AARCH64_LD_LO19_PCRELBFD_RELOC_AARCH64_ADR_LO21_PCRELBFD_RELOC_AARCH64_ADR_HI21_PCRELBFD_RELOC_AARCH64_ADR_HI21_NC_PCRELBFD_RELOC_AARCH64_ADD_LO12BFD_RELOC_AARCH64_LDST8_LO12BFD_RELOC_AARCH64_TSTBR14BFD_RELOC_AARCH64_BRANCH19BFD_RELOC_AARCH64_JUMP26BFD_RELOC_AARCH64_CALL26BFD_RELOC_AARCH64_LDST16_LO12BFD_RELOC_AARCH64_LDST32_LO12BFD_RELOC_AARCH64_LDST64_LO12BFD_RELOC_AARCH64_LDST128_LO12BFD_RELOC_AARCH64_GOT_LD_PREL19BFD_RELOC_AARCH64_ADR_GOT_PAGEBFD_RELOC_AARCH64_LD64_GOT_LO12_NCBFD_RELOC_AARCH64_LD32_GOT_LO12_NCBFD_RELOC_AARCH64_MOVW_GOTOFF_G0_NCBFD_RELOC_AARCH64_MOVW_GOTOFF_G1BFD_RELOC_AARCH64_LD64_GOTOFF_LO15BFD_RELOC_AARCH64_LD32_GOTPAGE_LO14BFD_RELOC_AARCH64_LD64_GOTPAGE_LO15BFD_RELOC_AARCH64_TLSGD_ADR_PAGE21BFD_RELOC_AARCH64_TLSGD_ADR_PREL21BFD_RELOC_AARCH64_TLSGD_ADD_LO12_NCBFD_RELOC_AARCH64_TLSGD_MOVW_G0_NCBFD_RELOC_AARCH64_TLSGD_MOVW_G1BFD_RELOC_AARCH64_TLSIE_ADR_GOTTPREL_PAGE21BFD_RELOC_AARCH64_TLSIE_LD64_GOTTPREL_LO12_NCBFD_RELOC_AARCH64_TLSIE_LD32_GOTTPREL_LO12_NCBFD_RELOC_AARCH64_TLSIE_LD_GOTTPREL_PREL19BFD_RELOC_AARCH64_TLSIE_MOVW_GOTTPREL_G0_NCBFD_RELOC_AARCH64_TLSIE_MOVW_GOTTPREL_G1BFD_RELOC_AARCH64_TLSLD_ADD_DTPREL_HI12BFD_RELOC_AARCH64_TLSLD_ADD_DTPREL_LO12BFD_RELOC_AARCH64_TLSLD_ADD_DTPREL_LO12_NCBFD_RELOC_AARCH64_TLSLD_ADD_LO12_NCBFD_RELOC_AARCH64_TLSLD_ADR_PAGE21BFD_RELOC_AARCH64_TLSLD_ADR_PREL21BFD_RELOC_AARCH64_TLSLD_LDST16_DTPREL_LO12BFD_RELOC_AARCH64_TLSLD_LDST16_DTPREL_LO12_NCBFD_RELOC_AARCH64_TLSLD_LDST32_DTPREL_LO12BFD_RELOC_AARCH64_TLSLD_LDST32_DTPREL_LO12_NCBFD_RELOC_AARCH64_TLSLD_LDST64_DTPREL_LO12BFD_RELOC_AARCH64_TLSLD_LDST64_DTPREL_LO12_NCBFD_RELOC_AARCH64_TLSLD_LDST8_DTPREL_LO12BFD_RELOC_AARCH64_TLSLD_LDST8_DTPREL_LO12_NCBFD_RELOC_AARCH64_TLSLD_MOVW_DTPREL_G0BFD_RELOC_AARCH64_TLSLD_MOVW_DTPREL_G0_NCBFD_RELOC_AARCH64_TLSLD_MOVW_DTPREL_G1BFD_RELOC_AARCH64_TLSLD_MOVW_DTPREL_G1_NCBFD_RELOC_AARCH64_TLSLD_MOVW_DTPREL_G2BFD_RELOC_AARCH64_TLSLE_MOVW_TPREL_G2BFD_RELOC_AARCH64_TLSLE_MOVW_TPREL_G1BFD_RELOC_AARCH64_TLSLE_MOVW_TPREL_G1_NCBFD_RELOC_AARCH64_TLSLE_MOVW_TPREL_G0BFD_RELOC_AARCH64_TLSLE_MOVW_TPREL_G0_NCBFD_RELOC_AARCH64_TLSLE_ADD_TPREL_HI12BFD_RELOC_AARCH64_TLSLE_ADD_TPREL_LO12BFD_RELOC_AARCH64_TLSLE_ADD_TPREL_LO12_NCBFD_RELOC_AARCH64_TLSLE_LDST16_TPREL_LO12BFD_RELOC_AARCH64_TLSLE_LDST16_TPREL_LO12_NCBFD_RELOC_AARCH64_TLSLE_LDST32_TPREL_LO12BFD_RELOC_AARCH64_TLSLE_LDST32_TPREL_LO12_NCBFD_RELOC_AARCH64_TLSLE_LDST64_TPREL_LO12BFD_RELOC_AARCH64_TLSLE_LDST64_TPREL_LO12_NCBFD_RELOC_AARCH64_TLSLE_LDST8_TPREL_LO12BFD_RELOC_AARCH64_TLSLE_LDST8_TPREL_LO12_NCBFD_RELOC_AARCH64_TLSDESC_LD_PREL19BFD_RELOC_AARCH64_TLSDESC_ADR_PREL21BFD_RELOC_AARCH64_TLSDESC_ADR_PAGE21BFD_RELOC_AARCH64_TLSDESC_LD64_LO12BFD_RELOC_AARCH64_TLSDESC_LD32_LO12_NCBFD_RELOC_AARCH64_TLSDESC_ADD_LO12BFD_RELOC_AARCH64_TLSDESC_OFF_G1BFD_RELOC_AARCH64_TLSDESC_OFF_G0_NCBFD_RELOC_AARCH64_TLSDESC_LDRBFD_RELOC_AARCH64_TLSDESC_ADDBFD_RELOC_AARCH64_TLSDESC_CALLBFD_RELOC_AARCH64_COPYBFD_RELOC_AARCH64_GLOB_DATBFD_RELOC_AARCH64_JUMP_SLOTBFD_RELOC_AARCH64_RELATIVEBFD_RELOC_AARCH64_TLS_DTPMODBFD_RELOC_AARCH64_TLS_DTPRELBFD_RELOC_AARCH64_TLS_TPRELBFD_RELOC_AARCH64_TLSDESCBFD_RELOC_AARCH64_IRELATIVEBFD_RELOC_AARCH64_RELOC_ENDBFD_RELOC_AARCH64_GAS_INTERNAL_FIXUPBFD_RELOC_AARCH64_LDST_LO12BFD_RELOC_AARCH64_TLSLD_LDST_DTPREL_LO12BFD_RELOC_AARCH64_TLSLD_LDST_DTPREL_LO12_NCBFD_RELOC_AARCH64_TLSLE_LDST_TPREL_LO12BFD_RELOC_AARCH64_TLSLE_LDST_TPREL_LO12_NCBFD_RELOC_AARCH64_LD_GOT_LO12_NCBFD_RELOC_AARCH64_TLSIE_LD_GOTTPREL_LO12_NCBFD_RELOC_AARCH64_TLSDESC_LD_LO12_NCBFD_RELOC_TILEPRO_COPYBFD_RELOC_TILEPRO_GLOB_DATBFD_RELOC_TILEPRO_JMP_SLOTBFD_RELOC_TILEPRO_RELATIVEBFD_RELOC_TILEPRO_BROFF_X1BFD_RELOC_TILEPRO_JOFFLONG_X1BFD_RELOC_TILEPRO_JOFFLONG_X1_PLTBFD_RELOC_TILEPRO_IMM8_X0BFD_RELOC_TILEPRO_IMM8_Y0BFD_RELOC_TILEPRO_IMM8_X1BFD_RELOC_TILEPRO_IMM8_Y1BFD_RELOC_TILEPRO_DEST_IMM8_X1BFD_RELOC_TILEPRO_MT_IMM15_X1BFD_RELOC_TILEPRO_MF_IMM15_X1BFD_RELOC_TILEPRO_IMM16_X0BFD_RELOC_TILEPRO_IMM16_X1BFD_RELOC_TILEPRO_IMM16_X0_LOBFD_RELOC_TILEPRO_IMM16_X1_LOBFD_RELOC_TILEPRO_IMM16_X0_HIBFD_RELOC_TILEPRO_IMM16_X1_HIBFD_RELOC_TILEPRO_IMM16_X0_HABFD_RELOC_TILEPRO_IMM16_X1_HABFD_RELOC_TILEPRO_IMM16_X0_PCRELBFD_RELOC_TILEPRO_IMM16_X1_PCRELBFD_RELOC_TILEPRO_IMM16_X0_LO_PCRELBFD_RELOC_TILEPRO_IMM16_X1_LO_PCRELBFD_RELOC_TILEPRO_IMM16_X0_HI_PCRELBFD_RELOC_TILEPRO_IMM16_X1_HI_PCRELBFD_RELOC_TILEPRO_IMM16_X0_HA_PCRELBFD_RELOC_TILEPRO_IMM16_X1_HA_PCRELBFD_RELOC_TILEPRO_IMM16_X0_GOTBFD_RELOC_TILEPRO_IMM16_X1_GOTBFD_RELOC_TILEPRO_IMM16_X0_GOT_LOBFD_RELOC_TILEPRO_IMM16_X1_GOT_LOBFD_RELOC_TILEPRO_IMM16_X0_GOT_HIBFD_RELOC_TILEPRO_IMM16_X1_GOT_HIBFD_RELOC_TILEPRO_IMM16_X0_GOT_HABFD_RELOC_TILEPRO_IMM16_X1_GOT_HABFD_RELOC_TILEPRO_MMSTART_X0BFD_RELOC_TILEPRO_MMEND_X0BFD_RELOC_TILEPRO_MMSTART_X1BFD_RELOC_TILEPRO_MMEND_X1BFD_RELOC_TILEPRO_SHAMT_X0BFD_RELOC_TILEPRO_SHAMT_X1BFD_RELOC_TILEPRO_SHAMT_Y0BFD_RELOC_TILEPRO_SHAMT_Y1BFD_RELOC_TILEPRO_TLS_GD_CALLBFD_RELOC_TILEPRO_IMM8_X0_TLS_GD_ADDBFD_RELOC_TILEPRO_IMM8_X1_TLS_GD_ADDBFD_RELOC_TILEPRO_IMM8_Y0_TLS_GD_ADDBFD_RELOC_TILEPRO_IMM8_Y1_TLS_GD_ADDBFD_RELOC_TILEPRO_TLS_IE_LOADBFD_RELOC_TILEPRO_IMM16_X0_TLS_GDBFD_RELOC_TILEPRO_IMM16_X1_TLS_GDBFD_RELOC_TILEPRO_IMM16_X0_TLS_GD_LOBFD_RELOC_TILEPRO_IMM16_X1_TLS_GD_LOBFD_RELOC_TILEPRO_IMM16_X0_TLS_GD_HIBFD_RELOC_TILEPRO_IMM16_X1_TLS_GD_HIBFD_RELOC_TILEPRO_IMM16_X0_TLS_GD_HABFD_RELOC_TILEPRO_IMM16_X1_TLS_GD_HABFD_RELOC_TILEPRO_IMM16_X0_TLS_IEBFD_RELOC_TILEPRO_IMM16_X1_TLS_IEBFD_RELOC_TILEPRO_IMM16_X0_TLS_IE_LOBFD_RELOC_TILEPRO_IMM16_X1_TLS_IE_LOBFD_RELOC_TILEPRO_IMM16_X0_TLS_IE_HIBFD_RELOC_TILEPRO_IMM16_X1_TLS_IE_HIBFD_RELOC_TILEPRO_IMM16_X0_TLS_IE_HABFD_RELOC_TILEPRO_IMM16_X1_TLS_IE_HABFD_RELOC_TILEPRO_TLS_DTPMOD32BFD_RELOC_TILEPRO_TLS_DTPOFF32BFD_RELOC_TILEPRO_TLS_TPOFF32BFD_RELOC_TILEPRO_IMM16_X0_TLS_LEBFD_RELOC_TILEPRO_IMM16_X1_TLS_LEBFD_RELOC_TILEPRO_IMM16_X0_TLS_LE_LOBFD_RELOC_TILEPRO_IMM16_X1_TLS_LE_LOBFD_RELOC_TILEPRO_IMM16_X0_TLS_LE_HIBFD_RELOC_TILEPRO_IMM16_X1_TLS_LE_HIBFD_RELOC_TILEPRO_IMM16_X0_TLS_LE_HABFD_RELOC_TILEPRO_IMM16_X1_TLS_LE_HABFD_RELOC_TILEGX_HW0BFD_RELOC_TILEGX_HW1BFD_RELOC_TILEGX_HW2BFD_RELOC_TILEGX_HW3BFD_RELOC_TILEGX_HW0_LASTBFD_RELOC_TILEGX_HW1_LASTBFD_RELOC_TILEGX_HW2_LASTBFD_RELOC_TILEGX_COPYBFD_RELOC_TILEGX_GLOB_DATBFD_RELOC_TILEGX_JMP_SLOTBFD_RELOC_TILEGX_RELATIVEBFD_RELOC_TILEGX_BROFF_X1BFD_RELOC_TILEGX_JUMPOFF_X1BFD_RELOC_TILEGX_JUMPOFF_X1_PLTBFD_RELOC_TILEGX_IMM8_X0BFD_RELOC_TILEGX_IMM8_Y0BFD_RELOC_TILEGX_IMM8_X1BFD_RELOC_TILEGX_IMM8_Y1BFD_RELOC_TILEGX_DEST_IMM8_X1BFD_RELOC_TILEGX_MT_IMM14_X1BFD_RELOC_TILEGX_MF_IMM14_X1BFD_RELOC_TILEGX_MMSTART_X0BFD_RELOC_TILEGX_MMEND_X0BFD_RELOC_TILEGX_SHAMT_X0BFD_RELOC_TILEGX_SHAMT_X1BFD_RELOC_TILEGX_SHAMT_Y0BFD_RELOC_TILEGX_SHAMT_Y1BFD_RELOC_TILEGX_IMM16_X0_HW0BFD_RELOC_TILEGX_IMM16_X1_HW0BFD_RELOC_TILEGX_IMM16_X0_HW1BFD_RELOC_TILEGX_IMM16_X1_HW1BFD_RELOC_TILEGX_IMM16_X0_HW2BFD_RELOC_TILEGX_IMM16_X1_HW2BFD_RELOC_TILEGX_IMM16_X0_HW3BFD_RELOC_TILEGX_IMM16_X1_HW3BFD_RELOC_TILEGX_IMM16_X0_HW0_LASTBFD_RELOC_TILEGX_IMM16_X1_HW0_LASTBFD_RELOC_TILEGX_IMM16_X0_HW1_LASTBFD_RELOC_TILEGX_IMM16_X1_HW1_LASTBFD_RELOC_TILEGX_IMM16_X0_HW2_LASTBFD_RELOC_TILEGX_IMM16_X1_HW2_LASTBFD_RELOC_TILEGX_IMM16_X0_HW0_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW0_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW1_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW1_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW2_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW2_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW3_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW3_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW0_LAST_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW0_LAST_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW1_LAST_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW1_LAST_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW2_LAST_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW2_LAST_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW0_GOTBFD_RELOC_TILEGX_IMM16_X1_HW0_GOTBFD_RELOC_TILEGX_IMM16_X0_HW0_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW0_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW1_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW1_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW2_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW2_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW0_LAST_GOTBFD_RELOC_TILEGX_IMM16_X1_HW0_LAST_GOTBFD_RELOC_TILEGX_IMM16_X0_HW1_LAST_GOTBFD_RELOC_TILEGX_IMM16_X1_HW1_LAST_GOTBFD_RELOC_TILEGX_IMM16_X0_HW3_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW3_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW0_TLS_GDBFD_RELOC_TILEGX_IMM16_X1_HW0_TLS_GDBFD_RELOC_TILEGX_IMM16_X0_HW0_TLS_LEBFD_RELOC_TILEGX_IMM16_X1_HW0_TLS_LEBFD_RELOC_TILEGX_IMM16_X0_HW0_LAST_TLS_LEBFD_RELOC_TILEGX_IMM16_X1_HW0_LAST_TLS_LEBFD_RELOC_TILEGX_IMM16_X0_HW1_LAST_TLS_LEBFD_RELOC_TILEGX_IMM16_X1_HW1_LAST_TLS_LEBFD_RELOC_TILEGX_IMM16_X0_HW0_LAST_TLS_GDBFD_RELOC_TILEGX_IMM16_X1_HW0_LAST_TLS_GDBFD_RELOC_TILEGX_IMM16_X0_HW1_LAST_TLS_GDBFD_RELOC_TILEGX_IMM16_X1_HW1_LAST_TLS_GDBFD_RELOC_TILEGX_IMM16_X0_HW0_TLS_IEBFD_RELOC_TILEGX_IMM16_X1_HW0_TLS_IEBFD_RELOC_TILEGX_IMM16_X0_HW0_LAST_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW0_LAST_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW1_LAST_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW1_LAST_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW2_LAST_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X1_HW2_LAST_PLT_PCRELBFD_RELOC_TILEGX_IMM16_X0_HW0_LAST_TLS_IEBFD_RELOC_TILEGX_IMM16_X1_HW0_LAST_TLS_IEBFD_RELOC_TILEGX_IMM16_X0_HW1_LAST_TLS_IEBFD_RELOC_TILEGX_IMM16_X1_HW1_LAST_TLS_IEBFD_RELOC_TILEGX_TLS_DTPMOD64BFD_RELOC_TILEGX_TLS_DTPOFF64BFD_RELOC_TILEGX_TLS_TPOFF64BFD_RELOC_TILEGX_TLS_DTPMOD32BFD_RELOC_TILEGX_TLS_DTPOFF32BFD_RELOC_TILEGX_TLS_TPOFF32BFD_RELOC_TILEGX_TLS_GD_CALLBFD_RELOC_TILEGX_IMM8_X0_TLS_GD_ADDBFD_RELOC_TILEGX_IMM8_X1_TLS_GD_ADDBFD_RELOC_TILEGX_IMM8_Y0_TLS_GD_ADDBFD_RELOC_TILEGX_IMM8_Y1_TLS_GD_ADDBFD_RELOC_TILEGX_TLS_IE_LOADBFD_RELOC_TILEGX_IMM8_X0_TLS_ADDBFD_RELOC_TILEGX_IMM8_X1_TLS_ADDBFD_RELOC_TILEGX_IMM8_Y0_TLS_ADDBFD_RELOC_TILEGX_IMM8_Y1_TLS_ADDBFD_RELOC_BPF_64BFD_RELOC_BPF_32BFD_RELOC_BPF_16BFD_RELOC_BPF_DISP16BFD_RELOC_BPF_DISP32BFD_RELOC_EPIPHANY_SIMM8BFD_RELOC_EPIPHANY_SIMM24BFD_RELOC_EPIPHANY_HIGHBFD_RELOC_EPIPHANY_LOWBFD_RELOC_EPIPHANY_SIMM11BFD_RELOC_EPIPHANY_IMM11BFD_RELOC_EPIPHANY_IMM8BFD_RELOC_VISIUM_HI16BFD_RELOC_VISIUM_LO16BFD_RELOC_VISIUM_IM16BFD_RELOC_VISIUM_REL16BFD_RELOC_VISIUM_HI16_PCRELBFD_RELOC_VISIUM_LO16_PCRELBFD_RELOC_VISIUM_IM16_PCRELBFD_RELOC_WASM32_LEB128BFD_RELOC_WASM32_LEB128_GOTBFD_RELOC_WASM32_LEB128_GOT_CODEBFD_RELOC_WASM32_LEB128_PLTBFD_RELOC_WASM32_PLT_INDEXBFD_RELOC_WASM32_ABS32_CODEBFD_RELOC_WASM32_COPYBFD_RELOC_WASM32_CODE_POINTERBFD_RELOC_WASM32_INDEXBFD_RELOC_WASM32_PLT_SIGBFD_RELOC_CKCORE_NONEBFD_RELOC_CKCORE_ADDR32BFD_RELOC_CKCORE_PCREL_IMM8BY4BFD_RELOC_CKCORE_PCREL_IMM11BY2BFD_RELOC_CKCORE_PCREL_IMM4BY2BFD_RELOC_CKCORE_PCREL32BFD_RELOC_CKCORE_PCREL_JSR_IMM11BY2BFD_RELOC_CKCORE_GNU_VTINHERITBFD_RELOC_CKCORE_GNU_VTENTRYBFD_RELOC_CKCORE_RELATIVEBFD_RELOC_CKCORE_COPYBFD_RELOC_CKCORE_GLOB_DATBFD_RELOC_CKCORE_JUMP_SLOTBFD_RELOC_CKCORE_GOTOFFBFD_RELOC_CKCORE_GOTPCBFD_RELOC_CKCORE_GOT32BFD_RELOC_CKCORE_PLT32BFD_RELOC_CKCORE_ADDRGOTBFD_RELOC_CKCORE_ADDRPLTBFD_RELOC_CKCORE_PCREL_IMM26BY2BFD_RELOC_CKCORE_PCREL_IMM16BY2BFD_RELOC_CKCORE_PCREL_IMM16BY4BFD_RELOC_CKCORE_PCREL_IMM10BY2BFD_RELOC_CKCORE_PCREL_IMM10BY4BFD_RELOC_CKCORE_ADDR_HI16BFD_RELOC_CKCORE_ADDR_LO16BFD_RELOC_CKCORE_GOTPC_HI16BFD_RELOC_CKCORE_GOTPC_LO16BFD_RELOC_CKCORE_GOTOFF_HI16BFD_RELOC_CKCORE_GOTOFF_LO16BFD_RELOC_CKCORE_GOT12BFD_RELOC_CKCORE_GOT_HI16BFD_RELOC_CKCORE_GOT_LO16BFD_RELOC_CKCORE_PLT12BFD_RELOC_CKCORE_PLT_HI16BFD_RELOC_CKCORE_PLT_LO16BFD_RELOC_CKCORE_ADDRGOT_HI16BFD_RELOC_CKCORE_ADDRGOT_LO16BFD_RELOC_CKCORE_ADDRPLT_HI16BFD_RELOC_CKCORE_ADDRPLT_LO16BFD_RELOC_CKCORE_PCREL_JSR_IMM26BY2BFD_RELOC_CKCORE_TOFFSET_LO16BFD_RELOC_CKCORE_DOFFSET_LO16BFD_RELOC_CKCORE_PCREL_IMM18BY2BFD_RELOC_CKCORE_DOFFSET_IMM18BFD_RELOC_CKCORE_DOFFSET_IMM18BY2BFD_RELOC_CKCORE_DOFFSET_IMM18BY4BFD_RELOC_CKCORE_GOTOFF_IMM18BFD_RELOC_CKCORE_GOT_IMM18BY4BFD_RELOC_CKCORE_PLT_IMM18BY4BFD_RELOC_CKCORE_PCREL_IMM7BY4BFD_RELOC_CKCORE_TLS_LE32BFD_RELOC_CKCORE_TLS_IE32BFD_RELOC_CKCORE_TLS_GD32BFD_RELOC_CKCORE_TLS_LDM32BFD_RELOC_CKCORE_TLS_LDO32BFD_RELOC_CKCORE_TLS_DTPMOD32BFD_RELOC_CKCORE_TLS_DTPOFF32BFD_RELOC_CKCORE_TLS_TPOFF32BFD_RELOC_CKCORE_PCREL_FLRW_IMM8BY4BFD_RELOC_CKCORE_NOJSRIBFD_RELOC_CKCORE_CALLGRAPHBFD_RELOC_CKCORE_IRELATIVEBFD_RELOC_CKCORE_PCREL_BLOOP_IMM4BY4BFD_RELOC_CKCORE_PCREL_BLOOP_IMM12BY4BFD_RELOC_S12Z_OPR@@overflow: BFD_RELOC_UNUSED@@read_relocwrite_relocbfd_get_reloc_sizebfd_check_overflow_bfd_relocate_contents%pB(%pA+%#lx): stabs entry has invalid string index../../bfd/stabs.c %c%c%c%c%c%c%c.$0123456789$GDB_SYMBOLS$$GDB_STRINGS$unsupported .stab relocation.drectve.idataincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     M #+3;CScs@@ !1Aa  0@` inflate 1.2.11 Copyright 1995-2017 Mark Adler need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versioninternal error: deflate stream corruptrequested length does not fit in intrequest does not fit in a size_t0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa deflate 1.2.11 Copyright 1995-2017 Jean-loup Gailly and Mark Adler    (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#csymbol `%s' not found Error reading helper thread's id in libunable to writeagent: resumed helper thread /tmp%s/gdb_ust%derror opening sync socket: %sstring overflow allocating socket nameerror connecting sync socket (%s): %s. Make sure the directory exists and that it is writable.agent: signalling helper thread agent: waiting for helper thread's response agent: helper thread's response received agent: stop helper thread Error reading command responseError reading capability of agentgdb_agent_helper_thread_idgdb_agent_cmd_bufgdb_agent_capabilityVV VUnknown branch trace format../../gdbsupport/btrace-common.ccUnkown branch trace format.No or unknown formatBranch Trace StoreIntel Processor TraceVVҝVMPP%lo%llocleanup* make_my_cleanup2(cleanup**, void (*)(void*), void*, void (*)(void*))../../gdbsupport/cleanups.ccold_chain != NULL%*s[%s] %s: %*s[%s] ../../gdbsupport/common-exceptions.ccgdb_exception_quit::gdb_exception_quit(gdb_exception&&)../../gdbsupport/common-exceptions.hex.reason == RETURN_QUITgdb_exception_error::gdb_exception_error(gdb_exception&&)ex.reason == RETURN_ERRORvoid throw_exception(gdb_exception&&)invalid return reasonSt19_Sp_make_shared_tag^ڟV18gdb_exception_quit^VGSt23_Sp_counted_ptr_inplaceINSt7__cxx1112basic_stringIcSt11char_traitsIcESaIcEEESaIS5_ELN9__gnu_cxx12_Lock_policyE2EE^ VBIV777ؗ77can't handle command-line argument containing whitespace"!#$&*()\|[]{}<>?'`~^; vasprintf call failed../../gdbsupport/common-utils.ccint xsnprintf(char*, size_t, const char*, ...)ret < sizeULONGEST align_up(ULONGEST, int)n && (n & (n-1)) == 0ULONGEST align_down(ULONGEST, int)Invalid hex digit %dError detected on fd %dInvalid or non-`poll'able fd %dException condition detected on fd %dinvoking fd file handler `%s`handle_file_eventfile_handler* get_next_file_handler_to_handle_and_advance()../../gdbsupport/event-loop.cccurr_next != NULLint gdb_wait_for_event(int)i < gdb_notifier.num_fdsfile_ptr != NULLunexpected event_source_head %d'''' ''' '''''''''['X/proc/self/fdvoid unmark_fd_no_cloexec(int)../../gdbsupport/filestuff.ccfd not found in open_fdsUnrecognized escape character \%c in format string.0-+ #`*' not supported for precision or width in printfFormat specifier `n' not supported in printfIncomplete format specifier at end of format stringUnrecognized format specifier '%c' in printfInappropriate modifiers to format specifier '%c' in printfCould not load %s: %sCould not find a match for '%s'.glob could not process pattern '%s'.std::string gdb_tilde_expand(const char*)../../gdbsupport/gdb_tilde_expand.ccglob.pathc () == 1Missing close bracket in hostname '%s'Invalid cruft after close bracket in '%s'Missing open bracket in hostname '%s'localhosttcp:udp4:tcp4:udp6:tcp6:QVVVV V 18gdb_quit_bad_allocH^VVL^V77J=gdb::unique_xmalloc_ptr gdb_abspath(const char*)../../gdbsupport/pathstuff.ccpath != NULL && path[0] != '\0'SHELLXDG_CACHE_HOME%s/gdb%s/.cache/gdbXDG_CONFIG_HOME%s/.config/gdbTMPDIRstd::string find_gdb_home_config_file(const char*, stat*)*name != '\0'%s%0*lu%s%0*lu%09lu%s%0*lu%09lu%09lu%08lx%08lx%lx%08lxhex_string_custom: insufficient space to store result../../gdbsupport/print-utils.cc%*o0%0*lo0%0*lo%010lo0%0*lo%010lo%010loReceived too much data from the target.Unmatched escape character in target response.0123456789abcdef(undocumented errno %d)file to mmap is emptyUnable to access %s bytes of target memory at %s, halting search.int simple_search_memory(gdb::function_view, CORE_ADDR, ULONGEST, const gdb_byte*, ULONGEST, CORE_ADDR*)../../gdbsupport/search.cckeep_len == pattern_len - 1const char* gdb_signal_to_symbol_string(gdb_signal)../../gdbsupport/signals.cc(int) sig >= GDB_SIGNAL_FIRST && (int) sig <= GDB_SIGNAL_LASTUnknown signalGDB bug: target.c (gdb_signal_from_host): unrecognized real-time signalSignal %s does not exist on this system.Signal 0GDB_SIGNAL_HUPSIGHUPHangupGDB_SIGNAL_INTSIGINTInterruptGDB_SIGNAL_QUITSIGQUITGDB_SIGNAL_ILLSIGILLIllegal instructionGDB_SIGNAL_TRAPTrace/breakpoint trapGDB_SIGNAL_ABRTSIGABRTAbortedGDB_SIGNAL_EMTSIGEMTEmulation trapGDB_SIGNAL_FPESIGFPEArithmetic exceptionGDB_SIGNAL_KILLSIGKILLKilledGDB_SIGNAL_BUSSIGBUSBus errorGDB_SIGNAL_SEGVSIGSEGVSegmentation faultGDB_SIGNAL_SYSSIGSYSBad system callGDB_SIGNAL_PIPESIGPIPEBroken pipeGDB_SIGNAL_ALRMSIGALRMAlarm clockGDB_SIGNAL_TERMSIGTERMGDB_SIGNAL_URGSIGURGUrgent I/O conditionGDB_SIGNAL_STOPStopped (signal)GDB_SIGNAL_TSTPSIGTSTPStopped (user)GDB_SIGNAL_CONTSIGCONTContinuedGDB_SIGNAL_CHLDSIGCHLDChild status changedGDB_SIGNAL_TTINSIGTTINStopped (tty input)GDB_SIGNAL_TTOUSIGTTOUStopped (tty output)GDB_SIGNAL_IOSIGIOI/O possibleGDB_SIGNAL_XCPUSIGXCPUCPU time limit exceededGDB_SIGNAL_XFSZSIGXFSZFile size limit exceededGDB_SIGNAL_VTALRMSIGVTALRMVirtual timer expiredGDB_SIGNAL_PROFSIGPROFProfiling timer expiredGDB_SIGNAL_WINCHSIGWINCHWindow size changedGDB_SIGNAL_LOSTSIGLOSTResource lostGDB_SIGNAL_USR1SIGUSR1User defined signal 1GDB_SIGNAL_USR2SIGUSR2User defined signal 2GDB_SIGNAL_PWRSIGPWRPower fail/restartGDB_SIGNAL_POLLSIGPOLLPollable event occurredGDB_SIGNAL_WINDSIGWINDGDB_SIGNAL_PHONESIGPHONEGDB_SIGNAL_WAITINGSIGWAITINGProcess's LWPs are blockedGDB_SIGNAL_LWPSIGLWPSignal LWPGDB_SIGNAL_DANGERSIGDANGERSwap space dangerously lowGDB_SIGNAL_GRANTSIGGRANTMonitor mode grantedGDB_SIGNAL_RETRACTSIGRETRACTNeed to relinquish monitor modeGDB_SIGNAL_MSGSIGMSGMonitor mode data availableGDB_SIGNAL_SOUNDSIGSOUNDSound completedGDB_SIGNAL_SAKSIGSAKSecure attentionGDB_SIGNAL_PRIOSIGPRIOGDB_SIGNAL_REALTIME_33SIG33Real-time event 33GDB_SIGNAL_REALTIME_34SIG34Real-time event 34GDB_SIGNAL_REALTIME_35SIG35Real-time event 35GDB_SIGNAL_REALTIME_36SIG36Real-time event 36GDB_SIGNAL_REALTIME_37SIG37Real-time event 37GDB_SIGNAL_REALTIME_38SIG38Real-time event 38GDB_SIGNAL_REALTIME_39SIG39Real-time event 39GDB_SIGNAL_REALTIME_40SIG40Real-time event 40GDB_SIGNAL_REALTIME_41SIG41Real-time event 41GDB_SIGNAL_REALTIME_42SIG42Real-time event 42GDB_SIGNAL_REALTIME_43SIG43Real-time event 43GDB_SIGNAL_REALTIME_44SIG44Real-time event 44GDB_SIGNAL_REALTIME_45SIG45Real-time event 45GDB_SIGNAL_REALTIME_46SIG46Real-time event 46GDB_SIGNAL_REALTIME_47SIG47Real-time event 47GDB_SIGNAL_REALTIME_48SIG48Real-time event 48GDB_SIGNAL_REALTIME_49SIG49Real-time event 49GDB_SIGNAL_REALTIME_50SIG50Real-time event 50GDB_SIGNAL_REALTIME_51SIG51Real-time event 51GDB_SIGNAL_REALTIME_52SIG52Real-time event 52GDB_SIGNAL_REALTIME_53SIG53Real-time event 53GDB_SIGNAL_REALTIME_54SIG54Real-time event 54GDB_SIGNAL_REALTIME_55SIG55Real-time event 55GDB_SIGNAL_REALTIME_56SIG56Real-time event 56GDB_SIGNAL_REALTIME_57SIG57Real-time event 57GDB_SIGNAL_REALTIME_58SIG58Real-time event 58GDB_SIGNAL_REALTIME_59SIG59Real-time event 59GDB_SIGNAL_REALTIME_60SIG60Real-time event 60GDB_SIGNAL_REALTIME_61SIG61Real-time event 61GDB_SIGNAL_REALTIME_62SIG62Real-time event 62GDB_SIGNAL_REALTIME_63SIG63Real-time event 63GDB_SIGNAL_CANCELSIGCANCELLWP internal signalGDB_SIGNAL_REALTIME_32SIG32Real-time event 32GDB_SIGNAL_REALTIME_64SIG64Real-time event 64GDB_SIGNAL_REALTIME_65SIG65Real-time event 65GDB_SIGNAL_REALTIME_66SIG66Real-time event 66GDB_SIGNAL_REALTIME_67SIG67Real-time event 67GDB_SIGNAL_REALTIME_68SIG68Real-time event 68GDB_SIGNAL_REALTIME_69SIG69Real-time event 69GDB_SIGNAL_REALTIME_70SIG70Real-time event 70GDB_SIGNAL_REALTIME_71SIG71Real-time event 71GDB_SIGNAL_REALTIME_72SIG72Real-time event 72GDB_SIGNAL_REALTIME_73SIG73Real-time event 73GDB_SIGNAL_REALTIME_74SIG74Real-time event 74GDB_SIGNAL_REALTIME_75SIG75Real-time event 75GDB_SIGNAL_REALTIME_76SIG76Real-time event 76GDB_SIGNAL_REALTIME_77SIG77Real-time event 77GDB_SIGNAL_REALTIME_78SIG78Real-time event 78GDB_SIGNAL_REALTIME_79SIG79Real-time event 79GDB_SIGNAL_REALTIME_80SIG80Real-time event 80GDB_SIGNAL_REALTIME_81SIG81Real-time event 81GDB_SIGNAL_REALTIME_82SIG82Real-time event 82GDB_SIGNAL_REALTIME_83SIG83Real-time event 83GDB_SIGNAL_REALTIME_84SIG84Real-time event 84GDB_SIGNAL_REALTIME_85SIG85Real-time event 85GDB_SIGNAL_REALTIME_86SIG86Real-time event 86GDB_SIGNAL_REALTIME_87SIG87Real-time event 87GDB_SIGNAL_REALTIME_88SIG88Real-time event 88GDB_SIGNAL_REALTIME_89SIG89Real-time event 89GDB_SIGNAL_REALTIME_90SIG90Real-time event 90GDB_SIGNAL_REALTIME_91SIG91Real-time event 91GDB_SIGNAL_REALTIME_92SIG92Real-time event 92GDB_SIGNAL_REALTIME_93SIG93Real-time event 93GDB_SIGNAL_REALTIME_94SIG94Real-time event 94GDB_SIGNAL_REALTIME_95SIG95Real-time event 95GDB_SIGNAL_REALTIME_96SIG96Real-time event 96GDB_SIGNAL_REALTIME_97SIG97Real-time event 97GDB_SIGNAL_REALTIME_98SIG98Real-time event 98GDB_SIGNAL_REALTIME_99SIG99Real-time event 99GDB_SIGNAL_REALTIME_100SIG100Real-time event 100GDB_SIGNAL_REALTIME_101SIG101Real-time event 101GDB_SIGNAL_REALTIME_102SIG102Real-time event 102GDB_SIGNAL_REALTIME_103SIG103Real-time event 103GDB_SIGNAL_REALTIME_104SIG104Real-time event 104GDB_SIGNAL_REALTIME_105SIG105Real-time event 105GDB_SIGNAL_REALTIME_106SIG106Real-time event 106GDB_SIGNAL_REALTIME_107SIG107Real-time event 107GDB_SIGNAL_REALTIME_108SIG108Real-time event 108GDB_SIGNAL_REALTIME_109SIG109Real-time event 109GDB_SIGNAL_REALTIME_110SIG110Real-time event 110GDB_SIGNAL_REALTIME_111SIG111Real-time event 111GDB_SIGNAL_REALTIME_112SIG112Real-time event 112GDB_SIGNAL_REALTIME_113SIG113Real-time event 113GDB_SIGNAL_REALTIME_114SIG114Real-time event 114GDB_SIGNAL_REALTIME_115SIG115Real-time event 115GDB_SIGNAL_REALTIME_116SIG116Real-time event 116GDB_SIGNAL_REALTIME_117SIG117Real-time event 117GDB_SIGNAL_REALTIME_118SIG118Real-time event 118GDB_SIGNAL_REALTIME_119SIG119Real-time event 119GDB_SIGNAL_REALTIME_120SIG120Real-time event 120GDB_SIGNAL_REALTIME_121SIG121Real-time event 121GDB_SIGNAL_REALTIME_122SIG122Real-time event 122GDB_SIGNAL_REALTIME_123SIG123Real-time event 123GDB_SIGNAL_REALTIME_124SIG124Real-time event 124GDB_SIGNAL_REALTIME_125SIG125Real-time event 125GDB_SIGNAL_REALTIME_126SIG126Real-time event 126GDB_SIGNAL_REALTIME_127SIG127Real-time event 127GDB_SIGNAL_INFOSIGINFOInformation requestGDB_SIGNAL_UNKNOWNInternal error: printing GDB_SIGNAL_DEFAULTGDB_EXC_BAD_ACCESSCould not access memoryGDB_EXC_BAD_INSTRUCTIONIllegal instruction/operandGDB_EXC_ARITHMETICGDB_EXC_EMULATIONEmulation instructionGDB_EXC_SOFTWARESoftware generated exceptionGDB_EXC_BREAKPOINTGDB_SIGNAL_LIBRTSIGLIBRTlibrt internal signal QRګVVVVVVV V0V=S8VGVNVbV͝NrVVVVVVVͬVܬVVVVVV&V-V7VGVOVbVqVxVVVVVVĭVЭVVoGVVVVN#V4VDVLV[VkVsV}VVVVV®V֮VVVVVV$V4V%s%s%svirtual void print_xml_feature::visit(const tdesc_type_with_fields*)t->kind >= TDESC_TYPE_STRUCT && t->kind <= TDESC_TYPE_ENUM<%s id="%s" size="%d" tdesc_type_with_fields* tdesc_create_enum(tdesc_feature*, const char*, int)tdesc_type_with_fields* tdesc_create_flags(tdesc_feature*, const char*, int)void tdesc_add_field(tdesc_type_with_fields*, const char*, tdesc_type*)type->kind == TDESC_TYPE_UNION || type->kind == TDESC_TYPE_STRUCTvoid tdesc_add_typed_bitfield(tdesc_type_with_fields*, const char*, int, int, tdesc_type*)type->kind == TDESC_TYPE_STRUCT || type->kind == TDESC_TYPE_FLAGSstart >= 0 && end >= startvoid tdesc_add_bitfield(tdesc_type_with_fields*, const char*, int, int)void tdesc_add_flag(tdesc_type_with_fields*, int, const char*)type->kind == TDESC_TYPE_FLAGS || type->kind == TDESC_TYPE_STRUCTvoid tdesc_add_enum_value(tdesc_type_with_fields*, int, const char*)type->kind == TDESC_TYPE_ENUM9tdesc_reg^VXTR10tdesc_type^VXTR18tdesc_type_builtin^VV17tdesc_type_vector^ VV22tdesc_type_with_fields^@VVV8<8l8VV8X8x84V 888\V$88,8V7888bQzbH W R13tdesc_feature^VXTR17print_xml_feature^ V@TR V(8888878 8(8std::future_error: gdb workerNSt13__future_base12_Task_setterISt10unique_ptrINS_7_ResultIvEENS_12_Result_base8_DeleterEEZNS_11_Task_stateISt8functionIFvvEESaIiES9_E6_M_runEvEUlvE_vEE^sVNSt13__future_base12_Task_setterISt10unique_ptrINS_7_ResultIvEENS_12_Result_base8_DeleterEEZNS_11_Task_stateISt8functionIFvvEESaIiES9_E14_M_run_delayedESt8weak_ptrINS_13_State_baseV2EEEUlvE_vEE^VNSt13__future_base13_State_baseV2E^VNSt13__future_base7_ResultIvEE^V^NSt6thread11_State_implINS_8_InvokerISt5tupleIJMN3gdb11thread_poolEFvvEPS4_EEEEEE^G G IrOGSgIgI gI gI LLV V G G GiKGiK>iK %HTiKTiKKiK KiK VVVVbiKbiKYiKYiK W W 6IGqiK TiKhiKhiKIIV V V V V V GRGRVV>I>IGIGIkVkVte)He)Ha}V}VV bVVV sYK VFV i1K V1V oLK %V1WV d>K eV2V5W}gIVSV4gIQ5gIfY5gISVSV VV#VneI oULN6MSSVogIhV VhGjK ScS SFMahUSVjKiGgIR$QV*)SxOVVKVHSG.gIVI VI#VI&VIGzgIQH`QGVpSS)VugI}XvgIT,V O+gIGNI8VigI;VlgI HiJjRFMH7EJNXgIG1gIGiJSYXklOgI>VgIAV7gIshHLDVfgIWIGV:gI# PI}GIPMVJrUJVrgIMVygISaST5SYQ3NPPV +VPV QbeI eIZV%HjKSXjKYHS@V%s: error: too many @-files encountered %s: error: @-file refers to a directory n; &C vkkMPG&"֊/aK+d 5ӆ1 Cͼ-}wp4mG0K=V9'C#=.r *ϝxO K} xV|iqލuݓklRobfF^[^Z}Wf`Sc0M-ZI D@ƥ d'NK`%#/+6lA/ ]D@hf+*{Pu&6>;;kvqUP2M_}1>φ˃4y:Z iYmێ`7Od2z~\sKwV OK86F+GB{\=fX@US]CQ;%)&!,G^(BM6P2,v?kZ;&H VM#RV/K`mpl +e= hﶻ'؀odj#ͳ`~>ɐ}:{y`6q}[Fu2 t-0q].KYT@PENOJ+ GC!}{`COFr[v hJGl0a$-eK^VZp0m5= ^[ Q7R3?>:З$:V -T)y&;h+̠ȥPMlk/|vˡv`#ds'ě yg:Ջb}>  q+2h6mf{u]6@__ctor__dtor~this__initZinitializer for __vtblZ__ClassZClassInfo for __postblitMFZthis(this)__InterfaceZInterface for __ModuleInfoZModuleInfo for \u\UuLNANNINF-Inf immutable shared inoutshared(const(immutable(inout(Tuple!(extern(C) extern(Windows) extern(Pascal) extern(C++) extern(Objective-C) pure nothrow ref @property @trusted @safe @nogc scope @live out lazy _D_DmainDW_TAG_paddingDW_TAG_class_typeDW_TAG_entry_pointDW_TAG_enumeration_typeDW_TAG_formal_parameterDW_TAG_imported_declarationDW_TAG_labelDW_TAG_lexical_blockDW_TAG_memberDW_TAG_pointer_typeDW_TAG_reference_typeDW_TAG_compile_unitDW_TAG_string_typeDW_TAG_structure_typeDW_TAG_subroutine_typeDW_TAG_typedefDW_TAG_union_typeDW_TAG_unspecified_parametersDW_TAG_variantDW_TAG_common_blockDW_TAG_common_inclusionDW_TAG_inheritanceDW_TAG_inlined_subroutineDW_TAG_moduleDW_TAG_ptr_to_member_typeDW_TAG_set_typeDW_TAG_subrange_typeDW_TAG_with_stmtDW_TAG_access_declarationDW_TAG_catch_blockDW_TAG_const_typeDW_TAG_constantDW_TAG_enumeratorDW_TAG_file_typeDW_TAG_friendDW_TAG_namelistDW_TAG_namelist_itemDW_TAG_packed_typeDW_TAG_subprogramDW_TAG_template_type_paramDW_TAG_template_value_paramDW_TAG_thrown_typeDW_TAG_try_blockDW_TAG_variant_partDW_TAG_variableDW_TAG_volatile_typeDW_TAG_dwarf_procedureDW_TAG_restrict_typeDW_TAG_interface_typeDW_TAG_namespaceDW_TAG_imported_moduleDW_TAG_unspecified_typeDW_TAG_imported_unitDW_TAG_conditionDW_TAG_shared_typeDW_TAG_type_unitDW_TAG_rvalue_reference_typeDW_TAG_template_aliasDW_TAG_coarray_typeDW_TAG_generic_subrangeDW_TAG_dynamic_typeDW_TAG_atomic_typeDW_TAG_call_siteDW_TAG_call_site_parameterDW_TAG_skeleton_unitDW_TAG_immutable_typeDW_TAG_MIPS_loopDW_TAG_HP_array_descriptorDW_TAG_HP_Bliss_fieldDW_TAG_HP_Bliss_field_setDW_TAG_format_labelDW_TAG_function_templateDW_TAG_class_templateDW_TAG_GNU_BINCLDW_TAG_GNU_EINCLDW_TAG_GNU_template_template_paramDW_TAG_GNU_template_parameter_packDW_TAG_GNU_formal_parameter_packDW_TAG_GNU_call_siteDW_TAG_GNU_call_site_parameterDW_TAG_upc_shared_typeDW_TAG_upc_strict_typeDW_TAG_upc_relaxed_typeDW_TAG_PGI_kanji_typeDW_TAG_PGI_interface_blockDW_TAG_array_typeDW_FORM_addrDW_FORM_block4DW_FORM_data2DW_FORM_data4DW_FORM_data8DW_FORM_stringDW_FORM_blockDW_FORM_block1DW_FORM_data1DW_FORM_flagDW_FORM_sdataDW_FORM_udataDW_FORM_ref_addrDW_FORM_ref1DW_FORM_ref2DW_FORM_ref4DW_FORM_ref8DW_FORM_ref_udataDW_FORM_sec_offsetDW_FORM_flag_presentDW_FORM_strxDW_FORM_addrxDW_FORM_ref_sup4DW_FORM_strp_supDW_FORM_data16DW_FORM_loclistxDW_FORM_rnglistxDW_FORM_ref_sup8DW_FORM_strx1DW_FORM_strx2DW_FORM_strx3DW_FORM_strx4DW_FORM_addrx1DW_FORM_addrx2DW_FORM_addrx3DW_FORM_addrx4DW_FORM_GNU_addr_indexDW_FORM_GNU_str_indexDW_FORM_GNU_ref_altDW_FORM_GNU_strp_altDW_FORM_block2DW_AT_nameDW_AT_orderingDW_AT_subscr_dataDW_AT_byte_sizeDW_AT_bit_offsetDW_AT_bit_sizeDW_AT_element_listDW_AT_stmt_listDW_AT_low_pcDW_AT_high_pcDW_AT_languageDW_AT_memberDW_AT_discrDW_AT_discr_valueDW_AT_visibilityDW_AT_string_lengthDW_AT_common_referenceDW_AT_comp_dirDW_AT_default_valueDW_AT_inlineDW_AT_is_optionalDW_AT_lower_boundDW_AT_producerDW_AT_prototypedDW_AT_return_addrDW_AT_start_scopeDW_AT_bit_strideDW_AT_upper_boundDW_AT_abstract_originDW_AT_accessibilityDW_AT_address_classDW_AT_artificialDW_AT_base_typesDW_AT_calling_conventionDW_AT_countDW_AT_data_member_locationDW_AT_decl_columnDW_AT_decl_fileDW_AT_decl_lineDW_AT_declarationDW_AT_discr_listDW_AT_encodingDW_AT_externalDW_AT_frame_baseDW_AT_friendDW_AT_identifier_caseDW_AT_namelist_itemsDW_AT_priorityDW_AT_segmentDW_AT_specificationDW_AT_static_linkDW_AT_use_locationDW_AT_variable_parameterDW_AT_virtualityDW_AT_allocatedDW_AT_associatedDW_AT_data_locationDW_AT_byte_strideDW_AT_entry_pcDW_AT_use_UTF8DW_AT_extensionDW_AT_rangesDW_AT_trampolineDW_AT_call_columnDW_AT_call_fileDW_AT_call_lineDW_AT_descriptionDW_AT_binary_scaleDW_AT_decimal_scaleDW_AT_smallDW_AT_decimal_signDW_AT_digit_countDW_AT_picture_stringDW_AT_mutableDW_AT_threads_scaledDW_AT_explicitDW_AT_object_pointerDW_AT_endianityDW_AT_elementalDW_AT_pureDW_AT_recursiveDW_AT_signatureDW_AT_main_subprogramDW_AT_data_bit_offsetDW_AT_const_exprDW_AT_enum_classDW_AT_linkage_nameDW_AT_string_length_bit_sizeDW_AT_string_length_byte_sizeDW_AT_rankDW_AT_str_offsets_baseDW_AT_addr_baseDW_AT_rnglists_baseDW_AT_dwo_nameDW_AT_referenceDW_AT_rvalue_referenceDW_AT_macrosDW_AT_call_all_callsDW_AT_call_all_source_callsDW_AT_call_all_tail_callsDW_AT_call_return_pcDW_AT_call_valueDW_AT_call_originDW_AT_call_parameterDW_AT_call_pcDW_AT_call_tail_callDW_AT_call_targetDW_AT_call_target_clobberedDW_AT_call_data_locationDW_AT_noreturnDW_AT_alignmentDW_AT_export_symbolsDW_AT_deletedDW_AT_defaultedDW_AT_loclists_baseDW_AT_MIPS_fdeDW_AT_MIPS_loop_beginDW_AT_MIPS_tail_loop_beginDW_AT_MIPS_epilog_beginDW_AT_MIPS_loop_unroll_factorDW_AT_MIPS_software_pipeline_depthDW_AT_MIPS_linkage_nameDW_AT_MIPS_strideDW_AT_MIPS_abstract_nameDW_AT_MIPS_clone_originDW_AT_MIPS_has_inlinesDW_AT_HP_actuals_stmt_listDW_AT_HP_proc_per_sectionDW_AT_HP_raw_data_ptrDW_AT_HP_pass_by_referenceDW_AT_HP_opt_levelDW_AT_HP_prof_version_idDW_AT_HP_opt_flagsDW_AT_HP_cold_region_low_pcDW_AT_HP_cold_region_high_pcDW_AT_HP_all_variables_modifiableDW_AT_HP_linkage_nameDW_AT_HP_prof_flagsDW_AT_HP_unit_nameDW_AT_HP_unit_sizeDW_AT_HP_widened_byte_sizeDW_AT_HP_definition_pointsDW_AT_HP_default_locationDW_AT_HP_is_result_paramDW_AT_sf_namesDW_AT_src_infoDW_AT_mac_infoDW_AT_src_coordsDW_AT_body_beginDW_AT_body_endDW_AT_GNU_vectorDW_AT_GNU_guarded_byDW_AT_GNU_pt_guarded_byDW_AT_GNU_guardedDW_AT_GNU_pt_guardedDW_AT_GNU_locks_excludedDW_AT_GNU_exclusive_locks_requiredDW_AT_GNU_shared_locks_requiredDW_AT_GNU_odr_signatureDW_AT_GNU_template_nameDW_AT_GNU_call_site_valueDW_AT_GNU_call_site_data_valueDW_AT_GNU_call_site_targetDW_AT_GNU_call_site_target_clobberedDW_AT_GNU_tail_callDW_AT_GNU_all_tail_call_sitesDW_AT_GNU_all_call_sitesDW_AT_GNU_all_source_call_sitesDW_AT_GNU_macrosDW_AT_GNU_deletedDW_AT_GNU_dwo_nameDW_AT_GNU_dwo_idDW_AT_GNU_ranges_baseDW_AT_GNU_addr_baseDW_AT_GNU_pubnamesDW_AT_GNU_pubtypesDW_AT_GNU_discriminatorDW_AT_GNU_locviewsDW_AT_GNU_entry_viewDW_AT_VMS_rtnbeg_pd_addressDW_AT_use_GNAT_descriptive_typeDW_AT_GNAT_descriptive_typeDW_AT_GNU_numeratorDW_AT_GNU_denominatorDW_AT_GNU_biasDW_AT_upc_threads_scaledDW_AT_PGI_lbaseDW_AT_PGI_soffsetDW_AT_PGI_lstrideDW_AT_APPLE_optimizedDW_AT_APPLE_flagsDW_AT_APPLE_isaDW_AT_APPLE_blockDW_AT_APPLE_major_runtime_versDW_AT_APPLE_runtime_classDW_AT_APPLE_omit_frame_ptrDW_AT_APPLE_property_nameDW_AT_APPLE_property_getterDW_AT_APPLE_property_setterDW_AT_APPLE_property_attributeDW_AT_APPLE_objc_complete_typeDW_AT_APPLE_propertyDW_IDX_compile_unitDW_IDX_die_offsetDW_IDX_parentDW_IDX_type_hashDW_IDX_hi_userDW_IDX_GNU_internalDW_IDX_GNU_externalDW_IDX_type_unitDW_UT_compileDW_UT_partialDW_UT_skeletonDW_UT_split_compileDW_UT_split_typeDW_UT_lo_userDW_UT_hi_userDW_UT_typeDW_CFA_nopDW_CFA_set_locDW_CFA_advance_loc1DW_CFA_advance_loc2DW_CFA_advance_loc4DW_CFA_offset_extendedDW_CFA_restore_extendedDW_CFA_undefinedDW_CFA_same_valueDW_CFA_registerDW_CFA_remember_stateDW_CFA_restore_stateDW_CFA_def_cfaDW_CFA_def_cfa_registerDW_CFA_def_cfa_offsetDW_CFA_def_cfa_expressionDW_CFA_expressionDW_CFA_offset_extended_sfDW_CFA_def_cfa_sfDW_CFA_def_cfa_offset_sfDW_CFA_val_offsetDW_CFA_val_offset_sfDW_CFA_val_expressionDW_CFA_lo_userDW_CFA_MIPS_advance_loc8DW_CFA_GNU_window_saveDW_CFA_GNU_args_sizeDW_CFA_GNU_negative_offset_extendedDW_CFA_hi_userDW_CFA_advance_locDW_CFA_offsetDW_CFA_restoreDW_ATE_voidDW_ATE_addressDW_ATE_booleanDW_ATE_complex_floatDW_ATE_floatDW_ATE_signedDW_ATE_signed_charDW_ATE_unsignedDW_ATE_unsigned_charDW_ATE_imaginary_floatDW_ATE_packed_decimalDW_ATE_numeric_stringDW_ATE_editedDW_ATE_signed_fixedDW_ATE_unsigned_fixedDW_ATE_decimal_floatDW_ATE_UTFDW_ATE_UCSDW_ATE_ASCIIDW_ATE_HP_float80DW_ATE_HP_complex_float80DW_ATE_HP_float128DW_ATE_HP_complex_float128DW_ATE_HP_floathpintelDW_ATE_HP_imaginary_float80DW_ATE_HP_imaginary_float128DW_ATE_HP_VAX_floatDW_ATE_HP_VAX_float_dDW_ATE_HP_packed_decimalDW_ATE_HP_zoned_decimalDW_ATE_HP_editedDW_ATE_HP_signed_fixedDW_ATE_HP_unsigned_fixedDW_ATE_HP_VAX_complex_floatDW_ATE_HP_VAX_complex_float_dDW_OP_addrDW_OP_derefDW_OP_const1uDW_OP_const1sDW_OP_const2uDW_OP_const2sDW_OP_const4uDW_OP_const4sDW_OP_const8uDW_OP_const8sDW_OP_constuDW_OP_constsDW_OP_dupDW_OP_dropDW_OP_overDW_OP_pickDW_OP_swapDW_OP_rotDW_OP_xderefDW_OP_absDW_OP_andDW_OP_divDW_OP_minusDW_OP_modDW_OP_mulDW_OP_negDW_OP_notDW_OP_orDW_OP_plusDW_OP_plus_uconstDW_OP_shlDW_OP_shrDW_OP_shraDW_OP_xorDW_OP_braDW_OP_eqDW_OP_geDW_OP_gtDW_OP_leDW_OP_ltDW_OP_neDW_OP_skipDW_OP_lit0DW_OP_lit1DW_OP_lit2DW_OP_lit3DW_OP_lit4DW_OP_lit5DW_OP_lit6DW_OP_lit7DW_OP_lit8DW_OP_lit9DW_OP_lit10DW_OP_lit11DW_OP_lit12DW_OP_lit13DW_OP_lit14DW_OP_lit15DW_OP_lit16DW_OP_lit17DW_OP_lit18DW_OP_lit19DW_OP_lit20DW_OP_lit21DW_OP_lit22DW_OP_lit23DW_OP_lit24DW_OP_lit25DW_OP_lit26DW_OP_lit27DW_OP_lit28DW_OP_lit29DW_OP_lit30DW_OP_lit31DW_OP_reg0DW_OP_reg1DW_OP_reg2DW_OP_reg3DW_OP_reg4DW_OP_reg5DW_OP_reg6DW_OP_reg7DW_OP_reg8DW_OP_reg9DW_OP_reg10DW_OP_reg11DW_OP_reg12DW_OP_reg13DW_OP_reg14DW_OP_reg15DW_OP_reg16DW_OP_reg17DW_OP_reg18DW_OP_reg19DW_OP_reg20DW_OP_reg21DW_OP_reg22DW_OP_reg23DW_OP_reg24DW_OP_reg25DW_OP_reg26DW_OP_reg27DW_OP_reg28DW_OP_reg29DW_OP_reg30DW_OP_reg31DW_OP_breg0DW_OP_breg1DW_OP_breg2DW_OP_breg3DW_OP_breg4DW_OP_breg5DW_OP_breg6DW_OP_breg7DW_OP_breg8DW_OP_breg9DW_OP_breg10DW_OP_breg11DW_OP_breg12DW_OP_breg13DW_OP_breg14DW_OP_breg15DW_OP_breg16DW_OP_breg17DW_OP_breg18DW_OP_breg19DW_OP_breg20DW_OP_breg21DW_OP_breg22DW_OP_breg23DW_OP_breg24DW_OP_breg25DW_OP_breg26DW_OP_breg27DW_OP_breg28DW_OP_breg29DW_OP_breg30DW_OP_breg31DW_OP_bregxDW_OP_pieceDW_OP_deref_sizeDW_OP_xderef_sizeDW_OP_nopDW_OP_call2DW_OP_call4DW_OP_call_refDW_OP_bit_pieceDW_OP_addrxDW_OP_constxDW_OP_regval_typeDW_OP_deref_typeDW_OP_xderef_typeDW_OP_convertDW_OP_reinterpretDW_OP_GNU_push_tls_addressDW_OP_HP_is_valueDW_OP_HP_fltconst4DW_OP_HP_fltconst8DW_OP_HP_mod_rangeDW_OP_HP_unmod_rangeDW_OP_HP_tlsDW_OP_AARCH64_operationDW_OP_GNU_uninitDW_OP_GNU_encoded_addrDW_OP_GNU_implicit_pointerDW_OP_GNU_entry_valueDW_OP_GNU_const_typeDW_OP_GNU_regval_typeDW_OP_GNU_deref_typeDW_OP_GNU_convertDW_OP_PGI_omp_thread_numDW_OP_GNU_reinterpretDW_OP_GNU_parameter_refDW_OP_GNU_const_indexxWWWWWWWWWWW WW#W.W9WDWOWYWfWpWzWWWWWWWWWWWWWWWW#W,W5W>WGWRW]WhWsW~WWWWWWWWWWWWWW W,W8WDWPW\WhWtWWWWWWWWWWWWW WW W+W6WBWNWZWfWrW~WWWWWWWWWWWWWW&W2W>WJWVWbWnWzWWWWWWWWWWWWWW+W8WEWRW_WlWyWWWWWWW2J-KWWWWWKW%W1WKK@WKKLPW\WK[LiW{WWWWWWWWW$W9WFW^WoWWWWWWW W"W8WKPWK W W W W W W W W0WEW\WrWWWWWWWWW W$W7WRWiWWWWWWWW%W>WZW. W9 WH W\ Wp W W W W W W W W W W8 WN Wh Wz W W W W W W W W$ W; WP Wt W W W Wfloatformat_bfloat16_littlefloatformat_bfloat16_bigfloatformat_ibm_long_double_littlefloatformat_ibm_long_double_bigfloatformat_ia64_quad_littlefloatformat_ia64_quad_bigfloatformat_ia64_spill_littlefloatformat_ia64_spill_bigfloatformat_arm_ext_littlebyte_bigwordfloatformat_arm_ext_bigfloatformat_m88110_ext_harrisfloatformat_m88110_extfloatformat_i960_extfloatformat_m68881_extfloatformat_i387_extfloatformat_vax_gfloatformat_vax_dfloatformat_vax_ffloatformat_ieee_double_littlebyte_bigwordfloatformat_ieee_double_littlefloatformat_ieee_double_bigfloatformat_ieee_single_littlefloatformat_ieee_single_bigfloatformat_ieee_half_littlefloatformat_ieee_half_big "WV9 "WV9  4"WW9$)W  4"WW9X)W?p#WV9?p1#WV9@K#WV9@i#WV9`? @#WV9`? @#WV9  4#WV9P?@#WV9`? @#WV9`? @ $WV9P?@$$W(W9@  49$WV9@ 7K$WV9  ]$WV9@  4o$WV9@  4$WV9@  4$WV9  $WV9  $WV9 %WV9 -%WV9PWDCannot find prime bigger than %lu %I$ <;G]tB{= 0$~`2fCOmA oE!a  0P AA ?  &*"@ `0PHX? "A!)?cccccccccccccccccccccccccccccccccccccccccccccccc ccccccc cccccccccccccccccccccccccc cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccopen temporary output filecould not create temporary fileclosing pipeline input fileopen temporary filepipeline already completeboth ERRNAME and PEX_STDERR_TO_PIPE specified.PEX_STDERR_TO_PIPE used in the middle of pipelineopen error filedup2execvpexecv: error trying to exec '9 999<9|9l909,9for<\u{::{shim as unsafe extern "fn(dyn 17hi128u1285YQIGtHLJiSGDYQVQ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~CBBBBQ00000000000000000000000000000000Signal %dSIGIOTIOT trapSIGCLDVVVV0V=SGVNV͝NrV`3Wg3WVVܬVV VV&V-V GVOVqVxV VVVĭVVoG KVSV yVVp3WVVVVVVVVVVVаVذVN#VDVLVkVsVV®VVVVVǯVϯV4V?23()*+,-./01TUHIXY23456789:;^_RSbc<=>?@ABCDEVW\]xyFGHIJKLMNO`afgdefghijklmnopqrstuvwxyz{|}~"#rs"#,-|}67<=$%@AFGJK !&'TU*+     ^_xy()hi,-./012345|}6789:;<=>?@ABCDEFGHI~JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{$%tu./~89PQBCZ[LMVW`axyjkDENO     FGPQ !"#$%HILM&'()*+,-./RSVW0123456789JK:;<=>?@ABCTUXYZ[\]^_`a&'vwbcdefghijk01lmnopqrstu:;devwxyz{|}~DEnoNOXYbcxylm     000001002003004005006007008009010011012013014015016017018019020021022023024025026027028029030031032033034035036037038039040041042043044045046047048049050051052053054055056057058059060061062063064065066067068069070071072073074075076077078079080081082083084085086087088089090091092093094095096097098099100101102103104105106107108109110111112113114115116117118119120121122123124125126127128129130131132133134135136137138139140141142143144145146147148149150151152153154155156157158159160161162163164165166167168169170171172173174175176177178179180181182183184185186187188189190191192193194195196197198199200201202203204205206207208209210211212213214215216217218219220221222223224225226227228229230231232233234235236237238239240241242243244245246247248249250251252253254255256257258259260261262263264265266267268269270271272273274275276277278279280281282283284285286287288289290291292293294295296297298299300301302303304305306307308309310311312313314315316317318319320321322323324325326327328329330331332333334335336337338339340341342343344345346347348349350351352353354355356357358359360361362363364365366367368369370371372373374375376377378379380381382383384385386387388389390391392393394395396397398399400401402403404405406407408409410411412413414415416417418419420421422423424425426427428429430431432433434435436437438439440441442443444445446447448449450451452453454455456457458459460461462463464465466467468469470471472473474475476477478479480481482483484485486487488489490491492493494495496497498499500501502503504505506507508509510511512513514515516517518519520521522523524525526527528529530531532533534535536537538539540541542543544545546547548549550551552553554555556557558559560561562563564565566567568569570571572573574575576577578579580581582583584585586587588589590591592593594595596597598599600601602603604605606607608609610611612613614615616617618619620621622623624625626627628629630631632633634635636637638639640641642643644645646647648649650651652653654655656657658659660661662663664665666667668669670671672673674675676677678679680681682683684685686687688689690691692693694695696697698699700701702703704705706707708709710711712713714715716717718719720721722723724725726727728729730731732733734735736737738739740741742743744745746747748749750751752753754755756757758759760761762763764765766767768769770771772773774775776777778779780781782783784785786787788789790791792793794795796797798799800801802803804805806807808809810811812813814815816817818819820821822823824825826827828829830831832833834835836837838839840841842843844845846847848849850851852853854855856857858859860861862863864865866867868869870871872873874875876877878879880881882883884885886887888889890891892893894895896897898899900901902903904905906907908909910911912913914915916917918919920921922923924925926927928929930931932933934935936937938939940941942943944945946947948949950951952953954955956957958959960961962963964965966967968969970971972973974975976977978979980981982983984985986987988989990991992993994995996997998999gf{  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy *+JKjkNO:;Z[z{^_  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy  *+JKjkNO:;Z[z{^_  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy  *+JKjkNO:;Z[z{^_  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy  *+JKjkNO:;Z[z{^_      ./>?,-,-,-,-./<=<=<=<=>?LMLMLMLM./\]\]\]\]>?lmlmlmlm./|}|}|}|}>?no~Out of memoryNCURSES_NO_PADDING, col %d, terminal '%s'  "%(+.147:=@CFILORUX\_bhk p!u"z#$%&'()*+ ,-./0123456789:;<4=5 >6?@A$B*C0D6E<FBGHHANIBTJCZK`LfMlNrOxP|QRSTUVWVXYXE3RGBTSU8XMgrbomgsbomxmANAXC0C8CECSE0G0KJOLS0TFWSXCXTZ0Z1CrCsCsrMsSeSmulxSsrmxxsmxxkDC3kDC4kDC5kDC6kDC7kDNkDN3kDN4kDN5kDN6kDN7kEND3kEND4kEND5kEND6kEND7kHOM3kHOM4kHOM5kHOM6kHOM7kIC3kIC4kIC5kIC6kIC7kLFT3kLFT4kLFT5kLFT6kLFT7kNXT3kNXT4kNXT5kNXT6kNXT7kPRV3kPRV4kPRV5kPRV6kPRV7kRIT3kRIT4kRIT5kRIT6kRIT7kUPkUP3kUP4kUP5kUP6kUP7ka2kb1kb3kc29=(,KWO.I"R&2:>)L !/FJ#S 73; ? *MY0GD$T8<P@+'N- 1HQE%U2Kn,X   `  %K @B  `  %& -g5 =NCURSES_NO_UTF8_ACSlinuxTERMCAPhhII00TERM environment variable not set. TERM environment must be <= %d characters. '%s': Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. unexpected return-code '%s': terminal is not really generic. '%s': I need something more specific. '%s': I can't handle hardcopy terminals. b64:hex:$TERMINFO%s/%c/%sbwamxbxsxneognhckmhsindadbmimsosesxthzulxonx5iHCNRNPNDccuthlYAYBYCYDYEYFYGcoitlilmsgpbvtwsNllhlwmaMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpbtblcrcsctclcecdchCCcmdohovileCMvendllupvsdcdldshdasmbmdtidmmhimmkmpmrsousecaemeteedeiseuevbfffsi1isi3ificalipkbkakCktkDkLkdkMkEkSk0k1k;k2k3k4k5k6k7k8k9khkIkAklkHkNkPkrkFkRkTkukeksl0l1lal2l3l4l5l6l7l8l9mommnwpcDCDLDOICSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pOrPacpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@7@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%c%d%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDTOPUfhPAWAu0u1u2u3u4u5u6u7u8u9opocIcIpspSfSbZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmAFABxldvcis0s1s2s3MLMTXyZzYvYwYxYyYzYZS1S2S3S4S5S6S7S8XhXlXoXrXtXvsAYIi2rsugbsnsncdCdNnlbcMTNLdBdTknkomaptxrG2G3G1G4GRGLGUGDGHGVGCmlmubxbwamxsbxhpxenleognhckmhsindadbmirmsgroseslokxthzulxonnxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixcolsitlineslmxmcpbvtwslnlablhlwmawnumcolorspairsncvbufszspinvspinhmaddrmjumpmcsmlsnpinsorcorlorhiorvicpswidcsbtnsbitwinbitypecbtbelcrcsrtbccleareledhpacmdchcupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdch1dl1dslhdsmacsblinkboldsmcupsmdcdimsmirinvisprotrevsmsosmulechrmacssgr0rmcuprmdcrmirrmsormulflashfffslis1is2is3ifich1il1ipkbsktbckclrkctabkdch1kdl1kcud1krmirkelkedkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9khomekich1kil1kcub1kllknpkppkcuf1kindkrikhtskcuu1rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmnelpaddchdlcudichindnilcubcufrincuupfkeypflocpfxmc0mc4mc5reprs1rs2rs3rfrcvpascindrisgrhtswindhttsluchuiprogka1ka3kb2kc1kc3mc5prmpacscplnkcbtsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkendkentkextkfndkhlpkmrkkmsgkmovknxtkopnkoptkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupdialqdialtonepulsehookpausewaitu0u1u2u3u4u5u6u7u8u9opocinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmkmousminforeqmpgetmsetafsetabpfxldevtcsins0dss1dss2dss3dssmglrsmgtbbirepbinelbicrcolornmdefbiendbisetcolorslinesdispcsmpchrmpchsmscrmscpctrmscescscesaehhlmelhlmelohlmerhlmethlmevhlmsgr1slengthOTi2OTrsOTugOTbsOTnsOTncOTdCOTdNOTnlOTbcOTMTOTNLOTdBOTdTOTknOTkoOTmaOTptOTxrOTG2OTG3OTG1OTG4OTGROTGLOTGUOTGDOTGHOTGVOTGCmemlmemubox1-7{GK\Pr#;]a|osYk?FJ&+(Aw, E30lLITqnrV4pM bS8VPcQe$<l@O)T4ZXB xu-S F\}$|W* tsY1Jy5`N! 9R %[=1Hm*_Cq!y.G }p2K)62O" :QR&ij>_I] wjZ,n'cdv+D"z^/MH ~U3NbL xX\gJ |{o1ky&RnP_aGNKb} z0vw4~#$@^[zCY`gqYc(h];Tld TQ`8"UV d} :*-BxWrjZv>e' uiaktEmO?2SrMsK\S{l_psqhoc]uw,fA'j UnJV)9f M1ZsbsrBSDBOmrAT&TCIviAT&TCVveAT&TDSmhAT&TFELFAT&TFLLOAT&TXSmkAT&TEEmhXENIXGEaeXENIXGSasXENIXCFviXENIXCOveXENIXEN@7XENIXHMkhXENIXLDkLXENIXPDkNXENIXPNpoXENIXPSpfXENIXPUkPXENIXRT@8XENIXUPkuXENIXG6XENIXG7XENIXG5XENIXG8XENIXGrXENIXGrXENIXGuXENIXGdXENIXGhXENIXGvXENIXGcXENIXGGXENIXkq%1IBMHSmhIRISKAk;TekKBF1TekKCF2TekKDF3TekKEF4TekKFF5TekBCSbTekFCSfTek  #&+.169<ADGLORWZ]cfioru{~ #&,/58>AGJPSY\beknqux{font0s0dsIBMfont1s1dsIBMfont2s2dsIBMfont3s3dsIBMkbtabkcbtIBMkselksltIBM $)-38<BGKPU    ! $ ' *-0369<?BEHKNQTWZ]` c!f"i#l$orux{~             #&),/2 5!8";#>$A%D&G'J(M)P*S+V,Y-\._/b0fe1h2k3n4q5t6w7z8}9:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\#]^_`abcdefxg h ijklmno"po%q(r+s.t1u4v7w:x=y@zC{F|I}L~ORUX[^adgjmpsvy|%u~tamd v`W  !$'*-0369<?BEHKNzQTWZ].`'cfiXl(oru/x{~56789:;<=>?@ABDE^       #&),/2 5!8";#>$A%D&G'J(M)P*S+V,Y-\._/b0e1h2k3n4q50t6w7z8}9:;<=>?@ABCDgEFhGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg h ijklmCno"pU%q(r+s.t1u4v7w:x=y@zC{F|I}eL~fOgRhUiX[^adgjmpsv!y%|&'"#()$%&{*+  " % ( + /47=@CFJOTY_cimquz !"#$     . #(/ D6:>AEIORUY _ Ic h m sx~ !"#$%&'()*+ ,-./01;#2L'3*4/53667:8?9bD:J;P<U=[>a?e@iAmBqCvDzE~FG=HIJKLMNOPQRST7UiVWQXYZ[\]^!_`abc^d efghij!k%l)m.n1o5p9q=rAs3GtMuQvUwYx]yaze{i|~m}p~swz~ 6 %*/4F9>CHMRW\afkpPuze H  %*/4+9>CHMR W!\"a#f$k%p&uz()*+,-./023456789:<=>?@ABCD  F G H I$ (,O1L6:?DJ%OUY^diotz !"#$%&'()*+,-.E/0123456789:;<N=> ? @ABC"Dp'E-F3G7H<IBJHK5NLSM/YN`OePjQoRtSxT}UVWXYZ[X\]^|_`ab[cdefWghijklmnm opqr"s(t-u5v;wAxJytQzW{]|c}Rh~msy!%&'"# ()$%&  * +    $ ) . 3 8 = <B yG L Q /usr/share/terminfoTERMINFO_DIRS%s/.terminfometa_onmeta_offcursor_visiblecursor_normalcursor_invisiblekeypad_xmitkeypad_local\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW../../../gnulib/import/glob.cold == init_namesglob_in_dirrpl_globUnknown error %dPOSIXLY_CORRECT../../../gnulib/import/fnmatch_loop.clist != NULLp[-1] == L_(')')! "Invalid extended matching operator"../../../gnulib/import/fnmatch.cmbsinit (&ps)ext_wmatchext_matchrpl_fnmatchgmp: overflow in mpz type  G2$~̂qEuNYd=p}$H0C<{fG5B3B;;%w2,mLoo0"Ļy8U0% *>|V+m?4("}|L(gɏ'hagSe)u~(%'P59^Lo'B!h,bV'?^  >'!E&'@ouR}'1T>A&A<ҁiإ__&G&j|2ӁF&l;t&~#ne&&Kx#W-r&30Jr]&&sMn==I&c%H14&j._%A &j!>ˬb &KcK)S%ױ % (%Ki*{y#% n\e%kAd -;%a υ!%> +xAw%& *ߖ7e%&Aۑl P*T%t {B%1S+ nd1%>W ۉrb!%Xܡ V~%m?\ 3fK%Sga ؔ@!$U4 26$.)q ;,C$ƈ_M"E$qQJyŰ$E#q$N~7($I$,K$B[RNvt$<JD6e$QHW$7k*/H$q|=]:$g7ŘF,$Eua7)ȝ$~d0M$-#Kx%Z$Hyz#]1@,p]###eI#e4w[2#x<#R<#~Hg#p?2#A(Y6# *@1{.#Ac U&vI#׳u v#m` Xi#{R,{]#!$]tR#y?F#m<ᇩ 뀞:#탉I!h&.#ag"9ƅ##"L#!'#~m6$7^k #gL%%##U&٥"%"P59;5"9k{1= +"B>h,P""ͼ1?L"?eA A"B0"RD?!adEU:!@VGR9!(qH!1AuJ>g6!QL$خ(!A<hMiإ!Lz]SO@!GQ!uhcRM9A!j|2mTG٦!?oQ.V7|!W;t5!7qY]m.!~# [neLͅ!:_any]d\^ڮ}!Kx^_#Wu![jJa{Pm!_=c0Jne!nJ128efC]!&:gMn=9U! MDiBH7N!>Vk%H1_F! 1omul+ͮ>!jo._% 7!A9qŢ s/!jrsˬ '!>$v[&k !K1fxK)!ޯz 6!} : !!2!:\0I! (D ^p*ǰv Kq*{bL ;$J- n\K m6.P kDƐ- fu" υ; ~ ˜&^ >|~+x sѶCqyŮ a*ߖ^ A\ЏU &AY̦ ⬚ 4Aѷu%I t{y i!)u 3nm Dm Cȵ#hqy >qۉrbs p {\>$m Xz>V q3T E_#s tQ5I'\ q N7(B L# qxn == 0tdiv_qr.cn2p[qn] >= cy2rn == dnnp[1] == n1sbpi1_div_q.ccy == 0sbpi1_divappr_q.cmu_div_qr.ccx >= cymu_divappr_q.c@@@@@@@@@@݀@ڀ@׀@Հ@Ӏ@р@π@̀@ʀ@Ȁ@@ŀĀ@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@GNU MP assertion failed: %s GNU MP: Cannot allocate memory (size=%lu) GNU MP: Cannot reallocate memory (old_size=%lu new_size=%lu)   !"#  !"#  !"#$%&'()*+,-./0123456789:;<=ͷ9=)5ይ kwcgKmWCeGɳ+M7#Eoq'_a -%OQ{s?A y/1[}iSu!Y;]I3Unl == 0mul_fft.c(n & (K2 - 1)) == 0nprime2 < n__gmpn_fft_next_size (pl, k) == plnprime < pl(080 80#80'8@8#@8)@81@H@8?@HPX`h p@x( (080 80#8@8#@8)@8/@H@'HPX`h p@xp%c%ldP%c%lde%c%02ldE%c%02ld0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0X0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzstd::bad_allocSt9bad_allocN10__cxxabiv117__class_type_infoE__gnu_cxx::__concurrence_lock_error__gnu_cxx::__concurrence_unlock_errorN9__gnu_cxx24__concurrence_lock_errorEN9__gnu_cxx26__concurrence_unlock_errorEstd::exceptionstd::bad_exceptionN10__cxxabiv115__forced_unwindEN10__cxxabiv119__foreign_exceptionESt13bad_exceptionSt9exceptionN10__cxxabiv120__function_type_infoEN9__gnu_cxx20recursive_init_errorEN10__cxxabiv119__pointer_type_infoEN10__cxxabiv120__si_class_type_infoESt9type_infoN10__cxxabiv121__vmi_class_type_infoEterminate called recursively terminate called after throwing an instance of 'terminate called without an active exception what(): basic_string::_S_construct null not validbasic_string::at: __n (which is %zu) >= this->size() (which is %zu)basic_string::copybasic_string::comparebasic_string::_S_createbasic_string::_M_replace_auxbasic_string::insertbasic_string::assignbasic_string::resizebasic_string::basic_stringbasic_string::substr?bad_function_callSt17bad_function_callfutureBroken promiseFuture already retrievedPromise already satisfiedNo associated state*N12_GLOBAL__N_121future_error_categoryENSt13__future_base12_Result_baseESt12future_error %)+/5;=CGIOSYagmq%9QgAk7wU eMW5 _A%]O"%!(i+.26E;@UEJQW^fnxǁ]ٗ;1q3L+hy?QAp[Wa ;U[DGqV1J A S C%piq@Ѻ h#=O&Yr)7,'0#|4W8n={vBGM)T [ǂbjMs|;wM slo%Qwہ(@[ zwm9a}zYjc,Zl5z8ox|gu*j*-+] ))VݿQPI K~ EZ CH 1I ]P`[_4M(O  ɝ1u+"]$'E+.%2K6խH;!}#@idEKu8QDWd_^fFoCLcx?)錽s+qQ Kx /dev/urandom/dev/randomrandom_device::random_device(const std::string&): unsupported tokenrandom_device::random_device(const std::string&): device not availablemt19937random_device could not be readnot enough space for format expansion (Please submit full bug report at https://gcc.gnu.org/bugs/): basic_string::_M_createbasic_string::_M_replacestring::string*N12_GLOBAL__N_121system_error_categoryE*N12_GLOBAL__N_122generic_error_categoryENSt3_V214error_categoryESt12system_errorNSt6thread6_StateEstd::bad_array_new_lengthSt20bad_array_new_lengthstd::bad_castSt8bad_caststd::bad_typeidSt10bad_typeidvPvPKvbPbPKbwPwPKwDuPDuPKDuDsPDsPKDsDiPDiPKDicPcPKcaPaPKahPhPKhsPsPKstPtPKtiPiPKijPjPKjlPlPKlmPmPKmxPxPKxyPyPKyfPfPKfdPdPKdePePKeDnPDnPKDnoPoPKou6__bf16Pu6__bf16PKu6__bf16__builtin_neon_tiP__builtin_neon_tiPK__builtin_neon_tiDfPDfPKDfDdPDdPKDdDePDePKDeN10__cxxabiv123__fundamental_type_infoEN10__cxxabiv117__pbase_type_infoEN10__cxxabiv129__pointer_to_member_type_infoESt11logic_errorSt11range_errorSt12domain_errorSt12length_errorSt12out_of_rangeSt13runtime_errorSt14overflow_errorSt15underflow_errorSt16invalid_argument+eGg@8CB.v:; ??fz^n?g5RҌ?m{]<lX?<2? n4jf?/*RVQ[?UNP1l?չ#ɑ-?U\Ӏ ?MuM<1 ?LtB<1Lp?J]9ݏ<d?[;_?hPKJ˩:7?-Qfm?6>q4?γ-?mL*H<"4L?i(z`E?[HX*.! ?Ig,|P?`cC<-a`?d; fZ~dxt_u?}JtH?U2gBV? ^˜T'?47;iL?:^#F?nWrPԔD٨?[g?11̐!Ղ_{3|? G;*)F?ӈ:`tF ?3ƿݣ?WĿ09 XJ?$¿"S?ZYb<n?uG_H?[W{хX#?`'"S?GL:w ?@x?ـY?B}8@{>?o;%s?wOz\ Q? Ũ# 0?x)&j!~%? wk~?PS?eD???M?Z:W?@W2?=?Р?8w?@r?CMr ?`P?cuܲ?v?Q?? wC?L O+?@ގ?`l}?j ?3.n6 ?ί ?9P)&p?g y?1'm?h????gI?NF?|p?: -?9 ?P Q?Y?q?m?}?X)i?`‹aԿ̄LH/=?0Կ: B<?HiULӿ`QƱ =?GӿMY%=? ҿ+{&=`?Zҿ?϶=`?Zҿ?϶=@?xA)ҿvS($Z ?iѿTh?\gѿ3=?HѿfZĨ&?s$п~k ?д%@п-6?д%@п-6?@^mϿ<*W =`?`˭ο$&+=@?*n'ο?TO/ ?Ok!\Ϳhʻ!=?̿4hOy'=?̿4hOy'=?-t˿1N=?Nʿf?cN<?#ʿFd%?#ʿFd%?PZRɿ*`? eȿ +=@?ǿXJSr+=@?ǿXJSr+= ?ƿfⲣj?p0ſ9PC?p0ſ9PC?&ſ[ ?l+MĿ?`F;? V]2%?ѧ?Nۥ^,=`?MZ?]<i,@? ?2흩<?@Y]^3?G:\#=?`j?h+?@X?ӬZF&=`? 9Ǿ?Eh-@?9? O4%?'?-x!=?#~+?48D,=? a?l=?e?rK#/<@?3=?xTy%= ?'?}i3&=?NW?x.<,=?pu?!%?PD?Cpf`?9믾?,T=@?ZZ?oX(=?ҿEB*?')ѿ߽"?H+mѿ4G?gAѿ@(C?пȣx>?п%?cRGп4$?E"Ͽ -m?uJGϿT9S?0=DοZD':?D οA ?w)`Ϳ>ڂ?̿W]?V) ̿L ?˿+`?ʿu+$?.@EʿП"?hwɿz[u?0Him ɿ6I]?E qȿ@MyF?0ǿ$\/?pb<<ǿI uw?`7ƿ9>7?T1 ƿAN?0$v}sſѩ ?0{Ŀ*?Q,FĿ z?ÿ0`r?IkÿWW}?@T¿;h?yS?,%`;ɪ>? W@+*?I<2A̖y?KW ?@@7 HMI?@>ieR?Ng|~W#?`/ yܺ&t|?(, ?rFp{?%w?8Et1L5d?m^_'Q?\HL2??jM3r,?`y 1(0? bF4?jlkN?@wJڭΟ*]?켫!,cD?@|?3X6ƃ/?g^q9۝?eI\R?@dI(N/{?r5j?RRU,Y?b=,II?(8? {12ye(?]5Hs'$?x?$y `&?o?ta?=5A܇?.c?ģΓ?ͭ<%???ذ?x?[? t?@\? :?Wj'?V` ?u?w? S?| ?8.?\f\?WY?^,'?j5vڷ?,k>n?`NC?ym?` x?m7m&? 2C?X]X?`q1 ?3&?@+g???G?u?0n&?(J ?PŦ?,>e?3eI*??`?hc_Y?)c%? 0?w?`Cr?%g?m&w?Wy?0O? V?/2?libc-start.c__ehdr_start.e_phentsize == sizeof *GL(dl_phdr)Unexpected reloc type in static binary. __libc_start_main_impl/dev/full/dev/nullFatal glibc error: Cannot allocate TLS block iconv.c!"Nothing like this should happen"gconv.cirreversible != NULLoutbuf != NULL && *outbuf != NULL__gconvgconv_db.cstep->__end_fct == NULL__gconv_release_stepgconv_conf.cresult == NULLelem != NULLcwd != NULL/usr/lib/gconvgconv-modules__gconv_get_pathISO-10646/UCS4/=INTERNAL->ucs4=ucs4->INTERNALUCS-4LE//=INTERNAL->ucs4le=ucs4le->INTERNALISO-10646/UTF8/=INTERNAL->utf8=utf8->INTERNALISO-10646/UCS2/=ucs2->INTERNAL=INTERNAL->ucs2ANSI_X3.4-1968//=ascii->INTERNAL=INTERNAL->asciiUNICODEBIG//=ucs2reverse->INTERNAL=INTERNAL->ucs2reverseUCS4//ISO-10646/UCS4/UCS-4//ISO-10646/UCS4/UCS-4BE//ISO-10646/UCS4/CSUCS4//ISO-10646/UCS4/ISO-10646//ISO-10646/UCS4/10646-1:1993//ISO-10646/UCS4/10646-1:1993/UCS4/ISO-10646/UCS4/OSF00010104//ISO-10646/UCS4/OSF00010105//ISO-10646/UCS4/OSF00010106//ISO-10646/UCS4/WCHAR_T//INTERNALUTF8//ISO-10646/UTF8/UTF-8//ISO-10646/UTF8/ISO-IR-193//ISO-10646/UTF8/OSF05010001//ISO-10646/UTF8/ISO-10646/UTF-8/ISO-10646/UTF8/UCS2//ISO-10646/UCS2/UCS-2//ISO-10646/UCS2/OSF00010100//ISO-10646/UCS2/OSF00010101//ISO-10646/UCS2/OSF00010102//ISO-10646/UCS2/ANSI_X3.4//ANSI_X3.4-1968//ISO-IR-6//ANSI_X3.4-1968//ANSI_X3.4-1986//ANSI_X3.4-1968//ISO_646.IRV:1991//ANSI_X3.4-1968//ASCII//ANSI_X3.4-1968//ISO646-US//ANSI_X3.4-1968//US-ASCII//ANSI_X3.4-1968//US//ANSI_X3.4-1968//IBM367//ANSI_X3.4-1968//CP367//ANSI_X3.4-1968//CSASCII//ANSI_X3.4-1968//OSF00010020//ANSI_X3.4-1968//UNICODELITTLE//ISO-10646/UCS2/UCS-2LE//ISO-10646/UCS2/UCS-2BE//UNICODEBIG//gconv_builtin.ccnt < sizeof (map) / sizeof (map[0])__gconv_get_builtin_trans../iconv/skeleton.coutbufstart == NULLoutbuf == outerrnstatus == __GCONV_FULL_OUTPUTcnt_after <= sizeof (data->__statep->__value.__wchb)gconv_simple.c*outptrp + 4 > outend../iconv/loop.c(state->__count & 7) <= sizeof (state->__value)inlen_after <= sizeof (state->__value.__wchb)inptr - bytebuf > (state->__count & 7)inend != &bytebuf[MAX_NEEDED_INPUT]inend - inptr > (state->__count & ~7)inend - inptr <= sizeof (state->__value.__wchb)ch != 0xc0 && ch != 0xc1internal_ucs2reverse_loop_single__gconv_transform_internal_ucs2reverseucs2reverse_internal_loop_single__gconv_transform_ucs2reverse_internalinternal_ucs2_loop_single__gconv_transform_internal_ucs2ucs2_internal_loop_single__gconv_transform_ucs2_internalutf8_internal_loop_single__gconv_transform_utf8_internalinternal_utf8_loop_single__gconv_transform_internal_utf8internal_ascii_loop_single__gconv_transform_internal_ascii__gconv_transform_ascii_internalucs4le_internal_loop_unaligneducs4le_internal_loop__gconv_transform_ucs4le_internalinternal_ucs4le_loop_unaligned__gconv_transform_internal_ucs4le__gconv_transform_ucs4_internal__gconv_transform_internal_ucs4GCONV_PATH/usr/lib/gconv/gconv-modules.cachegconv_dl.cobj->counter > 0found->handle == NULLgconv_initgconv_enddo_release_shlib__gconv_find_shlib,TRANSLIT/IGNORE,IGNORELOCPATH   LC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMELC_MESSAGESLC_PAPERLC_NAMELC_ADDRESSLC_TELEPHONELC_MEASUREMENTLC_IDENTIFICATION +3?HP[hwfindlocale.clocale_codeset != NULL/../_nl_find_locale/usr/lib/localen- loadlocale.ccategory == LC_CTYPE/SYS__nl_intern_locale_dataV.     loadarchive.cpowerof2 (ps)last->next == mappedranges[cnt].from >= fromarchmapped == &headmap_nl_archive_subfreeres_nl_load_locale_from_archive/usr/lib/locale/locale-archive%s%s%s:%u: %s%sAssertion `%s' failed. %nUnexpected error. OUTPUT_CHARSETcharset=.mo/usr/share/localemessagesllXlli/locale.alias' +.'                     plural=nplurals=cxa_atexit.c__new_exitfn__internal_atexit?UUUU?3333*$I$qtEUUU;$I8^Cy 0 ,d! p= ^B{ I$ B|uPq  UUUUUUUU?33333333*$I$I$qqqE]tEUUUUUUU;;I$I$I8885P^Cy 0 0 0 袋. ,d! p= ףp= ؉؉ %^B{ $I$I$ =B!B|PuPuPqqexit 0tmpfw+bto_outpunctvfprintf-internal.c(size_t) done <= (size_t) INT_MAX(mode_flags & PRINTF_FORTIFY) != 0*** invalid %N$ use detected *** *** %n in writable segment detected *** printf_positionaloutstring_func       to_inpunctvfscanf-internal.ccnt < MB_LEN_MAX__vfscanf_internal%+39HOV]ekrx@dk= '.5;AHOW_fm\tyyrG *:JUboz&0UN *6CK0EPERMENOENTESRCHEINTREIOENXIOE2BIGENOEXECEBADFECHILDEDEADLKENOMEMEACCESEFAULTENOTBLKEBUSYEEXISTEXDEVENODEVENOTDIREISDIREINVALEMFILEENFILEENOTTYETXTBSYEFBIGENOSPCESPIPEEROFSEMLINKEPIPEEDOMERANGEEAGAINEINPROGRESSEALREADYENOTSOCKEMSGSIZEEPROTOTYPEENOPROTOOPTEPROTONOSUPPORTESOCKTNOSUPPORTEOPNOTSUPPEPFNOSUPPORTEAFNOSUPPORTEADDRINUSEEADDRNOTAVAILENETDOWNENETUNREACHENETRESETECONNABORTEDECONNRESETENOBUFSEISCONNENOTCONNEDESTADDRREQESHUTDOWNETOOMANYREFSETIMEDOUTECONNREFUSEDELOOPENAMETOOLONGEHOSTDOWNEHOSTUNREACHENOTEMPTYEUSERSEDQUOTESTALEEREMOTEENOLCKENOSYSEILSEQEBADMSGEIDRMEMULTIHOPENODATAENOLINKENOMSGENOSRENOSTREOVERFLOWEPROTOETIMEECANCELEDEOWNERDEADENOTRECOVERABLEERESTARTECHRNGEL2NSYNCEL3HLTEL3RSTELNRNGEUNATCHENOCSIEL2HLTEBADEEBADREXFULLENOANOEBADRQCEBADSLTEBFONTENONETENOPKGEADVESRMNTECOMMEDOTDOTENOTUNIQEBADFDEREMCHGELIBACCELIBBADELIBSCNELIBMAXELIBEXECESTRPIPEEUCLEANENOTNAMENAVAILEISNAMEREMOTEIOENOMEDIUMEMEDIUMTYPEENOKEYEKEYEXPIREDEKEYREVOKEDEKEYREJECTEDERFKILLEHWPOISONwfileops.cstatus == __codecvt_partial_IO_wfile_underflowiofwide.cfcts.towc_nsteps == 1fcts.tomb_nsteps == 1_IO_fwideFatal error: glibc detected an invalid stdio handle ,ccs=_IO_new_file_fopenstrops.coffset >= oldendenlarge_userbuf%s%s%s: %minvalid mode parameterThe futex facility returned an unexpected error code. Fatal glibc error: rseq registration failed allocatestack.cfreesize < sizepthread_create.c*stopped_startpowerof2 (pagesize_m1 + 1)size > adjerrno == ENOMEMmem != NULLpd->stopped_startadvise_stack_rangecreate_threadallocate_stack__pthread_create_2_12.36@@@ T X@ @      @ 0@00   $  ( h @` ../nptl/pthread_mutex_lock.ce != EDEADLK || (kind != PTHREAD_MUTEX_ERRORCHECK_NP && kind != PTHREAD_MUTEX_RECURSIVE_NP)e != ESRCH || !robustrobust || (oldval & FUTEX_OWNER_DIED) == 0mutex->__data.__owner == 0PTHREAD_MUTEX_TYPE (mutex) == PTHREAD_MUTEX_ERRORCHECK_NP(mutex_kind & PTHREAD_MUTEX_PRIO_INHERIT_NP) != 0(mutex_kind & PTHREAD_MUTEX_ROBUST_NORMAL_NP) == 0(mutex_kind & PTHREAD_MUTEX_PSHARED_BIT) == 0__pthread_mutex_cond_lock_adjust__pthread_mutex_cond_lock_full__pthread_mutex_cond_lock__pthread_mutex_lock_full___pthread_mutex_lockpthread_mutex_trylock.c___pthread_mutex_trylockpthread_mutex_unlock.ctype == PTHREAD_MUTEX_ERRORCHECK_NP__pthread_mutex_unlock_usercnt/proc/self/task/%u/commtpp.cnew_prio == -1 || (new_prio >= fifo_min_prio && new_prio <= fifo_max_prio)previous_prio == -1 || (previous_prio >= fifo_min_prio && previous_prio <= fifo_max_prio)__pthread_tpp_change_priorityint_mallinfo(): unaligned fastbin chunk detectedchunk_is_mmapped (p)Fatal glibc error: malloc assertion failure in %s: %s munmap_chunk(): invalid pointerreplaced_arena->attached_threads > 0result->attached_threads == 0p->attached_threads == 0((INTERNAL_SIZE_T) chunk2mem (mm) & MALLOC_ALIGN_MASK) == 0corrupted size vs. prev_sizecorrupted double-linked listcorrupted double-linked list (not small)malloc_consolidate(): unaligned fastbin chunk detectedmalloc_consolidate(): invalid chunk sizecorrupted size vs. prev_size in fastbins __malloc_info(): unaligned fastbin chunk detected free(): invalid pointerfree(): invalid sizefree(): too many chunks detected in tcachefree(): unaligned chunk detected in tcache 2free(): double free detected in tcache 2free(): invalid next size (fast)double free or corruption (fasttop)invalid fastbin entry (free)double free or corruption (top)double free or corruption (out)double free or corruption (!prev)free(): invalid next size (normal)corrupted size vs. prev_size while consolidatingfree(): corrupted unsorted chunksheap->ar_ptr == avchunksize_nomask (p) == (0 | PREV_INUSE)new_size > 0 && new_size < (long) (2 * MINSIZE)new_size > 0 && new_size < max_size((unsigned long) ((char *) p + new_size) & (heap->pagesize - 1)) == 0((char *) p + new_size) == ((char *) heap + heap->size)/proc/sys/vm/overcommit_memory(old_top == initial_top (av) && old_size == 0) || ((unsigned long) (old_size) >= MINSIZE && prev_inuse (old_top) && ((unsigned long) old_end & (pagesize - 1)) == 0)(unsigned long) (old_size) < (unsigned long) (nb + MINSIZE)break adjusted to free malloc spacecorrection >= 0((unsigned long) chunk2mem (brk) & MALLOC_ALIGN_MASK) == 0malloc(): unaligned fastbin chunk detected 2malloc(): unaligned fastbin chunk detectedmalloc(): memory corruption (fast)malloc(): unaligned fastbin chunk detected 3malloc(): smallbin double linked list corruptedmalloc(): invalid size (unsorted)malloc(): invalid next size (unsorted)malloc(): mismatching next->prev_size (unsorted)malloc(): unsorted double linked list corruptedmalloc(): invalid next->prev_inuse (unsorted)chunk_main_arena (bck->bk)chunk_main_arena (fwd)malloc(): largebin double linked list corrupted (nextsize)malloc(): largebin double linked list corrupted (bk)malloc(): unaligned tcache chunk detectedmalloc(): corrupted unsorted chunks(unsigned long) (size) >= (unsigned long) (nb)malloc(): corrupted unsorted chunks 2malloc(): corrupted top sizerealloc(): invalid old size!chunk_is_mmapped (oldp)realloc(): invalid next size(unsigned long) (newsize) >= (unsigned long) (nb)newsize >= nb && (((unsigned long) (chunk2mem (p))) % alignment) == 0!victim || chunk_is_mmapped (mem2chunk (victim)) || &main_arena == arena_for_chunk (mem2chunk (victim))!victim || chunk_is_mmapped (mem2chunk (victim)) || ar_ptr == arena_for_chunk (mem2chunk (victim))!p || chunk_is_mmapped (mem2chunk (p)) || &main_arena == arena_for_chunk (mem2chunk (p))!p || chunk_is_mmapped (mem2chunk (p)) || ar_ptr == arena_for_chunk (mem2chunk (p))tcache_thread_shutdown(): unaligned tcache chunk detectedrealloc(): invalid pointermremap_chunk(): invalid pointeraligned_OK (chunk2mem (p))prev_size (p) == offset!newp || chunk_is_mmapped (mem2chunk (newp)) || ar_ptr == arena_for_chunk (mem2chunk (newp))!mem || chunk_is_mmapped (mem2chunk (mem)) || av == arena_for_chunk (mem2chunk (mem))nclears >= 3(char *) chunk2mem (p) + 2 * CHUNK_HDR_SZ <= paligned_mem(char *) p + size > paligned_memArena %d: system bytes = %10u in use bytes = %10u Total (incl. mmap): max mmap regions = %10u max mmap bytes = %10lu mtrim__libc_calloc_int_memalign_mid_memalign_int_reallocmremap_chunk__libc_reallocmunmap_chunkheap_trim_int_freesysmalloc_mmapsysmalloc_int_mallocremove_from_free_listdetach_arenaget_free_list__libc_malloc__malloc_arena_thread_freeresUnknown error strcoll_l.c((uintptr_t) table) % __alignof__ (table[0]) == 0((uintptr_t) indirect) % __alignof__ (indirect[0]) == 0__strcoll_lReal-time signal %dUnknown signal %dmbrtowc.cstatus == __GCONV_OK || status == __GCONV_EMPTY_INPUT || status == __GCONV_ILLEGAL_INPUT || status == __GCONV_INCOMPLETE_INPUT || status == __GCONV_FULL_OUTPUT__mbsinit (data.__statep)__mbrtowcwcrtomb.c__wcrtomb_internalwcsrtombs.cdata.__outbuf[-1] == '\0'data.__outbuf != (unsigned char *) dst__wcsrtombsFatal glibc error: gconv module reference counter overflow ANSI_X3.4-1968//TRANSLITmbsrtowcs_l.c((wchar_t *) data.__outbuf)[-1] == L'\0'result > 0__mbsrtowcs_l%hu%n:%hu%n:%hu%nM%hu.%hu.%hu%nUniversal/etc/localtimeTZUTCGMTTZDIRTZiftzfile.ctzspec_len > 0posixrulesnum_types == 2num_types == 1strcmp (&zone_names[info->idx], __tzname[tp->tm_isdst]) == 0__tzfile_compute__tzfile_read/usr/share/zoneinfo%m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %pgetgrgid_rsetpwentendpwentgetpwent_rgetpwnam_rgetpwuid_r../sysdeps/nptl/fork.hl->next->prev == elemreclaim_stacksfork handler counter overflow/bin:/usr/bin/proc/sys/kernel/ngroups_max/proc/sys/kernel/rtsig-max../sysdeps/unix/sysv/linux/sysconf.cGLRO(dl_minsigstacksize) != 0../sysdeps/unix/sysv/linux/sysconf-sigstksz.hminsigstacksize != 0../sysdeps/unix/sysv/linux/sysconf-pthread_stack_min.hpthread_stack_min != 0__get_pthread_stack_minsysconf_sigstksz__sysconfext_matchext_wmatchfnmatch_convert_to_wide%s: option '%s%s' is ambiguous %s: option '%s%s' is ambiguous; possibilities: '%s%s'%s: unrecognized option '%s%s' %s: option '%s%s' doesn't allow an argument %s: option '%s%s' requires an argument %s: invalid option -- '%c' %s: option requires an argument -- '%c' -W ../sysdeps/posix/getaddrinfo.csrc->results[i].native == -1 || src->results[i].native == a1_nativesrc->results[i].native == -1 || src->results[i].native == a2_nativea1->source_addr.sin6_family == PF_INETa2->source_addr.sin6_family == PF_INETa1->source_addr.sin6_family == PF_INET6a2->source_addr.sin6_family == PF_INET6/etc/gai.confscopev4precedencegethostbyname2_rgethostbyname3_rgetcanonname_rIN6_IS_ADDR_V4MAPPED (sin6->sin6_addr.s6_addr32)canonname == NULLtext_to_binary_addressrfc3484_sortgetaddrinfo ``   2 `` ((tcpudp!dccpudplitesctpsctpraw*Of(BOnAddress family for hostname not supportedTemporary failure in name resolutionBad value for ai_flagsNon-recoverable failure in name resolutionai_family not supportedMemory allocation failureNo address associated with hostnameName or service not knownServname not supported for ai_socktypeai_socktype not supportedSystem errorProcessing request in progressRequest canceledRequest not canceledAll requests doneInterrupted by a signalParameter string not correctly encoded../sysdeps/unix/sysv/linux/getcwd.cerrno != ERANGE || buf != NULL || size != 0__getcwd../sysdeps/unix/sysv/linux/getpagesize.cGLRO(dl_pagesize) != 0__getpagesize../sysdeps/unix/sysv/linux/getsysstats.c*cp <= *re/proc/stat/sys/devices/system/cpu/online/sys/devices/system/cpu/possiblenext_line/proc/self/fd//sys/kernel/mm/transparent_hugepage/hpage_pmd_size/sys/kernel/mm/transparent_hugepage/enabled/proc/meminfoHugepagesize:/sys/kernel/mm/hugepageshugepages-always madvise [never] always [madvise] never [always] madvise never GMON_OUT_PREFIXgmon.out%s.%u_mcleanup: gmon.out: %s secondsmonstartup: out of memory buffer overflow detected/proc/self/mapslongjmp causes uninitialized stack framebit out of range 0 - FD_SETSIZE on fd_setstack smashing detected*** %s ***: terminated getservbyname_r../sysdeps/unix/sysv/linux/ifaddrs.cifa_data_ptr <= (char *) &ifas[newlink + newaddr] + ifa_data_sizegetifaddrs_internallibidn2.so.0IDN2_0.0.0idn2_lookup_ulidn2_to_unicode_lzlzUnexpected error %d on netlink descriptor %d. Unexpected error %d on netlink descriptor %d (address family %d). Unexpected netlink response of size %zd on descriptor %d Unexpected netlink response of size %zd on descriptor %d (address family %d) %u.%u.%u.%u%s: line %d: cannot specify more than %d trim domains%s: line %d: list delimiter not followed by domain%s: line %d: expected `on' or `off', found `%s' /etc/host.confRESOLV_HOST_CONF%s: line %d: ignoring trailing garbage `%s' RESOLV_MULTIRESOLV_REORDERRESOLV_ADD_TRIM_DOMAINSRESOLV_OVERRIDE_TRIM_DOMAINS%s: line %d: bad command `%s' res_hconf.cifaddrs != NULL_res_hconf_reorder_addrsordertrimmultireorderresolv_context.ccurrent->__from_rescurrent->__refcount > 0ctx->conf == NULLcurrent == ctxctx->__refcount > 0__resolv_context_putmaybe_initcontext_reuseIllegal status in __nss_next. XXX-lookup.c*ni != NULL__nss_services_lookup2__nss_hosts_lookup2__nss_group_lookup2__nss_passwd_lookup2libnss_files.so.2libnss_%s.so%s_nss_%s_%snss_module.cname_entry != NULL__nss_module_get_functionendaliasentendetherentendgrentendhostentendnetentendnetgrentendprotoentendpwentendrpcentendserventendsgentendspentgetaliasbyname_rgetaliasent_rgetcanonname_rgetetherent_rgetgrent_rgetgrgid_rgetgrnam_rgethostbyaddr2_rgethostbyaddr_rgethostbyname2_rgethostbyname3_rgethostbyname4_rgethostbyname_rgethostent_rgethostton_rgetnetbyaddr_rgetnetbyname_rgetnetent_rgetnetgrent_rgetntohost_rgetprotobyname_rgetprotobynumber_rgetprotoent_rgetpublickeygetpwent_rgetpwnam_rgetpwuid_rgetrpcbyname_rgetrpcbynumber_rgetrpcent_rgetsecretkeygetservbyname_rgetservbyport_rgetservent_rgetsgent_rgetsgnam_rgetspent_rgetspnam_rinitgroups_dynnetname2usersetaliasentsetetherentsetgrentsethostentsetnetentsetnetgrentsetprotoentsetpwentsetrpcentsetserventsetsgentsetspentnisnis nisplusfiles dns/etc/nsswitch.confnss_database.cret > 0local != NULL__nss_database_fork_subprocess__nss_database_get_noreloadnss_database_select_defaultnss_database_reload_1aliasesethersgroupgroup_compatgshadowhostsinitgroupsnetgroupnetworkspasswdpasswd_compatprotocolspublickeyrpcservicesshadowshadow_compat# /etc/protocols/etc/services/etc/hostsnss_files/files-hosts.caf == AF_INET || af == AF_INET6tmp_result_buf.h_length == 4tmp_result_buf.h_length == 16buflen >= bufferend - bufferresult.h_addr_list[1] == NULL(_res_hconf.flags & HCONF_FLAG_MULTI) != 0_nss_files_gethostbyname4_rgethostbyname3_multi/etc/networks/etc/group/etc/passwd/etc/ethers/etc/shadow/etc/netgroup:include:/etc/aliases/etc/gshadow/etc/rpcnscd_getgr_r.c((uintptr_t) len & (__alignof__ (*len) - 1)) == 0nscd_getgr_rLOCALDOMAINnscd_getai.csock == -1__nscd_getainscd_getserv_r.calloca_aliases_len == 0nscd_getserv_r/var/run/nscd/socketnscd_helper.cmapped->counter == 0__nscd_unmap/proc/self/loginuid/var/log/wtmpx/var/run/utmpx/var/run/utmp/var/log/wtmpdl-close.c! should_be_there closing file=%s; direct_opencount=%u idx == nloaded(*lp)->l_idx >= 0 && (*lp)->l_idx < nloadedjmap->l_idx >= 0 && jmap->l_idx < nloadedimap->l_ns == nsidimap->l_type == lt_loaded && !imap->l_nodelete_active calling fini: %s [%lu] tmap->l_ns == nsidcannot create scope listdlcloseimap->l_type == lt_loadednsid == LM_ID_BASEimap->l_prev != NULL file=%s [%lu]; destroying link map TLS generation counter wrapped! Please report as described in . shared object not openremove_slotinfo_dl_close_workerFatal error: length accounting in _dl_exception_create_format Fatal error: invalid format in exception string dl-find_object.cns == l->l_nsFatal glibc error: cannot allocate memory for find-object data result->allocated >= sizeremaining_to_add > 0current_seg_index1 > 0remaining_to_add == 0target_seg_index1 == 0_dlfo_mappings_segment_allocate_dl_find_object_update_1_dl_find_object_slowfile too shortcannot read file dataELF file data encoding not little-endianELF file version does not match current oneonly ET_DYN and ET_EXEC can be loadedELF file's phentsize not the expected sizeinvalid ELF headerinternal errornonzero padding in e_identELF file ABI version invalidELF file version ident does not match current oneELF file OS ABI invalid
search path= (%s from file %s) (%s) trying file=%s cannot allocate name recorddl-load.clastp != NULLORIGIN(l)->l_name[0] == '\0' || IS_RTLD (l)cannot create cache for search pathcannot create RUNPATH/RPATH copycannot create search path arraysystem search pathpelem->dirname[0] == '/'l->l_type != lt_loadedcannot stat shared objectcannot create shared object descriptorcannot allocate memory for program headercannot close file descriptorELF load command address/offset not page-alignedobject file has no loadable segmentscannot dynamically load executableobject file has no dynamic sectioncannot dynamically load position-independent executablecannot enable executable stack as shared object requiresshared object cannot be dlopen()edcannot map zero-fill pagesfailed to map segment from shared objectcannot change memory protectionsfile=%s [%lu]; generating link map false && "TLS not initialized in static application"get-dynamic-info.hinfo[DT_PLTREL]->d_un.d_val == DT_REL || info[DT_PLTREL]->d_un.d_val == DT_RELAinfo[DT_RELAENT]->d_un.d_val == sizeof (ElfW(Rela))info[DT_RELENT]->d_un.d_val == sizeof (ElfW(Rel))info[DT_RELRENT]->d_un.d_val == sizeof (ElfW(Relr)) WARNING: Unsupported flag value(s) of 0x%x in DT_FLAGS_1. type != ET_EXEC || l->l_type == lt_executable dynamic: 0x%0*lx base: 0x%0*lx size: 0x%0*Zx entry: 0x%0*lx phdr: 0x%0*lx phnum: %*u libc.so.6r->r_state == RT_ADD file=%s [%lu]; needed by %s [%lu] file=%s [%lu]; dynamically loaded by %s [%lu] nsid >= 0nsid < GL(dl_nns)find library=%s [%lu]; searching wrong ELF class: ELFCLASS64cannot open shared object fileelf_get_dynamic_info_dl_map_object_from_fdELF@ELFadd_name_to_object_dl_map_objectexpand_dynamic_string_token_dl_init_paths/lib//usr/lib/ELF  =???dl-open.cnew_nlist < ns->_ns_global_scope_alloc add %s [%lu] to global scope added <= ns->_ns_global_scope_pending_addsopening file=%s [%lu]; direct_opencount=%u cannot extend global scopeinvalid mode for dlopen()no more namespaces available for dlmopen()invalid target namespace in dlmopen()_dl_debug_update (args.nsid)->r_state == RT_CONSISTENTobject=%s [%lu] scope %u: no scope mode & RTLD_NOLOADmarking %s [%lu] as NODELETE _dl_debug_update (args->nsid)->r_state == RT_CONSISTENTld-linux-armhf.so.3dlopenactivating NODELETE for %s [%lu] cnt + 1 < imap->l_scope_maxcannot allocate address lookup dataTLS generation counter wrapped! Please report this.imap->l_need_tls_init == 0add_to_global_updateupdate_tls_slotinfoupdate_scopesdl_open_worker_begin_dl_open_dl_find_dso_for_object/proc/self/exe../sysdeps/unix/sysv/linux/dl-origin.clinkval[0] == '/'_dl_get_origindl-printf.cpid >= 0 && sizeof (pid_t) <= 4niov < NIOVMAX! "invalid format specifier"_dl_debug_vdprintfcould not map page for fixup../sysdeps/arm/dl-machine.hfix_offset == 0R_ARM_PC24 relocation out of rangecannot allocate memory in static TLS block (lazy)cannot make segment writable for relocationcannot restore segment prot after reloc relocation processing: %s%s %s: Symbol `%s' has different size in shared object, consider re-linking %s: out of memory to store relocation results for %s cannot apply additional memory protection after relocationrelocate_pc24unexpected reloc type 0xunexpected PLT reloc type 0xdl-setup_hash.c(bitmask_nwords & (bitmask_nwords - 1)) == 0_dl_setup_hashdl-sort-maps.crpo_head == rpomaps_head == mapsi < nmaps_dl_sort_maps_dfsFailed loading %lu audit modules, %lu are supported. dl-tls.cresult <= GL(dl_tls_max_dtv_idx) + 1result == GL(dl_tls_max_dtv_idx) + 1cannot allocate memory for thread-local data: ABORT listp->slotinfo[cnt].gen <= GL(dl_tls_generation)map->l_tls_modid == total + cntmap->l_tls_blocksize >= map->l_tls_initimage_sizelistp != NULLidx == 0cannot create TLS data structures_dl_add_to_slotinfo_dl_allocate_tls_init_dl_assign_tls_modidunsupported version %s of Verneed recorddl-version.cneeded != NULLchecking for version `%s' in file %s [%lu] required by file %s [%lu] no version information available (required by %s)def_offset != 0unsupported version %s of Verdef recordweak version `%s' not found (required by %s)version lookup errorGLIBC_ABI_DT_RELRcannot allocate version reference tablelibc.so.DT_RELR without GLIBC_ABI_DT_RELR dependencymatch_symbol_dl_check_map_versions/etc/ld.so.cache search cache=%s glibc-ld.so.cache1.1ld.so-1.7.0dl-cache.c_dl_load_cache_lookup/etc/suid-debugfailed to allocate memory to process tunables GLIBC_TUNABLES%d (min: %d, max: %d) 0x%lx (min: 0x%lx, max: 0x%lx) 0x%Zx (min: 0x%Zx, max: 0x%Zx) error while loading shared libraries%s: %s: %s%s%s%s%s DYNAMIC LINKER BUG!!!GLIBC_PRIVATELD_WARNsetup-vdso.hph->p_type != PT_TLS__vdso_clock_gettime__vdso_clock_gettime64__vdso_gettimeofdayLD_BIND_NOWLD_BIND_NOTLD_DYNAMIC_WEAKLD_PROFILE_OUTPUTLINUX_2.6setup_vdsoGCONV_PATHGETCONF_DIRHOSTALIASESLD_AUDITLD_DEBUGLD_DEBUG_OUTPUTLD_DYNAMIC_WEAKLD_HWCAP_MASKLD_LIBRARY_PATHLD_ORIGIN_PATHLD_PRELOADLD_PROFILELD_SHOW_AUXVLOCALDOMAINLOCPATHMALLOC_TRACENIS_PATHNLSPATHRESOLV_HOST_CONFRES_OPTIONSTMPDIRTZDIR/var/tmp/var/profileswphalfthumb26bitfastmultfpavfpedspjavaiwmmxtcrunchthumbeeneonvfpv3vfpv3d16tlsvfpv4idivaidivtvfpd32lpaeevtstrmaespmullsha1sha2crc32RTLD_NEXT used in code not dynamically loaded_rtld_global_rortld_static_init.c__rtld_static_init023456789?upperloweralphadigitxdigitspaceprintgraphblankcntrlpunctalnumtouppertolower8HHHHHI( (xx>>~~~~     !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~     `     ` (C)<<-(R)u,>> 1/4 1/2 3/4 AExssaeIJij'nOEoesLJLjljNJNjnjDZDzdz'^'`_:~HhSSss##`Wwisss?J``A;EIIOYOIAVGDEZITHIKLMNXOPRSTYFCHPSOIYaeiiyavgdezithiklmnxoprsstyfchpsoiyoyo&bthY`Y`Y`fp&Qq66Ww9090900900SHshFfKHkhHhDJdjGJgjTItikrsjTHeeSHshSSsrSSSYODJG`YEZ`IYIJL`N`TSHK`U`DHABVGDEZHZIJKLMNOPRSTUFXCZCHSHSHHA`Y``E`YUYAabvgdezhzijklmnoprstufxczchshshh``y``e`yuyayodjg`yez`iyijl`n`tshk`u`dhO`o`FHfhYHyhE`e`G`g`GHghGHghZH`zh`K`k`K`k`N`n`NGngP`p`O`o`C`C`T`t`UuH`h`TCZtczSH`sh`CH`ch`CH`ch`iZH`zh`CH`ch`A`a`A`a`E`e`A`a`ZH`zh`Z`z`Z`z`I`i`O`o`O`o`U`u`U`u`CH`ch`Y`y`'" -------'','"",,"+o...... ``````<>!!/???!!? C=RsEURINRa/ca/sCc/oc/ugHHHhIILlNNoPQRRRTEL(TM)ZOhmZBCeeEFMoiDdeij 1/3 2/3 1/5 2/5 3/5 4/5 1/6 5/6 1/8 3/8 5/8 7/8 1/IIIIIIIVVVIVIIVIIIIXXXIXIILCDMiiiiiiivvviviiviiiixxxixiilcdm<--><-><==><=>-/\*|:~<=>=<<>><<<>>>NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUSSPDEL_NL(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(0)-|+++++++++o::====== =(21)(22)(23)(24)(25)(26)(27)(28)(29)(30)(31)(32)(33)(34)(35)(36)(37)(38)(39)(40)(41)(42)(43)(44)(45)(46)(47)(48)(49)(50)hPadaAUbaroVpcpAnAuAmAkAKBMBGBcalkcalpFnFuFugmgkgHzkHzMHzGHzTHzulmldlklfmnmummmcmkmmm^2cm^2m^2km^2mm^3cm^3m^3km^3m/sm/s^2PakPaMPaGParadrad/srad/s^2psnsusmspVnVuVmVkVMVpWnWuWmWkWMWa.m.BqcccdC/kgCo.dBGyhaHPinKKKMktlmlnloglxmbmilmolPHp.m.PPMPRsrSvWbfffiflffifflst+___,.;:?!(){}#&*+-<>=\$%@!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefgijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzACDGJKNOPQSTUVWXYZabcdfhijkmnpqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABDEFGJKLMNOPQSTUVWXYabcdefghijklmnopqrstuvwxyzABDEFGIJKLMOSTUVWXYabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567890123456789012345678901234567890123456789 %,37:>BFJNRVY]aeimquy}  $(+.147:=@CFILORUY\_behknqtwz}  $'*.258;>ADGKOSW[^beimrvz~  #&),048=AEHLPTX\`dhkorvz   %*/49>CFKPUZ^bfjnrvz   #',/26;>AEHLPTWY[]_cglqv{~#*18?FMRUY^beintx{  !&+05:?CGKOSW[_dinsx} #).38=BGLQV\bhntz     % * / 4 9 > C H M R W \ a f k p u z        $ ) . 3 8 = B G L Q V [ ` e j o t y ~     " ( . 4 : @ F L R X ^ d j o s w |      $ * / 5 : A E J O T Y ` i m q u y }      $ ( , 0 5 : > A C E G I K M O Q S U W Y [ ] _ a d g j m p s v y |    #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~23IRSpqrstuvwz{|}~     !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOQRSTUVWXYZ[\^_jkrstu                    " $ % & / 5 6 7 9 : < D G H I _ ` a b c !!!!! ! ! ! !!!!!!!!!!!!!!!"!$!&!(!,!-!.!/!0!1!3!4!9!E!F!G!H!I!S!T!U!V!W!X!Y!Z![!\!]!^!_!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!!!!!!!""""#"6"<"d"e"j"k"""$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$#$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%%$%,%4%<%%t*u*v*00Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2222222222222222q3r3s3t3u3v333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333) MNOPRTUVWYZ[\_`abcdefhijk  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~    !"#$%&'()*+,-./0123456789;<=>@ABCDFJKLMNOPRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~              " $ & ( * , . 0 2 4 6 8 : < > @ B D F H J L N P R T V X Z \ ^ ` b d f h j l n p r t v x z | ~ ^[yY]^[nN]SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecember%a %b %e %H:%M:%S %Y%a %b %e %H:%M:%S %Z %YSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%a %b %e %H:%M:%S %Z %Y%p%t%g%t%m%t%f%a%N%f%N%d%N%b%N%s %h %e %r%N%C-%z %T%N%c%N+%c %a %lISO/IEC 14652 i18n FDCC-setISO/IEC JTC1/SC22/WG20 - internationalizationC/o Keld Simonsen, Skt. Jorgens Alle 8, DK-1615 Kobenhavn VKeld Simonsenkeld@dkuug.dk+45 3122-6543+45 3325-6543ISO1997-12-20i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999i18n:1999  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~strtod_l.cdigcnt > 0*nsize < MPNSIZEdecimal_len > 0lead_zero == 0 && int_no <= (uintmax_t) INTMAX_MAX / 4lead_zero == 0 && int_no <= (uintmax_t) INTMAX_MAXdig_no >= int_nolead_zero <= (base == 16 ? ((uintmax_t) exponent - (uintmax_t) INTMAX_MIN) / 4 : ((uintmax_t) exponent - (uintmax_t) INTMAX_MIN))bits != 0int_no <= (uintmax_t) (exponent < 0 ? (INTMAX_MAX - bits + 1) / 4 : (INTMAX_MAX - exponent - bits + 1) / 4)numsize < RETURN_LIMB_SIZEdig_no > int_no && exponent <= 0 && exponent >= MIN_10_EXP - (DIG + 2)int_no > 0 && exponent == 0int_no == 0 && *startp != L_('0')need_frac_digits > 0numsize == 1 && n < dempty == 1numsize == densizecy != 0str_to_mpn____strtod_l_internal____strtof_l_internalrshift.cusize != 0 && cnt != 0__mpn_rshift d'@Bʚ;  62kg /SPL8mJ G d'o#ſt[Am-jd8n헧?O>. 8/t#ڰͼ3&N|.[Ӿr؇/PkpnJؕnq&fƭ$6ZB<TcsUe(U܀n_SlgrwFo]:FGWvyuD;s(!>p%"/.Q]OᖬW2Sq$^c_䭫*sf\wI[iCsFEHis 84c)r+[[!|nN5 }L,D4fl}C}Ο+#U>#`e!Q4\Ycɟ+1*ZibBtz["؊4س?ŏmk1Ke6ukG܉ـ( f13j~{j6h߸extra == 0*decimal != '\0' && decimalwc != L'\0'__printf_fphex%.*s/%.*sXXXXXXabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789(nil)(null)       Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorNo such device or addressArgument list too longExec format errorBad file descriptorNo child processesResource temporarily unavailableCannot allocate memoryPermission deniedBad addressBlock device requiredDevice or resource busyFile existsInvalid cross-device linkNo such deviceNot a directoryIs a directoryToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainNumerical result out of rangeResource deadlock avoidedFile name too longNo locks availableFunction not implementedDirectory not emptyToo many levels of symbolic linksNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedInvalid exchangeInvalid request descriptorExchange fullNo anodeInvalid request codeInvalid slotBad font file formatDevice not a streamNo data availableTimer expiredOut of streams resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorMultihop attemptedRFS specific errorBad messageValue too large for defined data typeName not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in too many shared librariesCannot exec a shared library directlyInvalid or incomplete multibyte or wide characterInterrupted system call should be restartedStreams pipe errorToo many usersSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocolAddress already in useCannot assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableTransport endpoint is already connectedTransport endpoint is not connectedCannot send after transport endpoint shutdownToo many references: cannot spliceConnection timed outConnection refusedHost is downNo route to hostOperation already in progressOperation now in progressStale file handleStructure needs cleaningNot a XENIX named type fileNo XENIX semaphores availableIs a named type fileRemote I/O errorDisk quota exceededNo medium foundWrong medium typeOperation canceledRequired key not availableKey has expiredKey has been revokedKey was rejected by serviceOwner diedState not recoverableOperation not possible due to RF-killMemory page has hardware error 0000000000000000unsupported dlinfo requestinvalid namespaceFATAL: exception not rethrown Fatal glibc error: array index %zu not less than array length %zu Fatal glibc error: invalid allocation buffer of size %zu %.3s %.3s%3d %.2d:%.2d:%.2d %d ;Zx0Nm<[y1Onstdinstdoutstderr(unreachable)/dev/pts/fd_to_filename.cdescriptor >= 0__fd_to_filenamegethostbyaddr_rgethostbyname_rgetservbyport_rndots:timeout:attempts:/etc/resolv.confnameserversortlistRES_OPTIONSrotate@edns0single-request-reopen@single-request no_tld_query no-tld-query no-reload use-vctrust-adno-aaaaresolv_conf.cconf->__refcount > 0init->nameserver_list[i]->sa_family == AF_INET6conf == ptr!alloc_buffer_has_failed (&buffer)global_copy->free_list_start == 0 || global_copy->free_list_start & 1conf->nameserver_list[i]->sa_family == AF_INET6resolv_conf_matches (resp, conf)update_from_conf__resolv_conf_attach__resolv_conf_allocateresolv_conf_get_1conf_decrement__resolv_conf_get_currentnss_parse_line_result.cparse_line_result >= -1 && parse_line_result <= 1__nss_parse_line_resultSUCCESSUNAVAILNOTFOUNDTRYAGAINCONTINUE__libc_early_initdl-call-libc-early-init.c_dl_call_libc_early_initcannot allocate dependency bufferDST not allowed in SUID/SGID programsdl-deps.ccannot load auxiliary `%s' because of empty dynamic string token substitution empty dynamic string token substitutionload auxiliary object=%s requested by file=%s cannot allocate dependency listmap->l_searchlist.r_list == NULLcannot allocate symbol search listmap_index < nlist_dl_map_object_depsdl-init.cl->l_real->l_relocated || l->l_real->l_type == lt_executable calling init: %s calling preinit: %s call_initdl-lookup.cversion->filename == NULL || ! _dl_name_match_p (version->filename, map)symbol=%s; lookup in file=%s [%lu] warning: copy relocation against non-copyable protected symbol `%s' in `%s' warning: direct reference to protected function `%s' in `%s' may break pointer equality error due to GNU_PROPERTY_1_NEEDED_INDIRECT_EXTERN_ACCESSmarking %s [%lu] as NODELETE due to unique symbol , version version == NULL || !(flags & DL_LOOKUP_RETURN_NEWEST)undefined symbol: %s%s%ssymbol lookup errormarking %s [%lu] as NODELETE due to reference from main program marking %s [%lu] as NODELETE due to reference from %s [%lu] marking %s [%lu] as NODELETE due to memory allocation failure file=%s [%lu]; needed by %s [%lu] (relocation dependency) binding file %s [%lu] to %s [%lu]: %s symbol `%s' [%s] check_match_dl_lookup_symbol_xdl-minimal-malloc.cptr == alloc_last_block__minimal_realloc%s: cannot open file: %s %s: cannot stat file: %s %s: cannot create file: %s %s: cannot map file: %s .profile%s: file is no correct profile data file for `%s' Out of memory while initializing profiler dl-runtime.cELFW(R_TYPE)(reloc->r_info) == ELF_MACHINE_JMP_SLOT_dl_profile_fixup0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzSTKFLTFloating point exceptionStack faultChild exitedWindow changedPower failurenss_dns/dns-host.cptrlist_size (&aliases) >= 1%u.%u.%u.%u.in-addr.arpaip6.arpagethostbyname3_context0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpaHOSTALIASESres_query.cquery2 == NULLanswerp == NULL || (void *) *answerp == (void *) answer(hp != NULL) && (hp2 != NULL)__res_context_queryres_send.canscp != NULL || ansp2 == NULLsend_dgsend_vcres_get_nsaddr.cn < statp->nscount__res_get_nsaddr;> >>%>3>>>>> >$>>'>>> > >CCdD@hp0Llt  (D| ', @H`HH8;0@<     (   LLļ @(*K*K+J++K+K,<,K--K.<.K./K/K/T0K02K2K33K34K4K4K45L5L56L67L77L7@8L8<L<?L@@L@@0LAALABLBDLD ELEELEELEELFLF FLGGLGLH8 @DHdD T,`h >??@ AABBCDEEFFIJ`KKKK8KL0LLLMTMMDNN8OÒOOPPPPЀQRRԀRRSThUUUUgh<hhii<jj@kk tuuvuvHvvy8!@D\ @Xl @XT\8\\\\Ȃ\\\t\X\<\ \\\́\\\x\\\@\$\\\Ѐ\\\|\`\D\(\ \\\\ 8h`x\d 8h`xH 8h`x, 8h`x 8h`x~ 8h`x~ 8h`x~ 8h`x~ 8h`x~ 8h`xh~ 8h`xL~ 8h`x0~ 8h`x~ 8h`x}\} 8h`x} 8h`x} @l}  T |       T |[p[48DHLP8L[48DHLP8([P [ (0Z0LT\pttZ,(|  Z|Z 8ThhEPZX$ZGZG,4Y DHY<4h@YlxY@dtDC\Y!@\,Y@ Y ,DX hX <0XHHXGA0}ԬPXE9h T|}X,PW@XdW <@W <W>lDhW4LWG <4W?UJ, h  d8V(|VV,$tV4DXV  \X@V(P4V h,8U(U (xU(@UtUG dTU (D8U @ 55#6##6#6$6$6$6$%6%&6''6'(6((+*6*T++T,6,-6-060lT@DPT\4T\T @lT HpS 4dS 8tS <,ES |`S,@SLP$S<(S<HRI6H<H10R!8L,lR,LRD,R R -$Q X<dK?I<      }K48DHLP8xKt \K,LPHK,d hK1'D8}DJ0P|J $|J-"4\l}XJHL8J 4DJlIFXt(&&&&L&&D$(&&%\T!! t"#"P##D#$%%%&&I %DD$8H"6HH4 `hpH(LH((H(Hl`PGGG |G(XG0 8p>? >"H L  @>Ttd>h  H>Ld ,>@L> D=,="$H   =8(=?JL    0=+     << )@H<(<`Hx<XtT</Xh4<W < Plt Hx    L ?*L(D              T " ,p,x 0HX`pX 0HX`p8 0HX`p 0HX`p F, @      t  HTp\t TL T$ "X  <X` <X`  X  Xx  08@` <8  08@ < H,L H,L0X Dhll Lt|T * 4DptDl0Lx! T}|lA4<P`}[ $ HhL8 L0HX`p0HX`p-$8Dx PHP D( 8dtTlW0,< (,dhp*LdH@l,$PXhPP \H4 >p,H\`HD : TDltl H $0?"A5D<l      }HU !h}U'!H8}T?D     d  d, 8Gdpd0?mc(|$  ,   T}S01'Dp`}S\5)8d }S%H`(,t($L8?NX\H$  d @L 4 t  0@X` 0pD 0  ` ,L,D DPT\X 30((<}HT4X  L`$@Tl\ +<8|$$4@dP p8< $LTMC@POL(, 0@T$4 ((Xh<07D|h QFX( dN(#<<l  M@H\ h }N Pd$0`?"T,(d81040(<  H()1<4`,,$$<h?DTp<  \th@I|\X l<0,p :a8   @l 4|?5@   L , 8 (Tl|+$@p<0?>qg4`4  L  }I` !,p,0HX`p Tt(HHxdH -%(p(H\YM0 D              }{\H!"l?9!@XXx3h88X R 0         X  0HX`p0HX`p"(@l ,ldX @@%t    8\0G   <((8 @DHXD\ 8h`x(tD$P(4t$PT\hTX < @lpp8, LP4, LP4 hlt|l0PH\,)l t T pt<  `$hxT $,. DT0HTHTl0tH ,P|, ,<  ,<| ,P\tXE*4(dd0L0HPp% 4`\tD@9.X}?\#x "L,"" "    ,# D( "l!\(D< h|}{C@XT ,<LPT<?.uk          | P      P  `48 ,\(X}X?< <dlDL LlLtL4\$Mɡp0 2H2&&-H-H&.H/&02) $ Tp04 L54    ` F (L*(p$0HL@ P(,| 8<Dx<`0HX`p@  (86DH  ` \PT,$ll,h$|xH,hp4d <P\Xl DJ 8tHP(9/,4}D:'(4l,$$ $|`  ,tD $p$0 4l$ +,P8\T lx;,t,  8p#  $,4L\t  ,!T,D@`x}:h7 DPdt4$$0p@,|  x x| d X`x0<\t0 t4 d lP\t`xd\tp\|Td|$8\t$ L(x T0 T0 L(x T0x$x$l , D\ <(`0#  0HX`p0HX`p0HX`pt0HX`pT0HX`p40HX`p0HX`p0HX`p0HX`p0HX`p0HX`pt0HX`pT0HX`p40HX`p0HX`p0HX`p $4@@     @    @@ <X`<X`<X`<X`p<X`\ 08@D 08@, 08@ 08@ 08@< H,L Xx<P H,L4 X < H,L X<x H,L\ X4<  H,L X ( ,x  8 dpt l|$D,@LTdp(4HT\lx  P,D$0 $((<t Xd,(<$d 8p\t\0d88$ptH8400     H ,ThT("$d-(p8,T"$$p(eZ0 L   P(       }- TD  $DT?z$, 8D       @   H   (    D$m,|<    |<8%<(H T HP,! (8(hx (<  L 8L\@x9PTt($x,-lP@@t,?x ?.PH    ` L l 3(Hhh  '(X0 @PTdEx#L `P\x4PȲ0`0h0l0@d:$ Dl(D@0` 0`4D$ LP|0`!<dD 40hp,0D\!Dd&8Tt4 hd 8t,<lLxLXL(-$,@p <|  Tx`(Td4  ,E<,XL  7 phtdG   @----------0--D-.-."."p#($$$8$$%0%%&.&&.&`'.'.($.(.()T)) *.**.* @DHXDp XX.%D $  ( ,<hp-#H}L"  @X\d`d} L0p,,HP$ CG,td( %4\8$dL|@HL8h,,h!($( $h09-$H(}), Xh8H!& Xh$8H0?J`|h   $ ,|t\iVT`T@$4,}Pl "( $)8<<p  $Ph`0HX`p@8   '84<$p@  P |P |X,@, P2P4hT  ,  , Td 4PL(8P8$  $$X\d  4|< \D\d&oX8|H@4 , 8LX@`BBCD(FF<BLIpJ@KKhM O8h>><(??L@8,AX BxPBCTCD |D Fț\HI pI KěPM$NNNNO ODOOPPQ$RhV?[h[l\(`l``aPh`kdno0dpHq`stuuupXvvtwwx y {|~pāl HЗИ8L Ģld\츨عлԻXx`d¨Ĩ,ƨƨlǨ̜Ǩ؜(ɨTʨtʨʨ˨˨̨ ΨϨ8ШШ4Ѩ<ѨѨѨѨ0ҨҨdtӨ|@ըըըը(֨`֨l֨֨``ר(بxبب@٨٨Hڨڨڨۨ@ܨݨݨި"Xߨߨ$`\(dD,L  $D($HhHxL  t TX  <P@ ( t DT ((PG   <'''((,*,./0D2(3@DDFG$GPGG IDKKK!`LLL\MMDNNOPQQ,QQ!R)S?pTHUHV>W*HY?TZ,[[x\\<]__H``g(xyPy`zz}|}7}$Ldx$؄PxlĊĊ(ԍ̏pēДp蕩D4h 8૩  \l$,$8 ԺԺػܻD8` Xĩ? ũ$ǩ? ȩ? ʩ̩tΩҩ\өtԩԩթ8թթ ֩֩ש(ששةܘ\٩ݩ `ީ? Ԙh(t TT`   dh\d \ \ $0`DDt$ G x H8h  H%%P&&h') *`*+,D--0.. 1023x770::h=>d?ab>@BxCGDFxFFGGIIDMPHQxQQQRRlSSThUdVVVWW X>X??(\@ @ @C8D E G<HTIlIJJKDLL(MMNtN|N OXOpOPLPPQRR8TTUUVHVVWWW YP|Zdp[T\\@]^l``"adThhtpę$rvXxxyy{8{{{|ؙ}Ԁ<$|$pXؙH썭0\`( d虭ԚЛȜ<`t0Hܬpl|ľ­í`ííííGɭ4̭̭ ͭ4XЭ`ЭЭѭҭ8ح  4($+|++,,,,--..x/00t11@22H6l99$:::D; <<>,???4@p@@|CD$D DEFFTWX\XYlYYlZȚ[ؚ\]_@`$da8bLc`dteg4>?@tA (BCCCCC0EEDFTGdMĞPȞ`QԞQTTT4^Ԟ_b0dHdLpe`g gt@h\ikkk"mDpxw0z<|}}L䂯,x؄ą؆Ԇ h `x @tēȟLؖğlؚGܜğd؟G(䥯d8P쩯|Ȯ8HT\豯xp쳯thļ<8ؾ8D|̿h4dH¯ïԠį$ůů<ƯƯ$Lǯ0ǯx˯8̯P̯hXͯͯί0ԯկկկT֯t̡֯֯֯HׯׯСدlدԡد,ٯء گگۯ8ܯHܯhݯxݯޯޯ߯ D $ 8   `x( tDd|40$$XĢ,\P`P? 0 X  l 0   |T4|<` P\!h"x$&))أ|+.D/T/d1124343t4Ԥ44556t7ؤ899:::: <d<l>Ȥ?\BC0FMN8PTPP@Q @RRS U dWX|XY ZZ$|\G^^_<_l_``Daa$bbbc8d\dtd\eee|fȤ\i kl Dm(v|vwxdyyzz{\{}~G (T إ॰L|ԧ訰 PФP Ф\l̤Ф̱@t,,4@ Tt°ĥưʰp̰ͰͰ<pӰӰ`ְ۰ܰ0`x 7X0dTd\lx\߄<d((<8T߄D߄00<,  P 8    p4tl  h `(H$,>><4?P@ @\R SSTTUtV`VtXDYYL\ jPjjtk4mlppq0q hr ss,tt,uuuvvv0w8whwȦH{{|(T ,4hȋP DH$@dD tГpܖH虱lthG蠱0T4tԥܥ䧱 "X Tز@,@නPܼ±±XññııDű$ƱDZ`ldD@D@0p,0 $$$X  `8p,D 0 Ԩ <l(P$<Dxp<  !!,"""##L$P%&&&(6V WPWWXXYYZZ<[P[[0\h\ll_G|aTceG@gh(kmnopq,rrsttuu\vxvvxxxyyzz 4|p~ HȨ(D4䌲|<ĩL,ܔGlܘ DĚTȩȫ쫲l t,  ܻ$x4L²`<IJDzDzhɲɲ˲\̲ Ͳ`βlϲPҲӲ`pԲ ղղղtײײ,زTزXزGܲ8P,<8t\t(  @ Ԫd    8$<Xtܪ8\تܪ|?@Ĭ$BLBBBpCEFHܬIQTUVh?4@@,ACDDDFFGKKxM,OGSSUU,V<VLV\xW|WdXxZ]`ԯa0bc$fd4hhhi\iijldlhmnnn!o@pp4qp> ? ???t@t@@hAhABBBB`H H8KMOPU̠WDXXY(YlYYYZ^7|^^^T__``@`aagn@XLLpMĦ [ b̧cfܧdgh h$Di<sdttvPvlxvvhx(yHzp{{{Ш{D|d|||8}}}\~<ܨ`  ,d<$  Ll Ԇ PP8 D x葽<ؒ약ؙ0Xhܜ$T@Hأ8G<D0@(07Эܭpp L|dԳ賽pxtdȻh½d½̨ĽdŽƽƽpʽ0˽D<ͽXͽννlνDϽϽϽHѽѽ8ӽTԽ\ԽԽԽԽսս0ֽPֽ,׽<׽׽׽׽׽Xؽؽ ٽ4ٽlڽڽڽ\۽۽lܽ(TP<Hh$lt@D,h(dh8Ч     `  (8P,P4@,Td#%̨&2<4\L?̩ CE8TFL4Gd0H|PQRRSSTTVVdWXxLY 0ZZ([[ \`]pH^l__abDcefXggitjjk0Tmm@nTqqdsstssluv x{||T}}̪x~|"\ȁlX Ԅ@Ċ`d PČH؎8h,dȔؔxT|T<$`$\,|h<<? p`̵l 仾8̽ <|п 00xlľ40žDǾ|,ʾtھ۾L޾,޾\޾ ߾P(߾\߾TG4( x D"""$% &&& '4((D)))0*X/X///0d12|059 ;;F\HH N\(PxR$S[]D^8^P`Tb(>>(t@@ԱBG,IKPMOQQ\RXR SDTTTTdUU<`VVHWXXdZ|p[[[T^`Բdeg$ijk kdkklDmmmn0npoop$pppq8qHqIJT>Ի?0?$BBEȻPFhFĻdHHлIIXJܻ KxKLL0MLN\NNPOOȻRܻPVtVVVYZY Z$[8\]^d_dbcdTe`f4h\>|>G@xAABlBBC0DDEE,F8FpFGHHHIJJKXOQ@S̿VWXX8ZTZ[\0^Dbc,uu(pv@xxxLxxyyy0zD~`lȀ,H8̄ $$Ld ܆؈dȊЊ (,0H\Hp@̙ě؞h\t<\<T$`x|T4@pH\Խ`x$lD\<0\ dP\4DP<\tlhxt`P $hPTXd p$lt( @3 56  GtG8GHI II 8J%@K$DLMM(NNO,OOPQ0RSTT U `VVVxWtWXW`(\dd\4ft$g@ixiijjkk@kkkpl m(mtmswT<<H̄P\HȔ(H<00<PԪ<0п 4dP <,<L(\lp|\Ht,T@,<D(0H\Dt<L$ hDX p,t ($@@D$ D\4Xh|<8dL  , ,   d \080LDdl"%''(d++,,,-./04(779@=H,B|BCHIIxJJJ M(Tx U$Z4[T[d[x\X]^____>>??@$@@AABBXChCD,DDDEEFFTGlGH HHHIIdJtJ4KDK,L@MMMNOO=P|QQS TT$ULUh>>>G@@AC\CpCCPEEHHIIpJ8KKKL$LxLMTNOOQQQRlHSSSx@TU 4XXp\YY$ZZ_`__(`h`н``ؽa8a#bb@bPbbxccd|ddd|LeXe|eehffHghhi`i@,kkl(lHlPmmmDHn|no qxqqdrrPw,w0xx4yyyyy|z${$l{{|}0 xȄ$Hp؍DD ؔ@`(`̘ܼdԛ؜ \ȼļ` ԡD@(DؤХ? H8 dP$hxp0 t pķ$  ȼܿ ( ,@lT4hx|04ļDȼ̼мl0`t$LP|Xd|$ Լp<ȼ  < dpؼPpD <@ """#$%&&'h4)4*|++T-./h/1,22 <33T7X8l:AAC̼GJhLM,UVTbc4h"oprs }h}}~<4\ȂHL @H| t \Լ4̔tȼ xļĮ   `$$TDh4L$$Xl|DtT @<@<<,(<<T  $|D@ DP   h<xhlPTd$HXt@ 8 ($48\ 0$ t,pPl   $!X!X!!"$#,## d$$,%`&'((,(4((()P)t) P**+4,--.,X3T4X99к:<ܺ>t?BHJ\JKlKK`LLM $N$4PXPpP$Q,QDRXSOdhOpOO>RRRPSSLTUV0WWD[[[L\\ ] ^^D_h__4`adahbbc,d(e,ee,e0f4ggh(dhhjk`lmXmm (nLn|op8qrrttuvdv,w`xx xxLyLzz{~p<|LTXԌ8T8L0@LxL؝x|ܟ<`ĥ\̺Lܬܮ pа̱4lL̷0ԺȺ|H4 L   TH,4غt 4D@LT`Tl4 \pԽLļм,dHhp\H| Tl XXpP!!4"#\#$L%xX%%%0&&'H''@(\)+t,-$..//3 5,7>? @@<@@@@XAAAAB\BBBB8CDDDDDEE POGGG}XmPS!gY@TSSSSSSS TZ;RH#uY TS@UMKUZ;RSSSHSOXS#uYSSSWS[S_ScSgSkSoSsSwS{SSSSSSS S%S*S0S6S6S6S6S?SESKSQS6S6S6S6SGSGS@PS@SS S S S 0S @S SSS"S`)Sp>SFSSfS@ySSPSS@SSSSGS@FS@@3S@@@FS@@YS@@lS@AS@@AS@AS@AS@BS@@BS@BS@BS@CS@@C*S@C=S@CPS@cS@tS@GS@DS@ES@FS@S@S@S@S@S@S@R3S@ZPS@VmS@PS@XS@S@S@T@T@ /T@(DT@0YT@8nT@HT@`T@hT@pT@xT@"T@AT@`T@{T@T@T@T@T@T@T@yS@ T@2TySSSSY@ tTP tTuTNuTuTuT vT %vTPFvT@yvTvTvTvT-wTjwT!gYSSSU SfUS!gYSSSTSSLQGGS> PGGG}Xf TXHHV@@T@@@@T@@@lT@@@@T@@̨T@@@T@ @8T@@ @^T@0@T@@0@T@@T@@@TS/SSS@SS@"S2S@`LS`XSjSpwS@S SO@S@@S@S@SS@S@S@S@S@3S@LS@oS@S@S@S@S@S@,S@HS@dS@SLSSSSS"SAS`S@fSDeSpkStS@QS@ASPS@S`SSSS0pSS p4$HSSSSSS.S/9SASXSoSSSSSSSSS;SQSPcSO~SSSSS/ S?#SOT SVT S@nT@ T@@T@T@ T@@ T+Tn`9Tp@@T@IT@0gTpT `S@fSDeSPpT tS@QT@ATPT@T`T TTpT`T 0T00yS00T8T@KT0^TPptTp`T -$H T T T T "T ET p4$H  S  S  S  S T?hT {T ?T T TTpTPTPpCTpT 9 T [ T0 | Tp  T  TP  TTT0T0T0 T00/ Tp0O T0q TP0 Tp T TP TP TP3 T0PS Tpr Tp T0p Tpp Tp TPp T`8 T`Z T0`{ Tp` T` TP` TpP TP TPP? T0^ Ts T T P Tp Tp Tp Tp  Tp0 TpH Tph Tp  Tp Tp Tp Tp  TpTp2TpPTp oTpTpTpTp TpTpTp<Tp [TpzTpTpTp TpTp6Tp`Tp TpTpTpTp 'TpPTppTpTp TpTp Tp6Tp aTpTpTpTp T&TDTRTPuTT@TPTP@TPNTPqTPTM_TTpTPp;T0hTT@TTTTp<TPpiT0T /Tp TT0/ToT T TPp3T:TcTTT T T@0T@\T@T@T`T`T` T`@T `T TPTP@TP TP`T-T@PFTP[T@PFTP[T@P FTP [T@PoT@PoT@PTPTPPySPPTPySPTTTT T T T@0T@0T@PT`pT`pT`TTTTTTT0T0TPTpTpTT T  T TTTT0T0T0T@/T@/T@CT`WT`WT`kTTTTT T` T ` T@` T` 5T`` OTfTfTTTTTySTPP T0p TP #T- 5T- 5T- 5T- 5T- 5T - 5T@- 5T- 5T- 5T- 5T- 5T- 5T- 5T - 5T@- 5T- 5T- JTTTpTTTTTT T@TTTTTTT T@TTTTT T T  TySM13 T 1P: T @1P[ TQz TQ TP T@p T`p!T@P*!TGppL!THPQj!TQ!T @ Q!T@Q!T @"T@>"T @ Qb"T @0p"T@Q"T@p"TW#TR=#T0Qa#TPQ#T`p#T m@Q#TnQ$T@M$Tq$T p@ Q!$T 1P$T @1P$T Q%T Q3%T PX%T@p}%T`p%T@P%T _%TPQ&T @1p-&T P QW&T P Q&T @1p&T@Q&T@p 'T@Q:'T@pk'T q0P'T'T _%T@Q'T 6P (T 7@QA(T 8?_(T 8?~(T 9@Q(Tin~(Tj`p(ToQ)Tk`pW)Tln~)T_)T)T*P)T+P&*T,@W*T-*T.*T/*T X+T!X-+T"I+T#c+T$~+T@Q+T3+T PQ+T ?,T @,T a,T,T,TPQ,T3,T P Q-T ?L-T p-T -T-T-T@p-TUQ'.TUQ`.TSQ.TTQ.TSQ.TTQ/TV@pF/T\Qu/TZQ/TXQ/TYQ0T ; C0T ; _0T < {0TDP0TwP0TxP0T~P#1TPS1TP1TP1TP1TBpyS=P  2T=P 2T?)2T?]2T@2T@2T A 2T@%3TJ@W3TK13T I@ 3T P Q3T `1p3TP Q4T`pI4TQv4TQ4TLQ4TM1Q 5TBp:5TCX5T s5T5TFP0Q5TEP Q5T>P Q6TN0Q$6TM1U6T1Q]6T@6TPQ6T`p6TO`0p7TP3C7TQ1l7T]Q7T^Q7T_`p8T`@p18Ta`pc8Tb@p8TcQ8TdQ8Te@ Q39Tf@ Qe9Tg`p9Th`p9T9TrPQ:Ts3P:TtAu:Tu:Tv1:TyPQ;Tz@2;T{e;TPQ;T`p;T@;TTU>T_>T_>T>T>T0P>T1P)?T2@PX?T3?T4?T5?T%X@T&X+@T'E@T(^@T)x@T @ Q@T @0p@T@Q@T@pAT/P?DAT-P_ATP?AT PATP?AT-QAT-PAT?Q?BT?P?3BT/Q?GBT/P?dBT QxBT PBTQ?BTP?BTQ?BTP?CTPCTP?CT_cCT_vCTPCTPCTPCTPCTP DT@@P%DT@%DT@ pVDT@0 psDT@ pDT@0 pDT@ pDT@ pDT@ ET@ &ET@ MET@P sET@@P ETETET ET  %FT OFT  0yFT FT FT@ PFT@#GT0GGT0uGT@ PGTP PGT@ PGT $HT MHT zHT HT  HT IT  1ITaIT@~ITITITITITJT@ ;JT@ _JT@ JT@JT@JT@JT@JT@@"KT@JKT@qKT@KT@KT KT@LT ELT@kLT@LT@LT@LT@MT@'MT@MMT@sMT@MT@MT@ MT@ NT@ ;NT@ iNT@ NT@ NT@ NT@OT@DOT@oOT OT@ POT@ P PT@ P5PT@ 0P_PT@ PPT@ PPT@ PPTQT >QT jQT 0QT@QT@QT@ RT@04RT@ZRT@RT@ RT@0RT@ RT ST@ FST  pST@ST ST@ST TT@BTT nTT@ TT 0TT@ TT  0UT@ BUT 0lUT@ UT 0UT@ UT VT@ FVT  pVT@VT VT@VT WT@DWT oWT@ WT 0WT@ WT 0XT@ BXT 0mXT@ XT 0XT@XT@YT@ MYT@ }YT@ YT@YT@ZT@ AZT@ qZT@ZT@ZT@[T@H[T@~[T@[T@[T@\T@S\T@\T@\T@\T@+]T@`]T@]T@ ]T@ ]T@ 5^T k^T ^T@^T@0^T@_T@ _T@0 :_T@ T_T@0 n_T@ _T@0 _T@ _T@0 _T@_T@0_T@_T@P`T@E`T@Pq`T@ `T@P `T@ `T@-aT@PWaT@aT@aT@aT@aT@'bT@PSbT@ bT@P bT@ bT@cT@=cT@jcT@cT@cT@cT@PdT@IdT@wdT@dT@dT@ dT@!eT@OeT@}eT@eT@eT@ fT@P6fT@ cfT@P fT@fT@fT@gT@BgT@mgT@gT@gT@gT@'hT@VhT@hT@hT@hT@hT@-iT@[iT@iT@iT@iT  'jTPfjT@PjT@PjT@PjT@ P#kT@ PVkT@ PkT@PkT@PkT@P"lT@PXlT@PlT@PlT@PlT@P0mT@PfmT@ PmT@ PmT@@PnT@@P3nT @P^nT@@PnT@@PnT@@PnT @PoT@@P,oT@@PZoT@@ PoT @ PoT@@ PoT@@ PpT@@ P1pT@@P`pT@@PpT @PpT@@PpT@@PqT @P1qT@@PVqT@@ PqT @ PqT@@ PqT@@ PqT@@P.rT@@P_rT@@ PrT@PrT@PrT@PsT@PNsT@}sT@ sT@ sT@sT@sT@sT@sT@tT@tT@sT@sT@sT@ sT@ sT@tT@:tT@WtT@ttT@tT wT(wT,wT@ xTP +xT!gY0?HxT@?_xTp?}xTp0xT`8xTxT@  yT,)yT RyT(oyT00yTyTP yTP?yT?yT 0zT05zTTzT zzTzT zT zT {T@{T@k{T`0{T`{TPP{TP{T  |T@|TI|Tt|T`|T|T|T "}T`S}T}T}T}T}T$~TE~Tv~T~T~T~T@00T@00*T@00PT wTT@0T@0TH0 T@06T@0XTH0T@ 0T@ 0΀TH 0T@P"TP4T FT[TT0TρT@TT8T0aT0TT!gY@ԂT@T@ T@0:T@@\T@P~T@`T@pƒT@T@T@(T@JT@lT@T@T@ T@0لT@@T@P T@`$T@p=T@VT@oT@T@T@T@ӅT@T@T@T@9T@ PT@0^T@@lT@PzT@T@T@T@ȆT@ ކT@ T  T  T 2T 2T@ 0?T@ MT@ - [T@ fT@ 0 |T@ T@ T@ T@ 0ЇT@  0T - T T 0 T 6T QT \T 0wT  0TTT T 0 ׈T T 'T@ @ QT@ P rT@ pT@ pPT@0 0ىT@0 0PT@ @)T@ PPOT@ P{T@ PT@ PT@ PҊT T T T 8T NT dT zT T T ՋT T T T -TCT [T qT T T T ЌT T T +T ?T RT kT T T T T T T@ p+T@ pDT@ ]T qT@ T T@ T T@ ֎T T T T@ P/T@ PKT@ PgT@ PT@ PT@ PƏT@ PT@ PT@ P7T@ PfT P T T ϐT @ T @  T P &T PCT@ P\T PuT@ PT PT@ PT PۑT@ PT PT@ P(T PBT@ P[T 0PuT@ 0PT 0PT@ 0PT PْT PT P T P TP P#TP P#T P;T P;TP PUTP PUT PoT PoT@ PT@ PT PT PT@ PT@ PTPӓTPT T+T0IT0gTTT0ŔT0T@ T@)T` MT`qT TT ݕTT #TFT iTTT ŖT`T@T'TJTmTTT֗TTTPCTpnTT TTT5T_T0T 0T@0əT`0T0 T03T0]T0TT ۚT0T 0(T@0KT`0nT0T0T0T0TIT wT@T`ӜTT;T uT0T PT PT@ PT@ P6T@ POT@ PiT PT PT PT PמT PT PT@ P-T@ PHT@ PcT@ PT@ PT@ PПT@ T@ T!gY/TiT 0T 0נT00T00FTT TT1T@ PoT T  T" PT"PT"P PHT"PPsT"PT"PΣT"PPT"PP.T ^T 0PrT @ PT @ pT T T @ PT @ P;T @ PWT P~T PT @ PT @ PɥT PT T @ T  0$T 06T PHT @ PcT P~T @ PT  T  ȦT T PT @ T @ P*T PDT @ P^T @ PxT @ T PT קT @ 0PT TI!gY!gY!gYtI!gY!gY!gY!gY!gYkGcQ!gY!gY!gY!gYRS!gYI"T `y/hy/py/y/}/xy/y/y/y/}/xy/y/y/y/}/xy/y/y/y/}/>TDT MM00`0TTTTTTyeI*T5TaTxTTTTTTTGGTVTcTTT1L1111111111P1 111 1M1\M1L1L1hM1M1M1M1JTH_PT_DT_VTp_dTT^,U\,U+UL+U +U*U*Ul*U )U,*U)Ul)U(U(U (U'Ul'U<'U,'U'U 'U+U+UWU^UeUmUuU~UUUUUUUUU!gYUU!gYBUPU!gYUUU4 (   33%333"3P33d/3t'3$3`333H33l ^0 ^T ^ ^( ^ ^ ^ ^8 ^^p^ ^^X^gEU_oL 9L TLLyJtEUzEU/U TTJ#QEU/UU EUEU EUUEUEUEUU4UOEU ,QHFUEUEUEUFU 9KUFU o&FUo5FUoQ oQ DFU oONFU JZFU=YIcL -L FL LTOLODO aFULLKUjFUsFUFUFUFUFUFUFUFUFUFUFU;WUEWUOWU]WUgWU sWU@WUWUWUWUWUWUFLTLLLLL-L9L-L9LcLoL|LLLL{LāLcUcUcUcU&L4LCLcUcUdU"dU5dUKҁLKҁLLLdLqLIdUXdUhdUwdUdUdUdUdUdUdUdUdUPfU$fUgUgUgUgUgUgUgUgUgUgUhUhUhUhUhU&hU.hU5hU=hUEhUMhUWhU]hUdhUkhUshUyhUhUhUhUhUhUhUhUhUhUhUhUhU hU hU hU hU iU iU iU %iU +iU4iU =iUEiU NiU WiU`iUkiU wiU~iUiUiUiUiUiUiUiUiUiUiUiUjU jUjU jU+jU6jUAjULjUWjUbjUmjUxjUjUjUjUjUjUjUjUjUjUjUjUkU kUkU#kU-kU7kUAkULkUVkUakUkkUukUfUkUkU kU kUkU kU kU kU kUkUkUkUkUkUkUlU lUlU&lU 6gU4lU;lU fU G =gU'gUfUfUfUfUfUfUfUfUfU fU fU fU fU 'gUSrULrUYrUkrUxrUrUrUrUrUrUrUrUrUrUsU$sU6sUJsUasUxsUsUsUsUsUsUsU tU$tU;tURtUitUtUtUtUtUtUtUtUuU#uU4uUKuUbuUyuUuUuUuUuUuUvUvU4vUKvUbvUyvUvUvUvUvUvUvUwU+wUDwUXwUfwUwwUwUwUwUwUwUwUwU xU"xU4xUFxU\xUrxUxUxUxUxUxUxUyU)yU>yUSyUhyUyUyUyUyUzUzU4zUKzUbzUuzUzUzUzUzUzUzU {U%{U={UU{Ug{Uy{U{U{U{U{U{U{U |U|U8|UL|Uc|Uz|U|U|U|U|U|U}U4}UQ}Um}U}U}U}U}U}U~U4~UO~Uj~U~U~U~U~U~UU4UPUcUvUUUUUUUUU1UDUXUlUUUUрUUUU1UIUbU}UUUUցUUUU+UDU`UyUUUʂUUUU3UKU^UvUUUUƒUуUUUU)UAUWUoUUUUׄUUU6UVUmUUUȅUUU U;UVUqUUUUچUU UU:URUoUUUUۇUUU%U=UUUrUUUU܈UUU U8UNUeUUUUʉUUUU&U?U[UwUUUŊUUUU2UVUuUUU֋UU U*UMUkUUUU͌UUU UU.UCUVUiU{UUUUЍUUUU&UU[UxUUUUܙUUU5URUiUUUUȚUUUUU0UGUYUsUUUU؛UUUU0UHUbU|UUUӜUUU U8UQUlUUUUםUUUU7UOUgUUUUǞUߞUUU8UWUvUUUʟUUU U%U=UWUpUUUUϠUUU#U=UZUsUUUơUUUU5UTUpUUUĢUUUUUVUhUzUUUUնUUU6ULUbUxUUUķUUUU)UCU[UtUUUUĸU۸UUUU/UDUYUkUUUUɹU߹UUUU-U?UQUdU|UUUUкUUUU*UCUYUsUUUŻUܻUUU%U?U\UxUUUƼUUU U%U=UUUkUUUUɽUUU U U3UGU^UuUUUU˾UUU"U;UZUpUUUUͿUUUU-UGU`UsUUUUUU U U0UAURUcUtUUUUUUUUU6UJUaUyUUUUUUUU*U?UXUoUUUUUUUU5UPUhUUUUUUUUU(U?UVUmUUUUUUUU2ULUeU~UUUUUUU7UMUdU{UUUUUUU3URUiU~UUUUUU%UHUiUUUUUUUU'U;UOUdUxUUUUUUU UU2UFU[UpUUUUUUU U"U;UMUeUUUUUUUUU)UUVUmUUUUUUUU#U:UTUlUUUUUUUV!V6VLVeV|VVVVVVVV1VHV_VvVVVVVVVV/VDV\VtVVVVVVV!V;VRVjVVVVVVVV3VLVdV}VVVVVVV(VBV\VxVVVVVV,VGVbV}VVVVVVV1VIVaVyVVVVVVVV0VGV_VyVVVVV V V4 VM Vh V V V V V V V V2 VM Vd V{ V V V V V V V V, VE V] Vu V V V V V V V V, VD V\ Vp V V V V V V V V' V? VW Vp V V V V V V VVV,VAVVVlVVVVVVVV/VGVZVmVVVVVVVVV0VDVWVkVVVVVVVVV3VMVeVVVVVVVV.VFV\VrVVVVVVV(V=VPViVVVVVVVV+V@VZVnVVVVVVVV*V@V\VpVVVVVV V$V@V\VxVVVVVVV9VTVoVVVVVVV$V9VNVcVyVVVVVVVV+V?VSVjVVVVVVVVV1VKV_V~VVVVVV!VBVbVVVVVVV0VJVbV|VVVVVV V$V9VNVcVxVVVVVVVV)VCV]VvVVVVVVV)VDV^VsVVVVVV V V8 VP Vg V V V V V V !V&!V>!VX!Vr!V!V!V!V!V!V"V"V-"VC"V["Vt"V"V"V"V"V"V#V,#VF#V`#Vz#V#V#V#V#V#V $V$$V>$VX$Vr$V$V$V$V$V$V%V+%VF%Va%V|%V%V%V%V%V&V&V9&VT&Vo&V&V&V&V&V&V'V%'V:'VV'Vt'V'V'V'V'V'V(V1(VI(Vb(V{(V(V(V(V(V(V)V)V))V=)VQ)Ve)Vy)V)V)V)V)V)V)V*V+*VC*V[*Vs*V*V*V*V*V*V +V@+V\+V}+V+V+V+V+V,VD,Vn,V,V,V,V,V -V/-VL-Vj-V-V-V-V-V-V.V4.VR.Vt.V.V.V.V.V/V?/V]/Vt/V/V/V/V/V/V0V0V50VR0Vl0V0V0V0V0V0V1V.1VM1Vo1V1V1V1V1V2V02VQ2Vr2V2V2V2V2V3V3V53VS3Vq3V3V3V3V3V4V34VW4Vx4V4V4V4V5V)5VM5Vp5V5V5V5V6VC6Vo6V6V6V6V7V77VZ7V}7V7V7V8V/8VZ8V8V8V8V9V09VW9V9V9V9V9V:VC:Vl:V:V:V:V;V;;Ve;V;V;V;VV#>V@>V]>Vy>V>V>V>V>V ?V5?Va?V?V?V?V@V&@V=@VX@Vs@V@V@V@V@VAVAV7AVQAVpAVAVAVAVAVBVBVGVcGVGVGVGVGVHV;HV`HVHVHVHVHVIV(IVJIVoIVIVIVIVJV(JV=JVRJVgJV|JVJVJVJVJVJVKV.KVHKVdKVKVKVKVKVKVLV#LV@LV\LVvLVLVLVLVLVLVMV8MVVMVtMVMVMVMVMVNV7NVZNV}NVNVNVNV OV0OVTOVxOVOVOVOVPV;PVdPVPVPVPVPV"QVJQVrQVQVQVQVRV8RV_RVRVRVRVRV SVESVjSVSVSVSVTViK %HTiKTiKKiK KiK VVVVbiKbiKYiKYiK W W 6IGqiK TiKhiKhiKIIV V V V V V GRGRVV>I>IGIGIkVkVte)He)Ha}V}VV bVVV sYK VFV i1K V1V oLK %V1WV d>K eV2V5W}gIVSV4gIQ5gIfY5gISVSV VV#VneI oULN6MSSVogIhV VhGjK ScS SFMahUSVjKiGgIR$QV*)SxOVVKVHSG.gIVI VI#VI&VIGzgIQH`QGVpSS)VugI}XvgIT,V O+gIGNI8VigI;VlgI HiJjRFMH7EJNXgIG1gIGiJSYXklOgI>VgIAV7gIshHLDVfgIWIGV:gI# PI}GIPMVJrUJVrgIMVygISaST5SYQ3NPPV +VPV QbeI eIZV%HjKSXjKYHS@V&X%X4#X'X%X #X#X"X"X #X"X|"X \+XH+Xd?d?d?d?d?d?d?d?d?d?d?d?d?d??\?????X?U@Lw3NU@Lw3aU@Lw3tU@Lw3U@Lw3U@Lw3U@Lw3U@Lw3U@Lw3U@Lw3U@ Lw3U Lw3U Lw3U //Lw3 ULw3U b Lw3*U!b Lw3>U"b Lw3SU#bLw3iU$B Lw3~U%BLw3U&Lw3U'Lw3U(Lw3U)Lw3U* Lw3U+Lw3U,@Lw3U- Lw3U.@ Lw3#U/ppLw33U0@ppLw3IU1 ppLw3\U2@ ppLw3sU3 /?/?Lw3U41 Lw3U5j Lw3U6j Lw3U7Lw3U8Lw3U9 Lw3U: Lw3U; Lw3U< Lw3%U= Lw35U> Lw3EU? Lw3UU@ Lw3eUA Lw3vUB Lw3UC Lw3UD Lw3UE Lw3UF Lw3UG Lw3UH Lw3UI Lw3UJ Lw3UK Lw3UL Lw3.UM Lw3>UN Lw3NUO Lw3_UP Lw3pUQ Lw3UR Lw3US Lw3UTLw3UU@Lw3UVLw3UWppLw3UX@ppLw3UYppLw3UZ@#U[Lw35U\Lw3DU]Lw3VU^Lw3iU_Lw3yU` Lw3Uab@Lw3Ubb@Lw3UcdD%4UeUfY Lw3UgA Lw3Uh@Ui@Lw3 Uj@Lw3Uk@,Ul@;Umb@Lw3JUnb@Lw3ZUob@Lw3iUpqrstuvwxyz{|}~Lw3zU@Lw3U@Lw3U@Lw3U@Lw3U Lw3Ua Lw3U Lw3U@Lw3U@Lw3U@Lw3U@Lw3 U@Lw3U@Lw3.U@Lw3CU@Lw3YULw3ULw3ULw3ULw3U (A$1l1@11p412(3@3@11244D?24201` 3@52h\2k21tw211p3H5H51114L211Q5Q3111@11d11X5 6 6 6 62=3G3,155 5)5h4h1p3l40H^ (5U$U1p81p1'14i4\i4 n4N>U?/XF1xF1G1(F1]U?/XF1xF1G1(F1U?/XF1xF1G1(F14 (   33%333"3l11d/3t'3$3`333H33\eU?/XF1xF1G1(F1^W^^WL^Е^(=\==^W^^==|=^W^^=$==^TW P^^PWP^|^MW^HW x^^DWx^|^AW^I>4l=4l=l=$J>4l=4l=DJ>^W^Ě^K>K>4l=4l=DJ>^W^^W0^^W^^W^^ W^^1W^^CW0^^VW0^^jW^^M>M>DL>^L>L>DL> ^ N>@N>DL>^N>N>DL>$^N>0O>DL>0^LL>L>DL><^M>8M>DL>H^TM>M>DL>T^\N>N>DL>DX>TX>nXй>X>X>X>>X$>X>X8>>X>2X>IX?E?,E^G^G^ L^F^F^J^J^J^PK^K^K^,E^G^G^ L^F^F^J^J^J^PK^K^K^pXpXpXW PW PW PW PW PW PW PW PW PW PW PW PW PXPX>PXX8>>glibc.rtld.nnsglibc.elision.skip_lock_after_retriesglibc.malloc.trim_thresholdMALLOC_TRIM_THRESHOLD_glibc.malloc.perturbMALLOC_PERTURB_glibc.pthread.rseqglibc.mem.taggingglibc.elision.triesglibc.elision.enableglibc.malloc.hugetlbglibc.malloc.mxfastglibc.rtld.dynamic_sortglibc.elision.skip_lock_busyglibc.malloc.top_padMALLOC_TOP_PAD_glibc.pthread.stack_cache_sizeglibc.cpu.hwcap_mask@LD_HWCAP_MASKglibc.malloc.mmap_maxMALLOC_MMAP_MAX_glibc.elision.skip_trylock_internal_abortglibc.malloc.tcache_unsorted_limitglibc.elision.skip_lock_internal_abortglibc.malloc.arena_maxMALLOC_ARENA_MAXglibc.malloc.mmap_thresholdMALLOC_MMAP_THRESHOLD_glibc.malloc.tcache_countglibc.malloc.arena_testMALLOC_ARENA_TESTglibc.pthread.mutex_spin_countdglibc.rtld.optional_static_tlsglibc.malloc.tcache_maxglibc.malloc.checkMALLOC_CHECK_&_0@@@F<@@ FFF E E E E`lp0Ax^/^4^]D`^([/^$@@/\N>cF`$^^L^l&_(^K^(XWК^^\&_T9^h`4vY3t` h=`\A,E^T`^la/^|<H^V1W^ A^^J^y>^[/ `W4&_Z/|`D ^@_H3` h_ A;@/_В^L_l`:W^^0` d_^!_`0<=@``y>&_T_``p _LTM>N=L>T^X`^0l^\Ct^0^\`x._^^T,=/p/`^[/G^8'_`^G^|``@^D3=x^:Z/haDhU;,8^'_^)W`^TM>l?/N>`d`0^Y3d,W`AGeT8`x``p[/0`W '_`8x<@=&_D9^``D_<^x`?]/H_t`d/^LWLL>J^l`إAh(j9 N>V/W Xh``5 [/\`|._``@'_^&_P_^ğAJ=P`H` L^[`J^Е^^T^48V=Ԕ^L`K^^,hc=d^0@`x^^t^ PN=Б?x._&_*_t=XN;G^wwppOwO $$lLh1BkGkGkGkGLh1h^:::j-HXz-H9`2-H99<-H:99L\Q9MJWtHtHtH'tH4tH8tHCtH SqHPtHXtH`tHgtHotHMwtHtH#WVtHtH tH@tHtHtHtHtHtHtH WtHtH tH@!HaIIWStHJWtHuH uHuHuH uH?WUW:HCIEIT$d4CI!JkGkGkGIKJĠJJ!gYkG@0':=$<=%>=&::!OR)IN(AND*ABSCHRDECNOT/DIV+INCMAXMINMOD,ODDCAPORDVALEXCL HIGHINCLSIZEFLOATTRUNCTSIZEkOlOp9`QQ{TlO<9`T<9`lO<9` lO@9` lOw`Ww`lOBlOt8`HfkYfG o)JH9`a1U TsQsFHeTeȭPc_Qc OpTpPxAlOXpVD9`[UL9`^Ux[HX)lOOKO<`]OhOO<`sO<`OhOO8<`5O<`'O@<`JO<`O\<`O <`O(<`O<`O<`O,<`-WOïOHܯOO6O/OO`tO <`O<`)O0DOSOjOO(O OdOOO<`OLİOаOڰOܵO0O OjOOO,5O:O@O!&LVO[OqOO,eO OyQOOO5N<`DZO˱OбOܱOO2OOO"Od(O;*O8OOXMOй]O nOhO8 WO O OO<`OO|& O&7OX'"O&JO+hO+O>SDzOжղOܲOO*QO O<O*O=OyHKOWOgO<`uO4O<`DOOOԼOOijOϳOڳOOOHO OO3O(AO&SO`bOqO8OxOO,Op%4O@ODOHO OtST>T3O9O_OdOiOLrTOOTOOOPOOOY#O-OFOQO`O8O~OOpBOOOTOOO؃N OO\.OQ0)Q'QsP;QP#`;"$'",!,wQvQ ZQop$RRRR;Rr`hcRcRcRbRbRRNames of targets and files being debugged. Shows the entire stack of targets currently in use (including the exec-file, core-file, and process, if any), as well as the symbol file name.R_$Sh$SSp$Sv$S$S$S^mJSS6MigI7EJMiJfgIIIlgIFMogI*)SrgI5SgI7gIL}gI4gI5gIKHS1gIYXugIvgI+gINIygIzgI3NV.gISOHSHSOHSHSKHSHS!gY!gYkO   PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžx_l_l___ @_l`_,_,,_ p _x`_,_,,_ `!_,_,,__@_p _d@ "_A3QX3QX?!gY!gYmX!gYH'_ *_*_`(_)_(_)_H'_H'_(_H'_!gY"@P6G6G6GL7GGT>G>G